| Basic Information | |
|---|---|
| Family ID | F087667 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 51 residues |
| Representative Sequence | QARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 78.18 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.636 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.68% β-sheet: 0.00% Coil/Unstructured: 51.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF09361 | Phasin_2 | 29.09 |
| PF04773 | FecR | 8.18 |
| PF00571 | CBS | 6.36 |
| PF12244 | DUF3606 | 2.73 |
| PF00313 | CSD | 1.82 |
| PF00171 | Aldedh | 1.82 |
| PF12625 | Arabinose_bd | 1.82 |
| PF00072 | Response_reg | 0.91 |
| PF00118 | Cpn60_TCP1 | 0.91 |
| PF08386 | Abhydrolase_4 | 0.91 |
| PF00574 | CLP_protease | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.82 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.82 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.82 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.64 % |
| Unclassified | root | N/A | 26.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17497182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1381 | Open in IMG/M |
| 3300000559|F14TC_100433312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1155 | Open in IMG/M |
| 3300001904|JGI24736J21556_1043697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 688 | Open in IMG/M |
| 3300001976|JGI24752J21851_1025658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 773 | Open in IMG/M |
| 3300002120|C687J26616_10122707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300003994|Ga0055435_10255964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
| 3300004019|Ga0055439_10305977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 525 | Open in IMG/M |
| 3300004058|Ga0055498_10060788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 690 | Open in IMG/M |
| 3300004062|Ga0055500_10074884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 718 | Open in IMG/M |
| 3300004067|Ga0055485_10040229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1018 | Open in IMG/M |
| 3300004145|Ga0055489_10307341 | Not Available | 510 | Open in IMG/M |
| 3300004156|Ga0062589_100316290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp. | 1217 | Open in IMG/M |
| 3300004463|Ga0063356_105477292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 545 | Open in IMG/M |
| 3300004803|Ga0058862_11078176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 574 | Open in IMG/M |
| 3300005093|Ga0062594_100030327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2468 | Open in IMG/M |
| 3300005290|Ga0065712_10220392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1043 | Open in IMG/M |
| 3300005330|Ga0070690_100853576 | Not Available | 709 | Open in IMG/M |
| 3300005338|Ga0068868_101220823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 696 | Open in IMG/M |
| 3300005339|Ga0070660_100433101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1090 | Open in IMG/M |
| 3300005339|Ga0070660_101011110 | Not Available | 702 | Open in IMG/M |
| 3300005355|Ga0070671_102129912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 500 | Open in IMG/M |
| 3300005439|Ga0070711_100262747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1359 | Open in IMG/M |
| 3300005439|Ga0070711_101288337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 634 | Open in IMG/M |
| 3300005444|Ga0070694_101599452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 553 | Open in IMG/M |
