NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087633

Metagenome / Metatranscriptome Family F087633

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087633
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 51 residues
Representative Sequence MAKSNDATRKSHTHFEQVPIEVVKKIAEQDVSKDKKAGTARVGAEPPSRKKG
Number of Associated Samples 93
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.34 %
% of genes near scaffold ends (potentially truncated) 29.09 %
% of genes from short scaffolds (< 2000 bps) 85.45 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.636 % of family members)
Environment Ontology (ENVO) Unclassified
(37.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.818 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 0.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF02518HATPase_c 10.91
PF03965Penicillinase_R 1.82
PF00120Gln-synt_C 0.91
PF13701DDE_Tnp_1_4 0.91
PF02566OsmC 0.91
PF02446Glyco_hydro_77 0.91
PF00753Lactamase_B 0.91
PF02086MethyltransfD12 0.91
PF10615DUF2470 0.91
PF13492GAF_3 0.91
PF08308PEGA 0.91
PF07638Sigma70_ECF 0.91
PF02910Succ_DH_flav_C 0.91
PF00512HisKA 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.82
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 1.82
COG0338DNA-adenine methylaseReplication, recombination and repair [L] 0.91
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.91
COG16404-alpha-glucanotransferaseCarbohydrate transport and metabolism [G] 0.91
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.91
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.91
COG3392Adenine-specific DNA methylaseReplication, recombination and repair [L] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.00 %
UnclassifiedrootN/A10.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100544281All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300000574|JGI1357J11328_10200036All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300000787|JGI11643J11755_11520352All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300002121|C687J26615_10013186All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300004114|Ga0062593_102134098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300004156|Ga0062589_101886379All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300004157|Ga0062590_100489337All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300004157|Ga0062590_101435001Not Available688Open in IMG/M
3300005093|Ga0062594_100719114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300005289|Ga0065704_10295592All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300005295|Ga0065707_10677767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300005331|Ga0070670_101490139All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005334|Ga0068869_100011015All Organisms → cellular organisms → Bacteria5923Open in IMG/M
3300005339|Ga0070660_100376259All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300005353|Ga0070669_101931409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300005356|Ga0070674_101127816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter693Open in IMG/M
3300005364|Ga0070673_100206943All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1692Open in IMG/M
3300005444|Ga0070694_100016265All Organisms → cellular organisms → Bacteria4682Open in IMG/M
3300005445|Ga0070708_101158439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300005471|Ga0070698_100790900All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300005471|Ga0070698_100850852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium857Open in IMG/M
3300005518|Ga0070699_100421862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1207Open in IMG/M
3300005518|Ga0070699_100847963All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300005536|Ga0070697_101471262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300005542|Ga0070732_10037259All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2786Open in IMG/M
