Basic Information | |
---|---|
Family ID | F087633 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 51 residues |
Representative Sequence | MAKSNDATRKSHTHFEQVPIEVVKKIAEQDVSKDKKAGTARVGAEPPSRKKG |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.34 % |
% of genes near scaffold ends (potentially truncated) | 29.09 % |
% of genes from short scaffolds (< 2000 bps) | 85.45 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.636 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.273 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.818 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF02518 | HATPase_c | 10.91 |
PF03965 | Penicillinase_R | 1.82 |
PF00120 | Gln-synt_C | 0.91 |
PF13701 | DDE_Tnp_1_4 | 0.91 |
PF02566 | OsmC | 0.91 |
PF02446 | Glyco_hydro_77 | 0.91 |
PF00753 | Lactamase_B | 0.91 |
PF02086 | MethyltransfD12 | 0.91 |
PF10615 | DUF2470 | 0.91 |
PF13492 | GAF_3 | 0.91 |
PF08308 | PEGA | 0.91 |
PF07638 | Sigma70_ECF | 0.91 |
PF02910 | Succ_DH_flav_C | 0.91 |
PF00512 | HisKA | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.82 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 1.82 |
COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.91 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.91 |
COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.91 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.91 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.91 |
COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.00 % |
Unclassified | root | N/A | 10.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100544281 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300000574|JGI1357J11328_10200036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300000787|JGI11643J11755_11520352 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300002121|C687J26615_10013186 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
3300004114|Ga0062593_102134098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300004156|Ga0062589_101886379 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300004157|Ga0062590_100489337 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300004157|Ga0062590_101435001 | Not Available | 688 | Open in IMG/M |
3300005093|Ga0062594_100719114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
3300005289|Ga0065704_10295592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
3300005295|Ga0065707_10677767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300005331|Ga0070670_101490139 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005334|Ga0068869_100011015 | All Organisms → cellular organisms → Bacteria | 5923 | Open in IMG/M |
3300005339|Ga0070660_100376259 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300005353|Ga0070669_101931409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300005356|Ga0070674_101127816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 693 | Open in IMG/M |
3300005364|Ga0070673_100206943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1692 | Open in IMG/M |
3300005444|Ga0070694_100016265 | All Organisms → cellular organisms → Bacteria | 4682 | Open in IMG/M |
3300005445|Ga0070708_101158439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300005471|Ga0070698_100790900 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300005471|Ga0070698_100850852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
3300005518|Ga0070699_100421862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1207 | Open in IMG/M |
3300005518|Ga0070699_100847963 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300005536|Ga0070697_101471262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300005542|Ga0070732_10037259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2786 | Open in IMG/M |
3300005544|Ga0070686_100481584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 960 | Open in IMG/M |
3300005545|Ga0070695_100209211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1399 | Open in IMG/M |
3300005545|Ga0070695_100634757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 842 | Open in IMG/M |