| 3300005546|Ga0070696_100756637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 796 | Open in IMG/M |
| 3300005578|Ga0068854_102048258 | Not Available | 528 | Open in IMG/M |
| 3300005614|Ga0068856_102323165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 544 | Open in IMG/M |
| 3300005719|Ga0068861_102283343 | Not Available | 543 | Open in IMG/M |
| 3300005841|Ga0068863_101187083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 769 | Open in IMG/M |
| 3300006173|Ga0070716_100142158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1532 | Open in IMG/M |
| 3300006755|Ga0079222_12467378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 522 | Open in IMG/M |
| 3300006845|Ga0075421_101479264 | Not Available | 744 | Open in IMG/M |
| 3300006954|Ga0079219_10978469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 698 | Open in IMG/M |
| 3300009011|Ga0105251_10657881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 501 | Open in IMG/M |
| 3300009094|Ga0111539_10198195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2342 | Open in IMG/M |
| 3300009101|Ga0105247_10946073 | Not Available | 669 | Open in IMG/M |
| 3300009148|Ga0105243_10818966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 919 | Open in IMG/M |
| 3300009153|Ga0105094_10605713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 640 | Open in IMG/M |
| 3300009156|Ga0111538_13621976 | Not Available | 535 | Open in IMG/M |
| 3300009157|Ga0105092_10035456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 2655 | Open in IMG/M |
| 3300009168|Ga0105104_10272667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter | 926 | Open in IMG/M |
| 3300009168|Ga0105104_10443017 | Not Available | 726 | Open in IMG/M |
| 3300009174|Ga0105241_11733716 | Not Available | 608 | Open in IMG/M |
| 3300009818|Ga0105072_1048361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 807 | Open in IMG/M |
| 3300012901|Ga0157288_10018220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1303 | Open in IMG/M |
| 3300012904|Ga0157282_10107216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 793 | Open in IMG/M |
| 3300012958|Ga0164299_10104396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1480 | Open in IMG/M |
| 3300012960|Ga0164301_11111065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300012964|Ga0153916_11899156 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012984|Ga0164309_11950931 | Not Available | 503 | Open in IMG/M |
| 3300012987|Ga0164307_10596675 | Not Available | 851 | Open in IMG/M |
| 3300012987|Ga0164307_11005584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 679 | Open in IMG/M |
| 3300013096|Ga0157307_1061193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 727 | Open in IMG/M |
| 3300013306|Ga0163162_13185265 | Not Available | 527 | Open in IMG/M |
| 3300014271|Ga0075326_1202904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 596 | Open in IMG/M |
| 3300014325|Ga0163163_10410700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1412 | Open in IMG/M |
| 3300014325|Ga0163163_12496040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 575 | Open in IMG/M |
| 3300014326|Ga0157380_12734374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 560 | Open in IMG/M |
| 3300014745|Ga0157377_10867850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp. | 672 | Open in IMG/M |
| 3300015077|Ga0173483_10042342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1709 | Open in IMG/M |
| 3300015374|Ga0132255_103271338 | Not Available | 690 | Open in IMG/M |
