| Basic Information | |
|---|---|
| Family ID | F087627 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.27 % |
| % of genes near scaffold ends (potentially truncated) | 42.73 % |
| % of genes from short scaffolds (< 2000 bps) | 81.82 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.545 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 12.24% Coil/Unstructured: 87.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF12706 | Lactamase_B_2 | 38.18 |
| PF11845 | DUF3365 | 10.00 |
| PF03070 | TENA_THI-4 | 7.27 |
| PF09900 | DUF2127 | 1.82 |
| PF04055 | Radical_SAM | 1.82 |
| PF01740 | STAS | 1.82 |
| PF02277 | DBI_PRT | 0.91 |
| PF13186 | SPASM | 0.91 |
| PF05402 | PqqD | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2038 | NaMN:DMB phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.55 % |
| Unclassified | root | N/A | 5.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0610286 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 596 | Open in IMG/M |
| 3300000953|JGI11615J12901_10361343 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300001431|F14TB_104499443 | Not Available | 742 | Open in IMG/M |
| 3300003993|Ga0055468_10009010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1856 | Open in IMG/M |
| 3300003996|Ga0055467_10015897 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300004798|Ga0058859_11309649 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005290|Ga0065712_10312194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
| 3300005328|Ga0070676_10115179 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300005332|Ga0066388_101839496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 1078 | Open in IMG/M |
| 3300005337|Ga0070682_100795106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 768 | Open in IMG/M |
| 3300005344|Ga0070661_101412818 | Not Available | 586 | Open in IMG/M |
| 3300005347|Ga0070668_100316448 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300005364|Ga0070673_102356389 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005438|Ga0070701_10156658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 1316 | Open in IMG/M |
| 3300005445|Ga0070708_100909871 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005458|Ga0070681_10109899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2696 | Open in IMG/M |
| 3300005547|Ga0070693_100112210 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300005713|Ga0066905_100187012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1534 | Open in IMG/M |
| 3300005764|Ga0066903_107027578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300005937|Ga0081455_10004907 | All Organisms → cellular organisms → Bacteria | 14823 | Open in IMG/M |
| 3300005937|Ga0081455_10488813 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300006049|Ga0075417_10382574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 694 | Open in IMG/M |
| 3300006049|Ga0075417_10472253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 628 | Open in IMG/M |
| 3300006058|Ga0075432_10021374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 2212 | Open in IMG/M |
| 3300006173|Ga0070716_101327644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300006358|Ga0068871_101833894 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006804|Ga0079221_10295728 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300006806|Ga0079220_11314006 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006844|Ga0075428_100800892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 1001 | Open in IMG/M |
| 3300006852|Ga0075433_10443385 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300006852|Ga0075433_11928470 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006854|Ga0075425_100405812 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300006854|Ga0075425_100552389 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300006854|Ga0075425_101150483 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300006854|Ga0075425_102886538 | Not Available | 527 | Open in IMG/M |
| 3300006871|Ga0075434_100125611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2582 | Open in IMG/M |
| 3300006871|Ga0075434_100338005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 1526 | Open in IMG/M |
| 3300006903|Ga0075426_10853681 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006954|Ga0079219_10402378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 908 | Open in IMG/M |
| 3300006954|Ga0079219_12530069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300009094|Ga0111539_10210341 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 2267 | Open in IMG/M |
| 3300010359|Ga0126376_10559616 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300010362|Ga0126377_11720749 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 702 | Open in IMG/M |
| 3300010371|Ga0134125_11520648 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 729 | Open in IMG/M |
| 3300010371|Ga0134125_11857311 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010371|Ga0134125_12031327 | Not Available | 625 | Open in IMG/M |
| 3300010373|Ga0134128_11820037 | Not Available | 670 | Open in IMG/M |
| 3300010398|Ga0126383_12189462 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 639 | Open in IMG/M |
| 3300010401|Ga0134121_12003623 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 611 | Open in IMG/M |
| 3300012884|Ga0157300_1040641 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 699 | Open in IMG/M |
| 3300012901|Ga0157288_10003045 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 2236 | Open in IMG/M |
| 3300012906|Ga0157295_10398807 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012909|Ga0157290_10028045 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 1298 | Open in IMG/M |
| 3300012915|Ga0157302_10373880 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012948|Ga0126375_10170742 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1395 | Open in IMG/M |
| 3300012955|Ga0164298_10672576 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 722 | Open in IMG/M |
| 3300012958|Ga0164299_10745991 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 691 | Open in IMG/M |
| 3300012960|Ga0164301_10603187 | Not Available | 811 | Open in IMG/M |
| 3300012961|Ga0164302_10032885 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2403 | Open in IMG/M |
| 3300012961|Ga0164302_11134874 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012984|Ga0164309_10179357 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1438 | Open in IMG/M |
| 3300012986|Ga0164304_11788187 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012987|Ga0164307_10082253 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1961 | Open in IMG/M |