3300005544|Ga0070686_100481584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter960Open in IMG/M
3300005545|Ga0070695_100209211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1399Open in IMG/M
3300005545|Ga0070695_100634757All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter842Open in IMG/M
3300005578|Ga0068854_100836518All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300005617|Ga0068859_100145009All Organisms → cellular organisms → Bacteria2449Open in IMG/M
3300005841|Ga0068863_101573919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter666Open in IMG/M
3300005843|Ga0068860_100317045All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300005844|Ga0068862_100640318All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300006028|Ga0070717_10716343All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300006173|Ga0070716_101032061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300006844|Ga0075428_100427019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1420Open in IMG/M
3300006845|Ga0075421_102296099Not Available567Open in IMG/M
3300006854|Ga0075425_100110603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3132Open in IMG/M
3300006854|Ga0075425_101664043All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300006854|Ga0075425_103080066Not Available508Open in IMG/M
3300006880|Ga0075429_100724590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium871Open in IMG/M
3300006918|Ga0079216_10681317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300006918|Ga0079216_11266220Not Available599Open in IMG/M
3300007004|Ga0079218_10002254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7497Open in IMG/M
3300007004|Ga0079218_12261209Not Available634Open in IMG/M
3300007076|Ga0075435_100467086All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300009093|Ga0105240_11702335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300009094|Ga0111539_10006959All Organisms → cellular organisms → Bacteria14516Open in IMG/M
3300009098|Ga0105245_10506115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1224Open in IMG/M
3300009100|Ga0075418_10820793All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300009100|Ga0075418_11358125All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300009100|Ga0075418_12296943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300009156|Ga0111538_12953144Not Available594Open in IMG/M
3300009162|Ga0075423_11160742All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300009162|Ga0075423_11662624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300009176|Ga0105242_12806829Not Available537Open in IMG/M
3300009177|Ga0105248_10066360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4052Open in IMG/M
3300010397|Ga0134124_10103782All Organisms → cellular organisms → Bacteria2478Open in IMG/M
3300010399|Ga0134127_10752685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1019Open in IMG/M
3300011433|Ga0137443_1057322All Organisms → cellular organisms → Bacteria → Acidobacteria1070Open in IMG/M
3300012146|Ga0137322_1034049All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300012225|Ga0137434_1048154Not Available646Open in IMG/M
3300013306|Ga0163162_12296392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300014325|Ga0163163_10061767All Organisms → cellular organisms → Bacteria → Acidobacteria3712Open in IMG/M
3300014968|Ga0157379_10681715All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300015374|Ga0132255_104600873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300019377|Ga0190264_11004854All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300020000|Ga0193692_1002821All Organisms → cellular organisms → Bacteria4549Open in IMG/M
3300021170|Ga0210400_10296287All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300021178|Ga0210408_10374133All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1135Open in IMG/M