| 3300016270|Ga0182036_10703664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 817 | Open in IMG/M |
| 3300018422|Ga0190265_11692449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 743 | Open in IMG/M |
| 3300018920|Ga0190273_12428661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 500 | Open in IMG/M |
| 3300019356|Ga0173481_10723882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 540 | Open in IMG/M |
| 3300019362|Ga0173479_10106701 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300023064|Ga0247801_1085138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 520 | Open in IMG/M |
| 3300025119|Ga0209126_1034078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1543 | Open in IMG/M |
| 3300025900|Ga0207710_10746515 | Not Available | 514 | Open in IMG/M |
| 3300025912|Ga0207707_11608439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 511 | Open in IMG/M |
| 3300025916|Ga0207663_10519110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp. | 927 | Open in IMG/M |
| 3300025921|Ga0207652_11772912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 522 | Open in IMG/M |
| 3300025930|Ga0207701_11202732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 625 | Open in IMG/M |
| 3300025932|Ga0207690_10282986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1292 | Open in IMG/M |
| 3300025933|Ga0207706_11714407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 505 | Open in IMG/M |
| 3300025939|Ga0207665_10240880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sneathiellales → Sneathiellaceae → Sneathiella → unclassified Sneathiella → Sneathiella sp. | 1333 | Open in IMG/M |
| 3300025939|Ga0207665_10720546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 785 | Open in IMG/M |
| 3300026075|Ga0207708_11650087 | Not Available | 563 | Open in IMG/M |
| 3300026088|Ga0207641_11279107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 734 | Open in IMG/M |
| 3300026494|Ga0257159_1079252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 569 | Open in IMG/M |
| 3300026872|Ga0207785_1015288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 676 | Open in IMG/M |
| 3300026945|Ga0207743_1028843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 563 | Open in IMG/M |
| 3300027787|Ga0209074_10106366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 956 | Open in IMG/M |
| 3300027955|Ga0209078_1215587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 512 | Open in IMG/M |
| 3300030019|Ga0311348_10429571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 987 | Open in IMG/M |
| 3300030114|Ga0311333_10247421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1402 | Open in IMG/M |
| 3300031232|Ga0302323_100995634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 931 | Open in IMG/M |
| 3300031255|Ga0315554_1094285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1115 | Open in IMG/M |
| 3300031276|Ga0307441_1184514 | Not Available | 599 | Open in IMG/M |
| 3300031368|Ga0307429_1162464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 590 | Open in IMG/M |
| 3300031424|Ga0308179_1017277 | Not Available | 764 | Open in IMG/M |
| 3300031545|Ga0318541_10493636 | Not Available | 685 | Open in IMG/M |
| 3300031847|Ga0310907_10089439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1303 | Open in IMG/M |
| 3300031890|Ga0306925_12165167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 518 | Open in IMG/M |
| 3300031910|Ga0306923_11097203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 857 | Open in IMG/M |