3300005578|Ga0068854_100836518 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300005617|Ga0068859_100145009 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
3300005841|Ga0068863_101573919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 666 | Open in IMG/M |
3300005843|Ga0068860_100317045 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
3300005844|Ga0068862_100640318 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300006028|Ga0070717_10716343 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300006173|Ga0070716_101032061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300006844|Ga0075428_100427019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
3300006845|Ga0075421_102296099 | Not Available | 567 | Open in IMG/M |
3300006854|Ga0075425_100110603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3132 | Open in IMG/M |
3300006854|Ga0075425_101664043 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300006854|Ga0075425_103080066 | Not Available | 508 | Open in IMG/M |
3300006880|Ga0075429_100724590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
3300006918|Ga0079216_10681317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300006918|Ga0079216_11266220 | Not Available | 599 | Open in IMG/M |
3300007004|Ga0079218_10002254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7497 | Open in IMG/M |
3300007004|Ga0079218_12261209 | Not Available | 634 | Open in IMG/M |
3300007076|Ga0075435_100467086 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300009093|Ga0105240_11702335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300009094|Ga0111539_10006959 | All Organisms → cellular organisms → Bacteria | 14516 | Open in IMG/M |
3300009098|Ga0105245_10506115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1224 | Open in IMG/M |
3300009100|Ga0075418_10820793 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300009100|Ga0075418_11358125 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300009100|Ga0075418_12296943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300009156|Ga0111538_12953144 | Not Available | 594 | Open in IMG/M |
3300009162|Ga0075423_11160742 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300009162|Ga0075423_11662624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300009176|Ga0105242_12806829 | Not Available | 537 | Open in IMG/M |
3300009177|Ga0105248_10066360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4052 | Open in IMG/M |
3300010397|Ga0134124_10103782 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
3300010399|Ga0134127_10752685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1019 | Open in IMG/M |
3300011433|Ga0137443_1057322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
3300012146|Ga0137322_1034049 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300012225|Ga0137434_1048154 | Not Available | 646 | Open in IMG/M |
3300013306|Ga0163162_12296392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300014325|Ga0163163_10061767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3712 | Open in IMG/M |
3300014968|Ga0157379_10681715 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300015374|Ga0132255_104600873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300019377|Ga0190264_11004854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300020000|Ga0193692_1002821 | All Organisms → cellular organisms → Bacteria | 4549 | Open in IMG/M |
3300021170|Ga0210400_10296287 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300021178|Ga0210408_10374133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1135 | Open in IMG/M |
3300021947|Ga0213856_1203041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 858 | Open in IMG/M |
3300025155|Ga0209320_10075487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
3300025155|Ga0209320_10291763 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300025311|Ga0209343_10402156 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300025312|Ga0209321_10084038 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