3300021947|Ga0213856_1203041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter858Open in IMG/M
3300025155|Ga0209320_10075487All Organisms → cellular organisms → Bacteria → Acidobacteria1571Open in IMG/M
3300025155|Ga0209320_10291763All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025311|Ga0209343_10402156All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300025312|Ga0209321_10084038All Organisms → cellular organisms → Bacteria1789Open in IMG/M
3300025899|Ga0207642_10145904All Organisms → cellular organisms → Bacteria → Acidobacteria1254Open in IMG/M
3300025903|Ga0207680_11211519Not Available538Open in IMG/M
3300025910|Ga0207684_10210252All Organisms → cellular organisms → Bacteria → Acidobacteria1678Open in IMG/M
3300025917|Ga0207660_10245611All Organisms → cellular organisms → Bacteria → Acidobacteria1412Open in IMG/M
3300025922|Ga0207646_10733555All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium882Open in IMG/M
3300025923|Ga0207681_10561623All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300025930|Ga0207701_11389107Not Available573Open in IMG/M
3300025936|Ga0207670_11203413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300025937|Ga0207669_11095269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter672Open in IMG/M
3300025938|Ga0207704_11758363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300025942|Ga0207689_10003332All Organisms → cellular organisms → Bacteria14715Open in IMG/M
3300025942|Ga0207689_10257278All Organisms → cellular organisms → Bacteria → Acidobacteria1444Open in IMG/M
3300025960|Ga0207651_10214379All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300026075|Ga0207708_10165477All Organisms → cellular organisms → Bacteria → Acidobacteria1748Open in IMG/M
3300026095|Ga0207676_10679010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter996Open in IMG/M
3300026095|Ga0207676_11058254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300026095|Ga0207676_11302914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter721Open in IMG/M
3300027815|Ga0209726_10011376All Organisms → cellular organisms → Bacteria → Acidobacteria8764Open in IMG/M
3300027815|Ga0209726_10178471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1145Open in IMG/M
3300027873|Ga0209814_10036111All Organisms → cellular organisms → Bacteria2048Open in IMG/M
3300027876|Ga0209974_10061632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1270Open in IMG/M
3300027886|Ga0209486_10101407All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1528Open in IMG/M
3300028381|Ga0268264_11172057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300030006|Ga0299907_10195688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1669Open in IMG/M
3300030606|Ga0299906_10282891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1298Open in IMG/M
3300030619|Ga0268386_10156176All Organisms → cellular organisms → Bacteria → Acidobacteria1736Open in IMG/M
3300030619|Ga0268386_10756044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300031228|Ga0299914_10628560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium914Open in IMG/M
3300031229|Ga0299913_11071002All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300031538|Ga0310888_10507782All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300031562|Ga0310886_10586135All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300031965|Ga0326597_10165099All Organisms → cellular organisms → Bacteria2630Open in IMG/M
3300032075|Ga0310890_10313534All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300032180|Ga0307471_100942273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter1031Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.55%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater2.73%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.82%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.91%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021947Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025311Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes)EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10054428133300000364SoilMAKSTGAPRKSQTHFEQVPIEAVKKIAEQDVFTVKEPGTARAGAKPTSSKKG*