| 3300031941|Ga0310912_11124971 | Not Available | 599 | Open in IMG/M |
| 3300031943|Ga0310885_10622965 | Not Available | 600 | Open in IMG/M |
| 3300031944|Ga0310884_10244488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 978 | Open in IMG/M |
| 3300031946|Ga0310910_10634826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 846 | Open in IMG/M |
| 3300031949|Ga0214473_10028854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6504 | Open in IMG/M |
| 3300032205|Ga0307472_100391115 | Not Available | 1159 | Open in IMG/M |
| 3300033417|Ga0214471_10213107 | Not Available | 1584 | Open in IMG/M |
| 3300033475|Ga0310811_10327803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1738 | Open in IMG/M |
| 3300034692|Ga0373917_0019546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 895 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.18% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.91% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.91% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Host-Associated | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300025119 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
| 3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031255 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-70 | Environmental | Open in IMG/M |
| 3300031276 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-20 | Environmental | Open in IMG/M |
| 3300031368 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230 | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034692 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03177570 | 2088090014 | Soil | VEVQARDPFRDFERDSELKTAIGQKLSMLAADGVTDPIELREWALEGFLLR |
| F14TC_1004333121 | 3300000559 | Soil | WVEVQARDPFRDFERDSELKTAIGQKLSMLAVDGVTDPIELREWALEGFLLR* |
| JGI24736J21556_10436971 | 3300001904 | Corn Rhizosphere | EATWTALQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR* |
| JGI24752J21851_10256581 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | VEQAFEATWTALQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR* |
| C687J26616_101227072 | 3300002120 | Soil | RAFDATWTVLQARDPFRDFDTDNELKTELSHKLSALAADGVTDAIELREWALEGLSGHR* |
| Ga0055435_102559641 | 3300003994 | Natural And Restored Wetlands | RDPLRDFEQDYELKTALSRKLMGLAADGVTDPIELREWALEGLPR* |
| Ga0055439_103059771 | 3300004019 | Natural And Restored Wetlands | WTVLQASDPFRDFEQNHELKTALSRKLMGLAADGVTDPIELREWALEGLPR* |
| Ga0055498_100607882 | 3300004058 | Natural And Restored Wetlands | ALGEAFDATWVVLQARDPFRDFERAYELRTALSQKLMTLAADGVTDPIELREWALESLPLN* |
| Ga0055500_100748841 | 3300004062 | Natural And Restored Wetlands | TVEQAFDAAWTVLQARDPLRDFEQDYELKTALSRKLMGLAADGVTDPIELREWALEGLPR |
| Ga0055485_100402293 | 3300004067 | Natural And Restored Wetlands | SSWVMLQARNPFRDFERDLDLKSTLSLKLTALAADGVTDPVELREWALESLPLR* |
| Ga0055489_103073411 | 3300004145 | Natural And Restored Wetlands | LDATWTVLQARDPLRDLEQDYELKTALSRKLIGLAADGVTDRIELREWALEGLPR* |
| Ga0062589_1003162902 | 3300004156 | Soil | VQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR* |
| Ga0063356_1054772921 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DATWVEVQVRDPFRDFERDSELKTAIDQKLLTLAADGVTDPVELREWALEGLSLR* |
| Ga0058862_110781761 | 3300004803 | Host-Associated | QAFDATWVVVQARDPFRDFERDFELKTALSQKLMMLAAEGVTDPIELREWALEGLLLR* |
| Ga0062594_1000303271 | 3300005093 | Soil | VVLQARDPFRDFERDSELRTALNQKLMTLAADGVTDPIELREWALESILLS* |
| Ga0065712_102203923 | 3300005290 | Miscanthus Rhizosphere | WTALQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR* |