3300025899|Ga0207642_10145904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
3300025903|Ga0207680_11211519 | Not Available | 538 | Open in IMG/M |
3300025910|Ga0207684_10210252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1678 | Open in IMG/M |
3300025917|Ga0207660_10245611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1412 | Open in IMG/M |
3300025922|Ga0207646_10733555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
3300025923|Ga0207681_10561623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300025930|Ga0207701_11389107 | Not Available | 573 | Open in IMG/M |
3300025936|Ga0207670_11203413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300025937|Ga0207669_11095269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 672 | Open in IMG/M |
3300025938|Ga0207704_11758363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300025942|Ga0207689_10003332 | All Organisms → cellular organisms → Bacteria | 14715 | Open in IMG/M |
3300025942|Ga0207689_10257278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
3300025960|Ga0207651_10214379 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300026075|Ga0207708_10165477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1748 | Open in IMG/M |
3300026095|Ga0207676_10679010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 996 | Open in IMG/M |
3300026095|Ga0207676_11058254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
3300026095|Ga0207676_11302914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 721 | Open in IMG/M |
3300027815|Ga0209726_10011376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8764 | Open in IMG/M |
3300027815|Ga0209726_10178471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1145 | Open in IMG/M |
3300027873|Ga0209814_10036111 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
3300027876|Ga0209974_10061632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
3300027886|Ga0209486_10101407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1528 | Open in IMG/M |
3300028381|Ga0268264_11172057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300030006|Ga0299907_10195688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1669 | Open in IMG/M |
3300030606|Ga0299906_10282891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1298 | Open in IMG/M |
3300030619|Ga0268386_10156176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1736 | Open in IMG/M |
3300030619|Ga0268386_10756044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300031228|Ga0299914_10628560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
3300031229|Ga0299913_11071002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
3300031538|Ga0310888_10507782 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300031562|Ga0310886_10586135 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300031965|Ga0326597_10165099 | All Organisms → cellular organisms → Bacteria | 2630 | Open in IMG/M |
3300032075|Ga0310890_10313534 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300032180|Ga0307471_100942273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1031 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.55% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 2.73% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.82% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.91% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.91% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.91% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021947 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - G-2016_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1005442813 | 3300000364 | Soil | MAKSTGAPRKSQTHFEQVPIEAVKKIAEQDVFTVKEPGTARAGAKPTSSKKG* |
JGI1357J11328_102000361 | 3300000574 | Groundwater | TRKSQTHFEQVPIEFVKKIADQDVSKDKKAGTVRVSAEPTSRKKG* |
JGI11643J11755_115203522 | 3300000787 | Soil | MAKSNDAPRKSRTHFEQVPLEVVKKIXEQDVPTDGKKTGTARADGEPTSSKKRPAPVRAGTFNP* |
C687J26615_100131863 | 3300002121 | Soil | MAKSNDATRKSHTHFEQVPIEVVKKIAEQDVSKDKKGGAAGVGVEPTSRKKG* |