JGI1357J11328_1020003613300000574GroundwaterTRKSQTHFEQVPIEFVKKIADQDVSKDKKAGTVRVSAEPTSRKKG*
JGI11643J11755_1152035223300000787SoilMAKSNDAPRKSRTHFEQVPLEVVKKIXEQDVPTDGKKTGTARADGEPTSSKKRPAPVRAGTFNP*
C687J26615_1001318633300002121SoilMAKSNDATRKSHTHFEQVPIEVVKKIAEQDVSKDKKGGAAGVGVEPTSRKKG*
Ga0062593_10213409813300004114SoilMAKSNAATPKKPPRHFEQVPIEVVKKIAELDARKDKKAGTARVGVQPTSRKKG*
Ga0062589_10188637913300004156SoilMAKPKDATRKSPTHFDQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG*
Ga0062590_10048933723300004157SoilMAKPKDATRKSPTHFDQVPIEVVKKIAEQDVPEDKRVGSSGARVGPPSRKKG*
Ga0062590_10143500113300004157SoilMAKLNPAPRKSHTHFEQVPIDVVKKTAEADASKDKKVGAARAGVEPTSRKRG*
Ga0062594_10071911423300005093SoilMAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR*
Ga0065704_1029559233300005289Switchgrass RhizosphereMAKPNEATRKPQTHFEQVPIEVVKKIAEPDAPKDKKVGTAHTGVEPTSRKKG*
Ga0065707_1067776713300005295Switchgrass RhizosphereMAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGTSGVRVEPTSRKKG*
Ga0070670_10149013913300005331Switchgrass RhizosphereMAKPKDTTRKSPTHFDQVPIEVVKKIAEQDVPEDKRVGSSGARVGPTSRKKG*
Ga0068869_10001101523300005334Miscanthus RhizosphereMAKSSGARRKSPTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR*
Ga0070660_10037625923300005339Corn RhizosphereMPKSNTAPRKSRTHFEQVPIEVVKKVAEPDVSKDKKAGPAHVAVKSPSRKQG*
Ga0070669_10193140923300005353Switchgrass RhizosphereTYCTAMAKPKDTTRKSPTHFDQVPIEVVKKIAEQDVPEDKRVGSSGARVGPTSRKKG*
Ga0070674_10112781623300005356Miscanthus RhizosphereKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR*
Ga0070673_10020694333300005364Switchgrass RhizosphereGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR*
Ga0070694_10001626533300005444Corn, Switchgrass And Miscanthus RhizosphereMPKSNNATRKSPTHFEQVPIEVVKKIAEPDVSKDKKARTADVAVEPTSRKKG*
Ga0070708_10115843913300005445Corn, Switchgrass And Miscanthus RhizosphereQTHFEQVPIEVVKQTAEQDVSKDKKAGTARAGAEPTSTRKKG*
Ga0070698_10079090023300005471Corn, Switchgrass And Miscanthus RhizosphereMPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKDKKAGTAYVAVEPTSRKKG*
Ga0070698_10085085223300005471Corn, Switchgrass And Miscanthus RhizosphereMAKSTDATRKPRTHFEQVPIDIAKKIAEQNDAKDKKAGTARVGVEATSRKKR*
Ga0070699_10042186213300005518Corn, Switchgrass And Miscanthus RhizosphereMPKSNNATRKSPTHFEQVPIEVVKKIAEPDVSKDKKAGTADVTVEPTSRKKG*
Ga0070699_10084796333300005518Corn, Switchgrass And Miscanthus RhizosphereMPKSNGASPKPQTHFEQIPVEVVKKVAAPDLPNGKKAGTARVGAKPTSRKKG*
Ga0070697_10147126223300005536Corn, Switchgrass And Miscanthus RhizosphereMPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKHKKAGTAYVAVEPTSRKKG*
Ga0070732_1003725913300005542Surface SoilMAKSNNATPKSQTHFEQVPIEVVKKIAEPEVAKDKKAGTGPAGAERTDRKKS*
Ga0070686_10048158413300005544Switchgrass RhizosphereMAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG*
Ga0070695_10020921123300005545Corn, Switchgrass And Miscanthus RhizosphereMPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKDKKARTADVAVEPTSRKKG*
Ga0070695_10063475723300005545Corn, Switchgrass And Miscanthus RhizosphereNTGIDVRPVTVPRMAKLNPAPRKSHTHFEQVPIDVVKKTAEADASKDKKVGAARAGVEPTSRKRG*
Ga0068854_10083651833300005578Corn RhizosphereMAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKK
Ga0068859_10014500943300005617Switchgrass RhizosphereMAKSTGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR*
Ga0068863_10157391913300005841Switchgrass RhizosphereGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR*
Ga0068860_10031704533300005843Switchgrass RhizosphereMAKSTAATRKSQTHFEQVPIEIVKKIVEPDAPRDKRVGTARAGVGPTSRKKTGTSNR*
Ga0068862_10064031823300005844Switchgrass RhizosphereMAKSNDATRKSQTHFEQVPIEVVKKKIAEQDATRDKKAGTARVGVEPPPKKKG*
Ga0070717_1071634323300006028Corn, Switchgrass And Miscanthus RhizosphereMTKSKNASRESQTHFEQVPVEVVKRIAEPGVSKEQKAGTAQVASKRTSRKKS*