| Ga0070690_1008535762 | 3300005330 | Switchgrass Rhizosphere | FERDLELKTAINQKLCAFARDGVTDPVELREWALESLRLR* |
| Ga0068868_1012208231 | 3300005338 | Miscanthus Rhizosphere | DATWVVLQARDPFRDFERIYELRTALSQKLVALAADGVTDPIELREWALEGLPG* |
| Ga0070660_1004331011 | 3300005339 | Corn Rhizosphere | LQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR* |
| Ga0070660_1010111102 | 3300005339 | Corn Rhizosphere | VQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELRECALECFLLR* |
| Ga0070671_1021299121 | 3300005355 | Switchgrass Rhizosphere | FRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR* |
| Ga0070711_1002627472 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VQARDPFRDFERDSELKTAISQKLSMLAVNGVTDPIELREWALEGFLLR* |
| Ga0070711_1012883372 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RYPFRDFERDSELKTALGQKLFTLATEGVTDPIELREWALESTLLR* |
| Ga0070694_1015994522 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | QARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR* |
| Ga0070696_1007566372 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LTQAFDATWVVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR |
| Ga0068854_1020482582 | 3300005578 | Corn Rhizosphere | WVEVQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR* |
| Ga0068856_1023231652 | 3300005614 | Corn Rhizosphere | ASWTALQARDPFRDFDRDNELKTDLSQRLAALVADGVTDPIELREWSLESLPLTQ* |
| Ga0068861_1022833432 | 3300005719 | Switchgrass Rhizosphere | ATWLEVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR* |
| Ga0068863_1011870832 | 3300005841 | Switchgrass Rhizosphere | VVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR* |
| Ga0070716_1001421584 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VQARDPFRDFESDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR* |
| Ga0079222_124673781 | 3300006755 | Agricultural Soil | ALQARDPFRDFERDYELKTTLRRKLMGLAIDGVTDPIELREWALEGLPR* |
| Ga0075421_1014792642 | 3300006845 | Populus Rhizosphere | ATWVVLQARDPFRDFDRDSELRTALNQKLRTLVADGVRDPIELREWALESLLLS* |
| Ga0079219_109784691 | 3300006954 | Agricultural Soil | DRDGRDRFRDFEWDYELKTTLRRKLMGLPVDGVTDPIELGQWALEGLPR* |
| Ga0105251_106578812 | 3300009011 | Switchgrass Rhizosphere | VVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR* |
| Ga0111539_101981953 | 3300009094 | Populus Rhizosphere | VQARDPFRDFERDSELKTAIGQKLSMLAVDGVTDPIELREWALEGFLLR* |
| Ga0105247_109460732 | 3300009101 | Switchgrass Rhizosphere | VQARDPFRDFERDSELKTATSQKLSMLAVDGVTDPIELREWALEGFLLR* |
| Ga0105243_108189664 | 3300009148 | Miscanthus Rhizosphere | QARDPFRDFERDSELRTALNRKLMTLAVDGVTDPIELREWALEGLPR* |
| Ga0105094_106057131 | 3300009153 | Freshwater Sediment | MLQARDPFRDFERAYELRTALSQKLMTLAADGVTDPIELREWALESLPLN* |
| Ga0111538_136219761 | 3300009156 | Populus Rhizosphere | VEVQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALENLRLR* |
| Ga0105092_100354566 | 3300009157 | Freshwater Sediment | MVQARDPLRDFERDSELRTALNRKLMTLVANGVTDPVELREWALESLLLS* |
| Ga0105104_102726673 | 3300009168 | Freshwater Sediment | MVQARDPFRDFDRDSELRTALNRKLMTLVADGVTDPTELREWALESLLLS* |
| Ga0105104_104430171 | 3300009168 | Freshwater Sediment | MTDAIKEAFEATWVVVQARDPFRDFERDFELRAALSRKLKMLSSEGVSEPVELREWALESLPLN* |
| Ga0105241_117337161 | 3300009174 | Corn Rhizosphere | HLGGVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR* |
| Ga0105072_10483611 | 3300009818 | Groundwater Sand | RAFDATWIVLQARDPFRDFDTDNELKTELSHELSALAADGVTDAVELREWALEGLSGHR* |
| Ga0134127_110758771 | 3300010399 | Terrestrial Soil | PKTAINQKLCALARDGVTDPVELREWALEGLRLR* |
| Ga0157288_100182201 | 3300012901 | Soil | TWTALQARDPFRDFERDYELKTTLRRKLMGLAVDGVTDPIELREWALEGLPR* |
