| Basic Information | |
|---|---|
| Family ID | F087631 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 48 residues |
| Representative Sequence | YGEPYVFPWLSDAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.36 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (16.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.909 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.43% β-sheet: 2.13% Coil/Unstructured: 57.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 30.00 |
| PF13191 | AAA_16 | 0.91 |
| PF06897 | DUF1269 | 0.91 |
| PF01087 | GalP_UDP_transf | 0.91 |
| PF00005 | ABC_tran | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.18 % |
| Unclassified | root | N/A | 1.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig123692 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 2170459005|F1BAP7Q01D41L0 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100236719 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300000956|JGI10216J12902_112745003 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300001538|A10PFW1_12123365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium tusciae | 532 | Open in IMG/M |
| 3300001867|JGI12627J18819_10435313 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005172|Ga0066683_10453291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 786 | Open in IMG/M |
| 3300005174|Ga0066680_10674031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 638 | Open in IMG/M |
| 3300005174|Ga0066680_10780976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 577 | Open in IMG/M |
| 3300005178|Ga0066688_10833603 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005186|Ga0066676_10385223 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300005332|Ga0066388_105108657 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005367|Ga0070667_100767913 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005435|Ga0070714_101221283 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005467|Ga0070706_100547370 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300005467|Ga0070706_101186492 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005471|Ga0070698_100578434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 1063 | Open in IMG/M |
| 3300005518|Ga0070699_100321068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1392 | Open in IMG/M |
| 3300005549|Ga0070704_102182732 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005552|Ga0066701_10323600 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005614|Ga0068856_102023208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 586 | Open in IMG/M |
| 3300005617|Ga0068859_100847539 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300005764|Ga0066903_105359441 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005764|Ga0066903_105882223 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005764|Ga0066903_106211994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 624 | Open in IMG/M |
| 3300005764|Ga0066903_107229453 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005764|Ga0066903_108717798 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005764|Ga0066903_108972961 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005841|Ga0068863_102299731 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005842|Ga0068858_102210207 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005842|Ga0068858_102602454 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005901|Ga0075274_1049687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 641 | Open in IMG/M |
| 3300006028|Ga0070717_10517331 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300006028|Ga0070717_11098115 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006173|Ga0070716_101152178 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006175|Ga0070712_100299341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1301 | Open in IMG/M |
| 3300006175|Ga0070712_100609894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 924 | Open in IMG/M |
| 3300006175|Ga0070712_101619087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 566 | Open in IMG/M |
| 3300006755|Ga0079222_12682479 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300006804|Ga0079221_10329569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 911 | Open in IMG/M |