Ga0062593_1021340981 | 3300004114 | Soil | MAKSNAATPKKPPRHFEQVPIEVVKKIAELDARKDKKAGTARVGVQPTSRKKG* |
Ga0062589_1018863791 | 3300004156 | Soil | MAKPKDATRKSPTHFDQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG* |
Ga0062590_1004893372 | 3300004157 | Soil | MAKPKDATRKSPTHFDQVPIEVVKKIAEQDVPEDKRVGSSGARVGPPSRKKG* |
Ga0062590_1014350011 | 3300004157 | Soil | MAKLNPAPRKSHTHFEQVPIDVVKKTAEADASKDKKVGAARAGVEPTSRKRG* |
Ga0062594_1007191142 | 3300005093 | Soil | MAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR* |
Ga0065704_102955923 | 3300005289 | Switchgrass Rhizosphere | MAKPNEATRKPQTHFEQVPIEVVKKIAEPDAPKDKKVGTAHTGVEPTSRKKG* |
Ga0065707_106777671 | 3300005295 | Switchgrass Rhizosphere | MAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGTSGVRVEPTSRKKG* |
Ga0070670_1014901391 | 3300005331 | Switchgrass Rhizosphere | MAKPKDTTRKSPTHFDQVPIEVVKKIAEQDVPEDKRVGSSGARVGPTSRKKG* |
Ga0068869_1000110152 | 3300005334 | Miscanthus Rhizosphere | MAKSSGARRKSPTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR* |
Ga0070660_1003762592 | 3300005339 | Corn Rhizosphere | MPKSNTAPRKSRTHFEQVPIEVVKKVAEPDVSKDKKAGPAHVAVKSPSRKQG* |
Ga0070669_1019314092 | 3300005353 | Switchgrass Rhizosphere | TYCTAMAKPKDTTRKSPTHFDQVPIEVVKKIAEQDVPEDKRVGSSGARVGPTSRKKG* |
Ga0070674_1011278162 | 3300005356 | Miscanthus Rhizosphere | KSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR* |
Ga0070673_1002069433 | 3300005364 | Switchgrass Rhizosphere | GATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR* |
Ga0070694_1000162653 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKSNNATRKSPTHFEQVPIEVVKKIAEPDVSKDKKARTADVAVEPTSRKKG* |
Ga0070708_1011584391 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QTHFEQVPIEVVKQTAEQDVSKDKKAGTARAGAEPTSTRKKG* |
Ga0070698_1007909002 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKDKKAGTAYVAVEPTSRKKG* |
Ga0070698_1008508522 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKSTDATRKPRTHFEQVPIDIAKKIAEQNDAKDKKAGTARVGVEATSRKKR* |
Ga0070699_1004218621 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKSNNATRKSPTHFEQVPIEVVKKIAEPDVSKDKKAGTADVTVEPTSRKKG* |
Ga0070699_1008479633 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKSNGASPKPQTHFEQIPVEVVKKVAAPDLPNGKKAGTARVGAKPTSRKKG* |
Ga0070697_1014712622 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKHKKAGTAYVAVEPTSRKKG* |
Ga0070732_100372591 | 3300005542 | Surface Soil | MAKSNNATPKSQTHFEQVPIEVVKKIAEPEVAKDKKAGTGPAGAERTDRKKS* |
Ga0070686_1004815841 | 3300005544 | Switchgrass Rhizosphere | MAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG* |
Ga0070695_1002092112 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKDKKARTADVAVEPTSRKKG* |
Ga0070695_1006347572 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | NTGIDVRPVTVPRMAKLNPAPRKSHTHFEQVPIDVVKKTAEADASKDKKVGAARAGVEPTSRKRG* |
Ga0068854_1008365183 | 3300005578 | Corn Rhizosphere | MAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKK |
Ga0068859_1001450094 | 3300005617 | Switchgrass Rhizosphere | MAKSTGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR* |
Ga0068863_1015739191 | 3300005841 | Switchgrass Rhizosphere | GATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR* |
Ga0068860_1003170453 | 3300005843 | Switchgrass Rhizosphere | MAKSTAATRKSQTHFEQVPIEIVKKIVEPDAPRDKRVGTARAGVGPTSRKKTGTSNR* |
Ga0068862_1006403182 | 3300005844 | Switchgrass Rhizosphere | MAKSNDATRKSQTHFEQVPIEVVKKKIAEQDATRDKKAGTARVGVEPPPKKKG* |
Ga0070717_107163432 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKSKNASRESQTHFEQVPVEVVKRIAEPGVSKEQKAGTAQVASKRTSRKKS* |
Ga0070716_1010320612 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KSQTHFEQVPIEVVKKIAEPDVSKDKKAGTADVAVVRTSRKKG* |
Ga0075428_1004270193 | 3300006844 | Populus Rhizosphere | MAKPNDAPRKSRTHFEQVPIEVVKKIAEQDVPNGKKAGTARADGAPTSRKERPNR* |
Ga0075421_1022960992 | 3300006845 | Populus Rhizosphere | MAKPNDAPRKSRTHFEQVPIEVVKKIAEQDAPNGKKAGTARADGAPTSRKERPNR* |
Ga0075425_1001106036 | 3300006854 | Populus Rhizosphere | VAKSNNPARKSQTHFEQVPVEVLKKIAKPDASKGKKGGTAHVAVEPAARKKG* |