Ga0070716_10103206123300006173Corn, Switchgrass And Miscanthus RhizosphereKSQTHFEQVPIEVVKKIAEPDVSKDKKAGTADVAVVRTSRKKG*
Ga0075428_10042701933300006844Populus RhizosphereMAKPNDAPRKSRTHFEQVPIEVVKKIAEQDVPNGKKAGTARADGAPTSRKERPNR*
Ga0075421_10229609923300006845Populus RhizosphereMAKPNDAPRKSRTHFEQVPIEVVKKIAEQDAPNGKKAGTARADGAPTSRKERPNR*
Ga0075425_10011060363300006854Populus RhizosphereVAKSNNPARKSQTHFEQVPVEVLKKIAKPDASKGKKGGTAHVAVEPAARKKG*
Ga0075425_10166404323300006854Populus RhizosphereMPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKDKKAGTANVAVEPTSRKKG*
Ga0075425_10308006623300006854Populus RhizosphereMPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKHKKAGTADVAVEPTSRKKG*
Ga0075429_10072459013300006880Populus RhizosphereMAKSPDATRKPQTHFEQVPIENVKKIAAPDVSNDKKAGAPRAGAEPTSRKKS*
Ga0079216_1068131713300006918Agricultural SoilMARVGVLFSMAKSNEAARKSQTHFEQVPIEVVKKIAHQDVSMGKKAGLVRVRAEPTSGKKG*
Ga0079216_1126622023300006918Agricultural SoilMAKSNDAARKSQTHFEQVPIEIVKKIAELDMSKDKKAGTTRVGAEPISRKKV*
Ga0079218_1000225423300007004Agricultural SoilMAKSNKATRKSNTHFEQVPLKVVKKIAEPDPPKDKKVGTARIGR*
Ga0079218_1226120913300007004Agricultural SoilMAKSHDATRKSHTHFEQVPLEVVEKIAEPDAPKDKKVGADRMGVKPTYTKKR*
Ga0075435_10046708613300007076Populus RhizosphereNNPTRKSQTHFEQVPVEVLKKIAKPDASKGKKGGTAHVAVEPAARKKG*
Ga0105240_1170233513300009093Corn RhizosphereRTHFEQVPIEVVKKVAEPDVSKDKKAGPAHVAVKSPSRKQG*
Ga0111539_1000695953300009094Populus RhizosphereMAKSNTARRKSHTHFEQIPIKVVKKIAEPEAPKNHKVARMGVEPISRKKG*
Ga0105245_1050611533300009098Miscanthus RhizosphereMAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR*
Ga0075418_1082079323300009100Populus RhizosphereFEQVPIEVVKRIAEPDVSKDKKARTADVAVEPTSRKKG*
Ga0075418_1135812523300009100Populus RhizosphereMAKPNDAPRKSRTHFEQVPIEVVKKIAEQDVPNGKKAGTALADGAPTPRKERPNR*
Ga0075418_1229694313300009100Populus RhizosphereQTHFEQVPLEVVKRIADLDVSKDKKAGTARVGAAPTSRKKG*
Ga0111538_1295314413300009156Populus RhizosphereMAKPKDATRKSQTHFEQVPIEVVKKIAEQDVPKDKNVGTRGVRVEPASRKKGQT*
Ga0075423_1116074223300009162Populus RhizosphereMPKSNNATRKSPTHFEQVPIEVVKRIAEPDVSKDKKARTADVAVEPTSRKKG*
Ga0075423_1166262423300009162Populus RhizosphereMPKSNNATRKSQTHFEQVPIEVVKKIAEPDGSKDKKAGTANVAVEPTSRKKG*
Ga0105242_1280682913300009176Miscanthus RhizosphereMAKSNDATRKSQTHFEQVPIEVVKKIAEQDAPKDKKVGTARAGVEAISRKKR*
Ga0105248_1006636063300009177Switchgrass RhizosphereMAKSKVSTRKSHTHFEQVPIEIVKKIAEQDAPRNAKAGTARAGVEPTSRKKR*
Ga0134124_1010378213300010397Terrestrial SoilKSNDAARKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR*
Ga0134127_1075268523300010399Terrestrial SoilEQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKRG*
Ga0137443_105732223300011433SoilMAKSNDATRKSRTHFEQVPLAVVKKIALQDAPKDKKAGTARMGVEPTSRKKR*
Ga0137322_103404913300012146SoilMAKWNDATRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTVRVGAEPTSRKK
Ga0137434_104815423300012225SoilMAKWNDATRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTVRVGAEPTSRKKG*
Ga0163162_1229639213300013306Switchgrass RhizosphereMAKSSGGPRKSQTPFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR*
Ga0163163_1006176743300014325Switchgrass RhizosphereMAKSSRATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR*
Ga0157379_1068171533300014968Switchgrass RhizosphereMAKSSRATRKSQTHFEQVPIEVVKKKIAEQDATRDKKAGTARVGVE
Ga0132255_10460087313300015374Arabidopsis RhizosphereMAKPKDATRKSPTHFEQVPNEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG*
Ga0190264_1100485413300019377SoilNATRKSQTHFEQVPIEVVKKIAEQDVSKNKKAGTARVGAEPTSRKKG
Ga0193692_100282193300020000SoilMAKAKTATRKSRTHFEQVPVEVVKKIAEQDVAKHKKVGTTRVSVEPTSIKKG
Ga0210400_1029628723300021170SoilMAKSNDVTRKSHTHFEQVPIEVVKKIAEQDVPKDKKVANARGVEPTSRKKD
Ga0210408_1037413323300021178SoilMAKSDDATRKAQTHFEQVPVENVKKIAEQDVSKGKKVGADRPAAGPTARKNGSALERGTFNR
Ga0213856_120304113300021947WatershedsSNATRKSQTHFEQVPVEVVKKIATQDAPKDKKAGTARMSVDATSRKKR
Ga0209320_1007548723300025155SoilMAKSNDATRKSHTHFEQVPIEVVKKIAEQDVSKDKKGGAAGVGVEPTSRKKG