| 3300006806|Ga0079220_11124703 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006871|Ga0075434_100662039 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300006903|Ga0075426_10214958 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300006903|Ga0075426_11323722 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300007258|Ga0099793_10359784 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300009137|Ga0066709_103261409 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300009545|Ga0105237_11023918 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009551|Ga0105238_11424281 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300009792|Ga0126374_10428256 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300010048|Ga0126373_11888879 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300010048|Ga0126373_12097776 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300010154|Ga0127503_10591351 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300010358|Ga0126370_11803453 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010361|Ga0126378_12922097 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010366|Ga0126379_11197093 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300010376|Ga0126381_104153280 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010376|Ga0126381_104964975 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010376|Ga0126381_105023902 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010397|Ga0134124_10791620 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300012205|Ga0137362_11754622 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012210|Ga0137378_10785402 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012211|Ga0137377_10858005 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012356|Ga0137371_10619269 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300012357|Ga0137384_10153915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 1924 | Open in IMG/M |
| 3300012917|Ga0137395_10495877 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300012960|Ga0164301_10488500 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012989|Ga0164305_11819296 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300014823|Ga0120170_1112487 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300017959|Ga0187779_10058318 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Bbin02 | 2263 | Open in IMG/M |
| 3300017959|Ga0187779_10185792 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300017974|Ga0187777_10014035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5073 | Open in IMG/M |
| 3300021086|Ga0179596_10201208 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300024245|Ga0247677_1043177 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300025906|Ga0207699_10076300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 2064 | Open in IMG/M |
| 3300025910|Ga0207684_10791386 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300025910|Ga0207684_11472130 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025915|Ga0207693_10181817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1655 | Open in IMG/M |
| 3300025915|Ga0207693_10728800 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300025922|Ga0207646_11079564 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300025929|Ga0207664_10651980 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300025929|Ga0207664_11965484 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300025935|Ga0207709_10176310 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300026358|Ga0257166_1045286 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027646|Ga0209466_1007211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2354 | Open in IMG/M |
| 3300027765|Ga0209073_10387537 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300030967|Ga0075399_11257983 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031231|Ga0170824_105295325 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031474|Ga0170818_111561046 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031561|Ga0318528_10055813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 2007 | Open in IMG/M |
| 3300031713|Ga0318496_10513465 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031724|Ga0318500_10130606 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300031736|Ga0318501_10658051 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031765|Ga0318554_10498891 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031769|Ga0318526_10392754 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031780|Ga0318508_1223554 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300031781|Ga0318547_10936901 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031796|Ga0318576_10442911 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031821|Ga0318567_10478141 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031845|Ga0318511_10017251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2582 | Open in IMG/M |