Ga0075425_1016640432 | 3300006854 | Populus Rhizosphere | MPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKDKKAGTANVAVEPTSRKKG* |
Ga0075425_1030800662 | 3300006854 | Populus Rhizosphere | MPKSNNATRKSQTHFEQVPIEVVKKIAEPDVSKHKKAGTADVAVEPTSRKKG* |
Ga0075429_1007245901 | 3300006880 | Populus Rhizosphere | MAKSPDATRKPQTHFEQVPIENVKKIAAPDVSNDKKAGAPRAGAEPTSRKKS* |
Ga0079216_106813171 | 3300006918 | Agricultural Soil | MARVGVLFSMAKSNEAARKSQTHFEQVPIEVVKKIAHQDVSMGKKAGLVRVRAEPTSGKKG* |
Ga0079216_112662202 | 3300006918 | Agricultural Soil | MAKSNDAARKSQTHFEQVPIEIVKKIAELDMSKDKKAGTTRVGAEPISRKKV* |
Ga0079218_100022542 | 3300007004 | Agricultural Soil | MAKSNKATRKSNTHFEQVPLKVVKKIAEPDPPKDKKVGTARIGR* |
Ga0079218_122612091 | 3300007004 | Agricultural Soil | MAKSHDATRKSHTHFEQVPLEVVEKIAEPDAPKDKKVGADRMGVKPTYTKKR* |
Ga0075435_1004670861 | 3300007076 | Populus Rhizosphere | NNPTRKSQTHFEQVPVEVLKKIAKPDASKGKKGGTAHVAVEPAARKKG* |
Ga0105240_117023351 | 3300009093 | Corn Rhizosphere | RTHFEQVPIEVVKKVAEPDVSKDKKAGPAHVAVKSPSRKQG* |
Ga0111539_100069595 | 3300009094 | Populus Rhizosphere | MAKSNTARRKSHTHFEQIPIKVVKKIAEPEAPKNHKVARMGVEPISRKKG* |
Ga0105245_105061153 | 3300009098 | Miscanthus Rhizosphere | MAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR* |
Ga0075418_108207932 | 3300009100 | Populus Rhizosphere | FEQVPIEVVKRIAEPDVSKDKKARTADVAVEPTSRKKG* |
Ga0075418_113581252 | 3300009100 | Populus Rhizosphere | MAKPNDAPRKSRTHFEQVPIEVVKKIAEQDVPNGKKAGTALADGAPTPRKERPNR* |
Ga0075418_122969431 | 3300009100 | Populus Rhizosphere | QTHFEQVPLEVVKRIADLDVSKDKKAGTARVGAAPTSRKKG* |
Ga0111538_129531441 | 3300009156 | Populus Rhizosphere | MAKPKDATRKSQTHFEQVPIEVVKKIAEQDVPKDKNVGTRGVRVEPASRKKGQT* |
Ga0075423_111607422 | 3300009162 | Populus Rhizosphere | MPKSNNATRKSPTHFEQVPIEVVKRIAEPDVSKDKKARTADVAVEPTSRKKG* |
Ga0075423_116626242 | 3300009162 | Populus Rhizosphere | MPKSNNATRKSQTHFEQVPIEVVKKIAEPDGSKDKKAGTANVAVEPTSRKKG* |
Ga0105242_128068291 | 3300009176 | Miscanthus Rhizosphere | MAKSNDATRKSQTHFEQVPIEVVKKIAEQDAPKDKKVGTARAGVEAISRKKR* |
Ga0105248_100663606 | 3300009177 | Switchgrass Rhizosphere | MAKSKVSTRKSHTHFEQVPIEIVKKIAEQDAPRNAKAGTARAGVEPTSRKKR* |
Ga0134124_101037821 | 3300010397 | Terrestrial Soil | KSNDAARKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR* |
Ga0134127_107526852 | 3300010399 | Terrestrial Soil | EQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKRG* |
Ga0137443_10573222 | 3300011433 | Soil | MAKSNDATRKSRTHFEQVPLAVVKKIALQDAPKDKKAGTARMGVEPTSRKKR* |
Ga0137322_10340491 | 3300012146 | Soil | MAKWNDATRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTVRVGAEPTSRKK |
Ga0137434_10481542 | 3300012225 | Soil | MAKWNDATRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTVRVGAEPTSRKKG* |
Ga0163162_122963921 | 3300013306 | Switchgrass Rhizosphere | MAKSSGGPRKSQTPFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR* |
Ga0163163_100617674 | 3300014325 | Switchgrass Rhizosphere | MAKSSRATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR* |
Ga0157379_106817153 | 3300014968 | Switchgrass Rhizosphere | MAKSSRATRKSQTHFEQVPIEVVKKKIAEQDATRDKKAGTARVGVE |
Ga0132255_1046008731 | 3300015374 | Arabidopsis Rhizosphere | MAKPKDATRKSPTHFEQVPNEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG* |
Ga0190264_110048541 | 3300019377 | Soil | NATRKSQTHFEQVPIEVVKKIAEQDVSKNKKAGTARVGAEPTSRKKG |
Ga0193692_10028219 | 3300020000 | Soil | MAKAKTATRKSRTHFEQVPVEVVKKIAEQDVAKHKKVGTTRVSVEPTSIKKG |
Ga0210400_102962872 | 3300021170 | Soil | MAKSNDVTRKSHTHFEQVPIEVVKKIAEQDVPKDKKVANARGVEPTSRKKD |
Ga0210408_103741332 | 3300021178 | Soil | MAKSDDATRKAQTHFEQVPVENVKKIAEQDVSKGKKVGADRPAAGPTARKNGSALERGTFNR |
Ga0213856_12030411 | 3300021947 | Watersheds | SNATRKSQTHFEQVPVEVVKKIATQDAPKDKKAGTARMSVDATSRKKR |
Ga0209320_100754872 | 3300025155 | Soil | MAKSNDATRKSHTHFEQVPIEVVKKIAEQDVSKDKKGGAAGVGVEPTSRKKG |
Ga0209320_102917632 | 3300025155 | Soil | MARSNDATRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTARVGAEPPSRKKG |
Ga0209343_104021561 | 3300025311 | Groundwater | MARSNDATRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTARVGAEPTSRKKG |
Ga0209321_100840384 | 3300025312 | Soil | MAKSNDATRKSHTHFEQVPIEVVKKIAEQDVSKDKKAGTARVGAEPPSRKKG |
Ga0207642_101459042 | 3300025899 | Miscanthus Rhizosphere | MAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR |
Ga0207680_112115191 | 3300025903 | Switchgrass Rhizosphere | MAKSTGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETAR |
Ga0207684_102102522 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKSNNATRKSQTHFEQVPIEVVRKIAEPDLSKDKKAGTARVAVEPTSRKKG |
Ga0207660_102456112 | 3300025917 | Corn Rhizosphere | MPKSNTAPRKSRTHFEQVPIEVVKKVAEPDVSKDKKAGPAHVAVKSPSRKQG |
Ga0207646_107335552 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKSNNATRKSPTHFEQVPIEVVKKIAEPDVSKDKKARTADVAVEPTSRKKG |
Ga0207681_105616232 | 3300025923 | Switchgrass Rhizosphere | MAKSNDATRKSQTHFEQVPIEVVKKKIAEQDATRDKKAGTARVGVEPPPKKKG |
Ga0207701_113891072 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG |
Ga0207670_112034131 | 3300025936 | Switchgrass Rhizosphere | YCSAMAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGSSGARVEPTSRKKG |
Ga0207669_110952692 | 3300025937 | Miscanthus Rhizosphere | KSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR |
Ga0207704_117583632 | 3300025938 | Miscanthus Rhizosphere | PTRMRRARYCSSMAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR |
Ga0207689_1000333214 | 3300025942 | Miscanthus Rhizosphere | MAKSSGATRKSQTHFEQVPIEIVKKIADQGVPKDNKAETVRGPTPVSRKKR |
Ga0207689_102572782 | 3300025942 | Miscanthus Rhizosphere | MAKSSGARRKSPTHFEQVPIEVVKKIADQGVPKGNKAETVRGPTPVSRKKR |
Ga0207651_102143793 | 3300025960 | Switchgrass Rhizosphere | GATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETVRGPTPVSRKKR |
Ga0207708_101654772 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKPKDATRKSPTHFEQVPIEVVKKIAEQDVPEDKRVGTSGVRVEPTSRKKG |
Ga0207676_106790101 | 3300026095 | Switchgrass Rhizosphere | FEQVPLEVVKKIAEQEVSKDKKAGTARSRVEPASRKKR |
Ga0207676_110582542 | 3300026095 | Switchgrass Rhizosphere | MAKSNDATRKSQTHFEQVPIEVVKKIADPDVSKHKKAGTARSGAERTARKKG |
Ga0207676_113029142 | 3300026095 | Switchgrass Rhizosphere | SSMAKSSGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR |
Ga0209726_1001137610 | 3300027815 | Groundwater | MAKWNDATRKSQTHFEQVPIEFVKKIADQDVSKDKKAGTVRVSAEPTSRKKG |
Ga0209726_101784712 | 3300027815 | Groundwater | MAKSNDVARKSQTHFEQVPVDVVKKLAAQDVSKDKRSGTARAGAEPTSKKKG |
Ga0209814_100361114 | 3300027873 | Populus Rhizosphere | CSPMLKSNNATRKSPTHFEQVPIEVVKKIAEPDVSKDKKARTADVAVEPTSRKKG |
Ga0209974_100616322 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MTKPNEATRKPQTHFEQVPIEVVKKIAEPDSPKDKKVGTAHTGVEPTSRKKG |
Ga0209486_101014072 | 3300027886 | Agricultural Soil | MAKSNKATRKSNTHFEQVPLKVVKKIAEPDPPKDKKVGTARIGR |
Ga0268264_111720572 | 3300028381 | Switchgrass Rhizosphere | MAKSTGATRKSQTHFEQVPIEVVKKIADQGVPKDNKAETARGPTPVSRKKR |
Ga0307282_103063261 | 3300028784 | Soil | MTKTNDAARKRPTHFEQVPIEVVKKIAEEDVPKNKSKASVEPT |
Ga0299907_101956881 | 3300030006 | Soil | MTRVPVLFSMAKSSDATRKSQTHFEQVPLDVVKKIAEQDVSKDRKAGTARGAEPISRKKG |
Ga0299906_102828912 | 3300030606 | Soil | NGATRKSHTHFEQVPIEVVKKIADQDVSKDKKAGTARVGAEPTSRKKG |
Ga0268386_101561762 | 3300030619 | Soil | MTRVPVLFSMAKSNDATRKSQTHFEQVPLDVVKKIAEQDVSKDRKAGTARGAEPISRKKG |
Ga0268386_107560442 | 3300030619 | Soil | TRMTRVPVLFSMAKSKDATRKSQTHFEQVSIDVVKKIADQDVSKDKKAGTARVGAEPTSTKKGSAPERAGTVNR |
Ga0299914_106285602 | 3300031228 | Soil | MTRVPVLFSMAKSKDATRKSQTHFEQVPIDVVKKIAEQGVSKDKKTGIARVSAERIKKEG |
Ga0299913_110710022 | 3300031229 | Soil | DATRKSQTHFEQVPIDVVKRIAEQHVSKDKKAGTARVGAEPTSRKKG |
Ga0310888_105077821 | 3300031538 | Soil | MAKPNEATRKPQTHFEQVPIEVVKKIAEPDAPKDKKVGTAHTGVEPTSRKKG |
Ga0310886_105861352 | 3300031562 | Soil | MAKPNEATRKPQTHFEQVPIEVVKKIAEPDAPKDKKVRTAHTGVEPTSRKKG |
Ga0326597_101650995 | 3300031965 | Soil | MAKSNDGSRKSQTHFEQVPIEVVKKIADQDVSKDKKAGTVRVGAESTSRKKG |
Ga0310890_103135341 | 3300032075 | Soil | TRKPQTHFEQVPIEVVKKIAEPDSPKDKKVGTAHTGVEPTSRKKG |
Ga0307471_1009422732 | 3300032180 | Hardwood Forest Soil | MPKSNDATRKPQTHFEQVPIDVVKKIAEQDVSKDKKAGTARVGVEPTSRKKG |
⦗Top⦘ |