| Ga0157282_101072161 | 3300012904 | Soil | WTALQARDPFRDFERDYEWKTTLRRKLMGLAVDGVTDPIELREWALEGLPR* |
| Ga0164299_101043963 | 3300012958 | Soil | PFRDFERDLELKTAINQRLCALTRDGVTDPVELREWTLEGLRLR* |
| Ga0164301_111110651 | 3300012960 | Soil | FDSSWVVLQARYPFRDFERDSELKTALGQKLFTLATEGVTDPIELREWALESTLLR* |
| Ga0164301_112360471 | 3300012960 | Soil | VRDPFRDFDKDNDVKSELSHELMGLAAEGVTDPIELREWALESLGGYR* |
| Ga0153916_118991561 | 3300012964 | Freshwater Wetlands | ARDPFGDFERVYELRTALSQKLVALAADGVTDPIELREWALEGLPR* |
| Ga0164309_119509311 | 3300012984 | Soil | LRQAFNATWVEVQARDPFRDFERDLELKTAINQRLCALTRDGVTDPVELREWTLEGLRLR |
| Ga0164307_105966752 | 3300012987 | Soil | QAFNAAWVEVQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWTLEGLRLR* |
| Ga0164307_110055841 | 3300012987 | Soil | QWKALQACDPFRDFERGYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR* |
| Ga0157307_10611931 | 3300013096 | Soil | ARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR* |
| Ga0157374_105107133 | 3300013296 | Miscanthus Rhizosphere | RDFERDSELKTAIGQKLSMLAADGVTDPIELREWALEGFLLR* |
| Ga0163162_131852652 | 3300013306 | Switchgrass Rhizosphere | ARRIMEAEQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR* |
| Ga0075326_12029041 | 3300014271 | Natural And Restored Wetlands | MLQTRDPFRDFERDSELKTDIGLKLMALAADGVTDPVELREWALESLPPR* |
| Ga0163163_104107004 | 3300014325 | Switchgrass Rhizosphere | LDALGEAFDAIWVVLHVRDPFRDFERVYELRTALSQKLVALAADGVTDPVELREWALEGLPR* |
| Ga0163163_124960401 | 3300014325 | Switchgrass Rhizosphere | FDATWVVLQARDPFRDFERDSELRTALNQKLMTLAADGVTDPIELREWALESLLLS* |
| Ga0157380_127343742 | 3300014326 | Switchgrass Rhizosphere | RDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR* |
| Ga0157377_108678501 | 3300014745 | Miscanthus Rhizosphere | RDPFRDFERDSELKTAIRQKLSMLAVDGVTDPIELREWALEGFLLR* |
| Ga0173483_100423421 | 3300015077 | Soil | EQAFEATWTALQARDPFRDFERDYELKTTLRRKLKGLAVDGVTDPIELREWALEGLPR* |
| Ga0132255_1032713381 | 3300015374 | Arabidopsis Rhizosphere | QARDPFRDFERDSELKIAINQKLWALAMDGVTDAVELREWALEGLRLR* |
| Ga0182036_107036642 | 3300016270 | Soil | DPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR |
| Ga0190265_116924492 | 3300018422 | Soil | FRDFERDFELRAALSRKLKMLSSEGVSDPVELREWALENLLLS |
| Ga0190273_124286612 | 3300018920 | Soil | FNATWTALQARDPLRDFEQDYELKIALNRKLMGLAADGVTDPIELREWALEGLPR |
| Ga0173481_107238822 | 3300019356 | Soil | FNATWTVLQARDPLRDFEQDYELKIALNRKLMGLAADGVTDPIELQEWALEGLPR |
| Ga0173479_101067013 | 3300019362 | Soil | LQARDPFRDFERDYELKATLRRKLMGLAVDGVTDPIELREWALEGLPR |
| Ga0173479_107784892 | 3300019362 | Soil | QAFNATWVEVQARDPFRDLERDSALKTAINQKLWALARDGVTDPVELRGP |
| Ga0247801_10851381 | 3300023064 | Soil | VLQAREPLRDFEQDYELKIALNRKLMGLAADGVTDPIELQEWALEGLPR |
| Ga0209126_10340786 | 3300025119 | Soil | FNATWTVLQARDPLRDFEQDYELKIALNRKLMGLAADGVTDPIELREWALEGLPR |
| Ga0207710_107465151 | 3300025900 | Switchgrass Rhizosphere | VQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR |
| Ga0207707_116084391 | 3300025912 | Corn Rhizosphere | RDPFRDFERIYELRTALSQKLVALAADGVTDPIELREWALEGLPG |
| Ga0207663_105191102 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EVQARDPFRDFERDSELKTAISQKLSMLAVNGVTDPIELREWALEGFLLR |
| Ga0207652_117729121 | 3300025921 | Corn Rhizosphere | GGVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR |
| Ga0207701_112027321 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLQARDPLHDFEQDYELKIALNRKLMGLAADGVTDPIELQEWALEGLPR |
| Ga0207690_102829865 | 3300025932 | Corn Rhizosphere | ARDPFRDFDRDNELKTDLSQRLAALVADGVTDPIELREWSLESLPLTQ |