Ga0209320_1029176323300025155SoilMARSNDATRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTARVGAEPPSRKKG
Ga0209343_1040215613300025311GroundwaterMARSNDATRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTARVGAEPTSRKKG
Ga0209321_1008403843300025312SoilMAKSNDATRKSHTHFEQVPIEVVKKIAEQDVSKDKKAGTARVGAEPPSRKKG
Ga0207642_1014590423300025899Miscanthus RhizosphereMAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR
Ga0207680_1121151913300025903Switchgrass RhizosphereMAKSTGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETAR
Ga0207684_1021025223300025910Corn, Switchgrass And Miscanthus RhizosphereMPKSNNATRKSQTHFEQVPIEVVRKIAEPDLSKDKKAGTARVAVEPTSRKKG
Ga0207660_1024561123300025917Corn RhizosphereMPKSNTAPRKSRTHFEQVPIEVVKKVAEPDVSKDKKAGPAHVAVKSPSRKQG
Ga0207646_1073355523300025922Corn, Switchgrass And Miscanthus RhizosphereMPKSNNATRKSPTHFEQVPIEVVKKIAEPDVSKDKKARTADVAVEPTSRKKG
Ga0207681_1056162323300025923Switchgrass RhizosphereMAKSNDATRKSQTHFEQVPIEVVKKKIAEQDATRDKKAGTARVGVEPPPKKKG
Ga0207701_1138910723300025930Corn, Switchgrass And Miscanthus RhizosphereMAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG
Ga0207670_1120341313300025936Switchgrass RhizosphereYCSAMAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG
Ga0207669_1109526923300025937Miscanthus RhizosphereKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR
Ga0207704_1175836323300025938Miscanthus RhizospherePTRMRRARYCSSMAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR
Ga0207689_10003332143300025942Miscanthus RhizosphereMAKSSGATRKSQTHFEQVPIEIVKKIADQGVPKDNKAETVRGPTPVSRKKR
Ga0207689_1025727823300025942Miscanthus RhizosphereMAKSSGARRKSPTHFEQVPIEVVKKIADQGVPKGNKAETVRGPTPVSRKKR
Ga0207651_1021437933300025960Switchgrass RhizosphereGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR
Ga0207708_1016547723300026075Corn, Switchgrass And Miscanthus RhizosphereMAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGTSGVRVEPTSRKKG
Ga0207676_1067901013300026095Switchgrass RhizosphereFEQVPLEVVKKIAEQEVSKDKKAGTARSRVEPASRKKR
Ga0207676_1105825423300026095Switchgrass RhizosphereMAKSNDATRKSQTHFEQVPIEVVKKIADPDVSKHKKAGTARSGAERTARKKG
Ga0207676_1130291423300026095Switchgrass RhizosphereSSMAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR
Ga0209726_10011376103300027815GroundwaterMAKWNDATRKSQTHFEQVPIEFVKKIADQDVSKDKKAGTVRVSAEPTSRKKG
Ga0209726_1017847123300027815GroundwaterMAKSNDVARKSQTHFEQVPVDVVKKLAAQDVSKDKRSGTARAGAEPTSKKKG
Ga0209814_1003611143300027873Populus RhizosphereCSPMLKSNNATRKSPTHFEQVPIEVVKKIAEPDVSKDKKARTADVAVEPTSRKKG
Ga0209974_1006163223300027876Arabidopsis Thaliana RhizosphereMTKPNEATRKPQTHFEQVPIEVVKKIAEPDSPKDKKVGTAHTGVEPTSRKKG
Ga0209486_1010140723300027886Agricultural SoilMAKSNKATRKSNTHFEQVPLKVVKKIAEPDPPKDKKVGTARIGR
Ga0268264_1117205723300028381Switchgrass RhizosphereMAKSTGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR
Ga0307282_1030632613300028784SoilMTKTNDAARKRPTHFEQVPIEVVKKIAEEDVPKNKSKASVEPT
Ga0299907_1019568813300030006SoilMTRVPVLFSMAKSSDATRKSQTHFEQVPLDVVKKIAEQDVSKDRKAGTARGAEPISRKKG
Ga0299906_1028289123300030606SoilNGATRKSHTHFEQVPIEVVKKIADQDVSKDKKAGTARVGAEPTSRKKG
Ga0268386_1015617623300030619SoilMTRVPVLFSMAKSNDATRKSQTHFEQVPLDVVKKIAEQDVSKDRKAGTARGAEPISRKKG
Ga0268386_1075604423300030619SoilTRMTRVPVLFSMAKSKDATRKSQTHFEQVSIDVVKKIADQDVSKDKKAGTARVGAEPTSTKKGSAPERAGTVNR
Ga0299914_1062856023300031228SoilMTRVPVLFSMAKSKDATRKSQTHFEQVPIDVVKKIAEQGVSKDKKTGIARVSAERIKKEG
Ga0299913_1107100223300031229SoilDATRKSQTHFEQVPIDVVKRIAEQHVSKDKKAGTARVGAEPTSRKKG
Ga0310888_1050778213300031538SoilMAKPNEATRKPQTHFEQVPIEVVKKIAEPDAPKDKKVGTAHTGVEPTSRKKG
Ga0310886_1058613523300031562SoilMAKPNEATRKPQTHFEQVPIEVVKKIAEPDAPKDKKVRTAHTGVEPTSRKKG
Ga0326597_1016509953300031965SoilMAKSNDGSRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTVRVGAESTSRKKG
Ga0310890_1031353413300032075SoilTRKPQTHFEQVPIEVVKKIAEPDSPKDKKVGTAHTGVEPTSRKKG
Ga0307471_10094227323300032180Hardwood Forest SoilMPKSNDATRKPQTHFEQVPIDVVKKIAEQDVSKDKKAGTARVGVEPTSRKKG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.