| 3300031890|Ga0306925_11124150 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300031941|Ga0310912_11504309 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032041|Ga0318549_10051881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 1694 | Open in IMG/M |
| 3300032055|Ga0318575_10720314 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032180|Ga0307471_100446917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium | 1431 | Open in IMG/M |
| 3300032205|Ga0307472_102379792 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300032828|Ga0335080_10278219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1823 | Open in IMG/M |
| 3300033004|Ga0335084_10043645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4617 | Open in IMG/M |
| 3300033289|Ga0310914_10829021 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 16.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.27% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_11188600 | 2124908045 | Soil | TTKSSYTGEPYVWPWLADAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSGVS |
| E41_08285710 | 2170459005 | Grass Soil | KADPATLTTTNSYYGEPYVFPWLSDAVVHESDFRTGYFEEELTPQVDQLWHNAWQAFNSA |
| INPhiseqgaiiFebDRAFT_1002367191 | 3300000364 | Soil | EPYVFPWMSDAVVHEEDFHVGYFEEELTPAVDQLWHNAWQAFNSGVS* |
| JGI10216J12902_1127450032 | 3300000956 | Soil | TLTTTNSYYGEPYVFPWLSDAVVHESDFQTGYFEEELTPQVDQLWHNAWQAFNSA* |
| A10PFW1_121233651 | 3300001538 | Permafrost | LTTTKNAYGVPYVFPWMSDAVVREEDFKTGRLELELTPGVDQLWHNAWQAFNAGVK* |
| JGI12627J18819_104353132 | 3300001867 | Forest Soil | VVHESDFHTGYFQEELTPQVDGLWHNAWQAFNSA* |
| Ga0066683_104532912 | 3300005172 | Soil | TTAKSYYGVPYVFPWLSEAVLQESDFKTGKLELELTPTVDQAWHNVWQSFNAGVK* |
| Ga0066680_106740312 | 3300005174 | Soil | SAVVDESDFHTGYFEAELTPQVDQLWHNVWQAFNSGVSG* |
| Ga0066680_107809762 | 3300005174 | Soil | TTTNSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0066688_108336032 | 3300005178 | Soil | ISAQGEPYVFPWLSDAIVRETDFTTGKLELELTPDVDSLWHDAWSQFQSG* |
| Ga0066676_103852231 | 3300005186 | Soil | SYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHHAWQAFNSA* |
| Ga0066388_1051086571 | 3300005332 | Tropical Forest Soil | GEPYIFPWLSDAVVHESDFRTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0070667_1007679132 | 3300005367 | Switchgrass Rhizosphere | DPETLTTTKSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0070714_1012212831 | 3300005435 | Agricultural Soil | FPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0070706_1005473702 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FYGEPYVFPWMSDAVVHESDFHIGYFEEELTPQVDQLWHNAWQAFNSGVS* |
| Ga0070706_1011864921 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0070698_1005784342 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | YVFPWLSDAVVRESDFHTGRLELELTPQVDQQWHNVWQAFNAGVG* |
| Ga0070698_1013477161 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ADPATLTTTKSYYGVPYVFPWMKDAVVYESDFKTGYFEEELTPSVDTLWHNAWQGFNSGVS* |
| Ga0070699_1003210681 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DPATLTTTNSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0070704_1021827322 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TLTTTNSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDGLWHNAWQAFNSA* |
| Ga0066701_103236002 | 3300005552 | Soil | DESDFHTGYFEAELTPQVDQLWHNVWQAFNSGVSG* |
| Ga0068856_1020232081 | 3300005614 | Corn Rhizosphere | TKSAYGEPYVFPWMSDAVVRESDFSIGYFEEELTPQVDQLWHNVWQAFNSG* |
| Ga0068859_1008475392 | 3300005617 | Switchgrass Rhizosphere | GEPYVFPWLSDAVVRESDFRTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0066903_1053594412 | 3300005764 | Tropical Forest Soil | FPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0066903_1058822232 | 3300005764 | Tropical Forest Soil | TNGYYGEPYVFPWLSDAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0066903_1062119942 | 3300005764 | Tropical Forest Soil | PWLSDAVVHEADFHTGYFEEELTPQVDALWHNAWQAFNSA* |
| Ga0066903_1072294532 | 3300005764 | Tropical Forest Soil | AVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0066903_1087177981 | 3300005764 | Tropical Forest Soil | YGEPYVFPWLSDAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0066903_1089729612 | 3300005764 | Tropical Forest Soil | YVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0068863_1022997312 | 3300005841 | Switchgrass Rhizosphere | VVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0068858_1022102072 | 3300005842 | Switchgrass Rhizosphere | VVRESDFQVGYFIEELTPQVDQLWHNAWQAFNSA* |