| Ga0207706_117144071 | 3300025933 | Corn Rhizosphere | ADALREAFDATWVVLQARDPFRDFERDSELRTALNQKLMTLAADGVTDPIELREWALESLLLS |
| Ga0207665_102408804 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | WVEVQARDPFRDFERDSELKTAIGQKLSMLAADGVTDPIELREWALEGFLLR |
| Ga0207665_107205461 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EALTQAFDATWVVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR |
| Ga0207708_116500872 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LEVQARDPFRDFERDSELKTAISQKLSMLAVDGVTDPIELREWALEGFLLR |
| Ga0207641_112791072 | 3300026088 | Switchgrass Rhizosphere | WVVVQARDPFRDFERDFELKTALSQKLMTLAADGVTDPIELREWALEGLLLR |
| Ga0257159_10792522 | 3300026494 | Soil | VEQAFDATWTVLQARDPLRDFEQDYELKTALSRKLMGLAADGVTDPIELREWALEGLPR |
| Ga0207785_10152882 | 3300026872 | Tropical Forest Soil | TWVKVQARDPFRDFERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR |
| Ga0207743_10288432 | 3300026945 | Tropical Forest Soil | ATWVEVQARDPFRDLERDSELKIAINQKLWALARDGVTDPAELREWALESLRLR |
| Ga0209074_101063661 | 3300027787 | Agricultural Soil | WRALQARDPFRDFERDYELKTTLRRKLMGLAIDGVTDPIELREWALEGLPR |
| Ga0209078_12155871 | 3300027955 | Freshwater Sediment | DPFRDFERAYELRTALSQKLMTLAADGVTDPIELREWALESLPLN |
| Ga0311348_104295711 | 3300030019 | Fen | AALEQAFDATWTVLQARNAFRDFDRDNELQTALSQTLATLAMEGVTDPLELREWALESLPRS |
| Ga0311333_102474213 | 3300030114 | Fen | QARNAFRDFDRDNELQSALSQTLATLAVEGVTDPIELREWALESLPRS |
| Ga0302323_1009956341 | 3300031232 | Fen | LQARNAFRDFDRDNELQTALSQTLATLAMEGVTDPLELREWALESLPRS |
| Ga0315554_10942851 | 3300031255 | Salt Marsh Sediment | TFEATWVALQTRDPFRDFESDLELRNALSLKLAALAEDGVTDPVELLERALESLALR |
| Ga0307441_11845142 | 3300031276 | Salt Marsh | ARDPFRDFESDSDLKATLSRKLLALAANGVTDAVELREGAVEG |
| Ga0307429_11624641 | 3300031368 | Salt Marsh | EQAFDATWTVLQARDPLRDFEQDYELKTALNRKLMGLAADGVTDPIELREWALEGLPR |
| Ga0308179_10172771 | 3300031424 | Soil | ARDPFRDFDTDNELKTELSHKLSALAADGVTDAIELREWALEGLSGHR |
| Ga0318541_104936361 | 3300031545 | Soil | DATWVEVQARDPFRDFERDLDLKTALNQKLVALANDGVTDPIELREWALESLLLR |
| Ga0318521_106350592 | 3300031770 | Soil | LERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR |
| Ga0310907_100894393 | 3300031847 | Soil | SFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR |
| Ga0306925_121651672 | 3300031890 | Soil | QARDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR |
| Ga0306923_110972033 | 3300031910 | Soil | VEVQARDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR |
| Ga0310912_111249712 | 3300031941 | Soil | VEVQARDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLQLR |
| Ga0310885_106229652 | 3300031943 | Soil | RDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR |
| Ga0310884_102444881 | 3300031944 | Soil | RDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR |
| Ga0310910_106348262 | 3300031946 | Soil | NATWVEVQARDPFRDLERDSELKTAINQKLWALARDGVTDPVELREWALESLRLR |
| Ga0214473_100288547 | 3300031949 | Soil | VVLQACNPFRDFESDSELKTALSRKLTTLAADGVTDPVELREWALESLLPDA |
| Ga0306926_117194791 | 3300031954 | Soil | VEVQARDPFRDLERDSELKTEKLWALARDGVTDPVELR |
| Ga0307472_1003911151 | 3300032205 | Hardwood Forest Soil | QAFNATWVEVQARDSFRDFERDLELKTAINQKLCALARDGVTDPVELREWALESLRLR |
| Ga0214471_102131071 | 3300033417 | Soil | LQARDPFRDFDTDNELKTELSHKLSALAADGVTDAIELREWALEGLSGHR |
| Ga0310811_103278036 | 3300033475 | Soil | QARDPFRDFERDYELKTTLRRKLMGLAVDGVTDPIELREWALEGLPR |
| Ga0373917_0019546_2_190 | 3300034692 | Sediment Slurry | DALREAFDATWVVLQARDPFRDFDRDSELRTALNQRLMTLVADGVTDPVELREWALESLLLS |
| ⦗Top⦘ |