| Ga0068858_1026024541 | 3300005842 | Switchgrass Rhizosphere | TTTNSYYGEPYVFPWLSDAVVRESDFRTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0075274_10496871 | 3300005901 | Rice Paddy Soil | TLTTTNGFYGEPYVFPWMSDAVVHESDFRTGYFEEELTPQVDQLWHNAWQAFNSGVS* |
| Ga0070717_105173312 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TLTTTKSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDGLWHNAWQAFNSA* |
| Ga0070717_110981151 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EPYVFPWLSDAVVRESDFHTGYFEEELTPRVDQLWHNAWQAFNSA* |
| Ga0070716_1011521781 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SYYGEPYVFPWLSDAVVRESDFRTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0070712_1002993411 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FPWLSDAVVHESDFHTGYFQEELTPQVDGLWHNAWQAFNSA* |
| Ga0070712_1006098941 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ETLTTTKSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0070712_1016190871 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LTTTNSYYGEPYVFPWLSDAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0079222_126824792 | 3300006755 | Agricultural Soil | DAVVRESDFRTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0079221_103295691 | 3300006804 | Agricultural Soil | DPATLTTTNSYFGEPYVFPWLSDAVVHDSDFHTGYFQEELTPQVDALWHNAWQAFNSG* |
| Ga0079220_111247032 | 3300006806 | Agricultural Soil | VVHEEDFHVGYFEEELTPSVDQLWHNAWQAFNSGVS* |
| Ga0075434_1006620391 | 3300006871 | Populus Rhizosphere | VFPWLSDAVVHEEDFHVGYFEEELTPTVDQLWHNAWQAFNSGVS* |
| Ga0075426_102149581 | 3300006903 | Populus Rhizosphere | FPWLSDAVVHEEDFHVGYFEEELTPTVDQLWHNAWQAFNSGVS* |
| Ga0075426_113237222 | 3300006903 | Populus Rhizosphere | SYYGEPYVFPWLSDAVVDESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0099793_103597842 | 3300007258 | Vadose Zone Soil | GEPYVFPWLSDAIVYESDFHTGFFEEELTPQVDQLWHNAWQAFNSGVS* |
| Ga0066709_1032614092 | 3300009137 | Grasslands Soil | VFPWMSSAVVDESDFHTGDFEAELTPQVDQLWHNVWQAFNSGVSG* |
| Ga0105237_110239181 | 3300009545 | Corn Rhizosphere | TTKSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0105238_114242811 | 3300009551 | Corn Rhizosphere | AVVRESDFQVGYFIEELTPQVDQLWHNAWQAFNSA* |
| Ga0126374_104282562 | 3300009792 | Tropical Forest Soil | VFPWLSDAVVFEKDFHSGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0126373_118888792 | 3300010048 | Tropical Forest Soil | TLTTTKSYYGEPYVFPWLSDAVVRESDFHTGFFEEELTPQVDQRWHNAWQAFNSA* |
| Ga0126373_120977761 | 3300010048 | Tropical Forest Soil | SYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0127503_105913511 | 3300010154 | Soil | EPYVFPWLSDAVVHESDFHTGYFQEELTPAVDHLWHNAWQAFNSA* |
| Ga0126370_118034531 | 3300010358 | Tropical Forest Soil | YGEPYVFPWLSDAVVHESDFHTGYFQEELTPTVDQLWHNAWQAFNSA* |
| Ga0126378_129220972 | 3300010361 | Tropical Forest Soil | SDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0126379_111970932 | 3300010366 | Tropical Forest Soil | YVFPWLSDAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0126381_1041532802 | 3300010376 | Tropical Forest Soil | DAVVHESDFHTGFFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0126381_1049649752 | 3300010376 | Tropical Forest Soil | SDAVVRESDFHTGYFEEELTPQIDQLWHNAWQAFNSGVS* |
| Ga0126381_1050239022 | 3300010376 | Tropical Forest Soil | YGEPYVFPWLSDAVVHESDFRTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0134124_107916202 | 3300010397 | Terrestrial Soil | YVFPWLSDAVVRESDFHTGYFQEELTPQVDGLWHNAWQVFNSA* |
| Ga0137362_117546221 | 3300012205 | Vadose Zone Soil | YGEPYVFPWLSDAIVYETDFHTGFFEEELTPQVDQLWHNAWQAFNSGVS* |
| Ga0137378_107854022 | 3300012210 | Vadose Zone Soil | ATLTTTSSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0137377_108580051 | 3300012211 | Vadose Zone Soil | LTTTSSYYGEPYVFPWLSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0137371_106192691 | 3300012356 | Vadose Zone Soil | VVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA* |
| Ga0137384_101539151 | 3300012357 | Vadose Zone Soil | LTTTNGFYQEPYVFPWMSDAVVHESDFHTGYFEEELTPAVDQLWHNAWQAFNSGVS* |
| Ga0137395_104958771 | 3300012917 | Vadose Zone Soil | TPTTTKNYYGEPYVFPWLSDAIVYESDFHTGFFEEELTPQVDQLWHNAWQAFNSGVS* |
| Ga0164301_104885002 | 3300012960 | Soil | TTTNSYYGEPYVFPWLSDAVVRESDFRTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0164305_118192961 | 3300012989 | Soil | KNYYGEPYVFPWLSDAIVYESDFHTGFFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0157372_110571681 | 3300013307 | Corn Rhizosphere | RKADPETLTTTKSYYGEPYVFPWLSDAVVRETDFHTGYFEEELTPQVDQLWHNAWQAFNSA* |
| Ga0120170_11124872 | 3300014823 | Permafrost | PYVFPWMSDAVVREEDFKTGRLELELTPGVDQLWHNAWQAFNAGVK* |
| Ga0187779_100583181 | 3300017959 | Tropical Peatland | ENAYGVPYVFPWMSDAVIRESDFHTGREELELTPATDVLWHNAWQGFTAGAK |
| Ga0187779_101857923 | 3300017959 | Tropical Peatland | YGVPYVFPWMSDAVIRESDFRTGREELELTPATDVLWHDAWQGFTAGAK |
| Ga0187777_100140351 | 3300017974 | Tropical Peatland | PYVFPWMSDAVIRESDFHTGREELELTPATDVLWHNAWQGFTAGAK |
| Ga0179596_102012081 | 3300021086 | Vadose Zone Soil | LSDAVVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0247677_10431772 | 3300024245 | Soil | NSYYGEPYVFPWLSDAVVRESDFRTGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0207699_100763001 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DAIVHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0207684_107913861 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TLTTTKSYYGVPYVFPWMKDAVVYESDFKTGYFEEELTPSVDTLWHNAWQGFNSGVS |
| Ga0207684_114721301 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0207693_101818171 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | TLTTTNSYYGEPYVFPWLSDAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0207693_107288001 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ETLTTTKSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0207646_110795641 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SDAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0207664_106519802 | 3300025929 | Agricultural Soil | PWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0207664_119654841 | 3300025929 | Agricultural Soil | TTLTTTNSYYGEPYVFPWLSDAVVHERDFHTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0207709_101763102 | 3300025935 | Miscanthus Rhizosphere | PYVFPWLSDAVVRESDFRTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0257166_10452861 | 3300026358 | Soil | LTTTNSYYGEPYVFPWLSDAVVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0209466_10072111 | 3300027646 | Tropical Forest Soil | TTTNGYYGEPYVWPWLSDAVVHESDFQTGYFQEELTPQVDRLWHNAWQAFNSA |
| Ga0209073_103875371 | 3300027765 | Agricultural Soil | NSYFGEPYVFPWLSDAVVRDSDFHTGYFEEELTPQVDALWHNAWQAFNSG |
| Ga0075399_112579831 | 3300030967 | Soil | YYGVPYVFPWLTDAIVHESDFHTGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0170824_1052953251 | 3300031231 | Forest Soil | PYVFPWLKDAIVYESDFHTGYFEEELTPQVDGLWHNAWQAFTAGVS |
| Ga0170818_1115610461 | 3300031474 | Forest Soil | SYYGEPYVFPWLSDAVVHESDFHTGHFQEELTPQVDQLWHNAWQAFNSA |
| Ga0318528_100558133 | 3300031561 | Soil | SDAVVQESDFRTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0318496_105134652 | 3300031713 | Soil | TTNSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSG |
| Ga0318500_101306063 | 3300031724 | Soil | EPYVFPWMADAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0318501_106580511 | 3300031736 | Soil | ADPATLTTTNSAYGEPYVFPWMPDAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0318554_104988912 | 3300031765 | Soil | EPYVFPWMSDAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0318526_103927542 | 3300031769 | Soil | PWMADAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0318508_12235542 | 3300031780 | Soil | TTKGYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSG |
| Ga0318547_109369011 | 3300031781 | Soil | EPYVFPWLSDAVVQESDFRTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0318576_104429111 | 3300031796 | Soil | WLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFQSG |
| Ga0318567_104781411 | 3300031821 | Soil | ADPTTLTTTKSYYGEPYVFPWMTDAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA |
| Ga0318511_100172514 | 3300031845 | Soil | YYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFQSG |
| Ga0306925_111241502 | 3300031890 | Soil | TNGYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNSG |
| Ga0310912_115043091 | 3300031941 | Soil | WLSDAVVHESDFHTGYFEEELTPAVDQLWHNAWQAFNSA |
| Ga0318549_100518813 | 3300032041 | Soil | RQADPATLTTTNSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFNS |
| Ga0318575_107203141 | 3300032055 | Soil | TNSYYGEPYVFPWLSDAVVRESDFHTGYFEEELTPQVDQLWHNAWQAFQSG |
| Ga0307471_1004469171 | 3300032180 | Hardwood Forest Soil | DPATLTTTNSYYGEPYVFPWMSDAVVDESDFHTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0307472_1023797921 | 3300032205 | Hardwood Forest Soil | STLTTTNSYYGEPYVFPWLPDAIMHESDFHTGYFQEELTPQVDQLWHNAWQAFNSA |
| Ga0335080_102782193 | 3300032828 | Soil | TLTTTQNAYGVPYVFPWMSDAVIRESDFHTGLEELELTPATDVLWHNAWQGFTAGAK |
| Ga0335084_100436451 | 3300033004 | Soil | VDTLTTTKTVYGLPYVFPWMPDAVVREDDFQQGLVAGELTPQVDAQWRNVWQAFKSGRS |
| Ga0310914_108290211 | 3300033289 | Soil | SYYGEPYVFPWMADAVVFEKDFHVGYFEEELTPQVDQLWHNAWQAFNSA |
| ⦗Top⦘ |