| 3300012988|Ga0164306_10191287 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1429 | Open in IMG/M |
| 3300012989|Ga0164305_11383370 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 619 | Open in IMG/M |
| 3300014259|Ga0075311_1045424 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300014268|Ga0075309_1037731 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1079 | Open in IMG/M |
| 3300014310|Ga0075331_1050055 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 936 | Open in IMG/M |
| 3300014325|Ga0163163_12559861 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300014745|Ga0157377_10047380 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 2408 | Open in IMG/M |
| 3300015077|Ga0173483_10002631 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 5915 | Open in IMG/M |
| 3300015371|Ga0132258_10462604 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 3165 | Open in IMG/M |
| 3300015372|Ga0132256_103320119 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 541 | Open in IMG/M |
| 3300015373|Ga0132257_100521529 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1460 | Open in IMG/M |
| 3300019361|Ga0173482_10204943 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 810 | Open in IMG/M |
| 3300019362|Ga0173479_10212421 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300022892|Ga0247753_1047854 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 544 | Open in IMG/M |
| 3300025559|Ga0210087_1082164 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 637 | Open in IMG/M |
| 3300025795|Ga0210114_1120095 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 527 | Open in IMG/M |
| 3300025796|Ga0210113_1055852 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 791 | Open in IMG/M |
| 3300025893|Ga0207682_10011596 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 3443 | Open in IMG/M |
| 3300025901|Ga0207688_10044271 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300025911|Ga0207654_10164098 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1437 | Open in IMG/M |
| 3300025918|Ga0207662_10071628 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300025934|Ga0207686_11146891 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300025940|Ga0207691_10068772 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 3199 | Open in IMG/M |
| 3300025940|Ga0207691_10461052 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1081 | Open in IMG/M |
| 3300025940|Ga0207691_10461053 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300025941|Ga0207711_12056008 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 514 | Open in IMG/M |
| 3300025942|Ga0207689_10089888 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
| 3300025944|Ga0207661_10885397 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 822 | Open in IMG/M |
| 3300025944|Ga0207661_11805013 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300026062|Ga0208654_1050442 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026118|Ga0207675_100118477 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
| 3300026121|Ga0207683_10464431 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1167 | Open in IMG/M |
| 3300027252|Ga0209973_1031769 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 747 | Open in IMG/M |
| 3300027360|Ga0209969_1000337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6270 | Open in IMG/M |
| 3300027364|Ga0209967_1002233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2514 | Open in IMG/M |
| 3300027462|Ga0210000_1031026 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300027471|Ga0209995_1000339 | All Organisms → cellular organisms → Bacteria | 7328 | Open in IMG/M |
| 3300027873|Ga0209814_10269575 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 739 | Open in IMG/M |
| 3300028587|Ga0247828_10398900 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 791 | Open in IMG/M |
| 3300031908|Ga0310900_11410691 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 585 | Open in IMG/M |
| 3300031943|Ga0310885_10055241 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 1664 | Open in IMG/M |
| 3300032000|Ga0310903_10711395 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032003|Ga0310897_10420878 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 635 | Open in IMG/M |
| 3300032013|Ga0310906_10411170 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 896 | Open in IMG/M |
| 3300032017|Ga0310899_10563994 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300033412|Ga0310810_10213853 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira moscoviensis | 2163 | Open in IMG/M |
| 3300033412|Ga0310810_11096249 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 663 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.36% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.55% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 4.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.64% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_06102862 | 2228664021 | Soil | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA |
| JGI11615J12901_103613432 | 3300000953 | Soil | NMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA* |
| F14TB_1044994431 | 3300001431 | Soil | MSAEIGGYQDDFDERGSKPEEVVRSSDDPQSVPNVA* |
| Ga0055468_100090102 | 3300003993 | Natural And Restored Wetlands | MATWTTPTYTEINMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA* |
| Ga0055467_100158972 | 3300003996 | Natural And Restored Wetlands | MATWTTPTYTEISMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA* |
| Ga0058859_113096491 | 3300004798 | Host-Associated | EINMSAEIGGYQDDFDERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0065712_103121942 | 3300005290 | Miscanthus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA* |
| Ga0070676_101151792 | 3300005328 | Miscanthus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA* |
| Ga0066388_1018394962 | 3300005332 | Tropical Forest Soil | MITWTTPTYTEINMSAEIGGYQDEFDERGSKPEDTIRTSEAPQSVPKEA* |
| Ga0070682_1007951061 | 3300005337 | Corn Rhizosphere | VSRARTIPPSAIPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA* |
| Ga0070661_1014128181 | 3300005344 | Corn Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDLQSVPNVA* |
| Ga0070668_1003164482 | 3300005347 | Switchgrass Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTGDDSQSVPNVA* |
| Ga0070673_1023563891 | 3300005364 | Switchgrass Rhizosphere | MATWTTPTYSEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSFPKEA* |
| Ga0070701_101566582 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0070708_1009098711 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDD |
| Ga0070681_101098992 | 3300005458 | Corn Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTSDDPQSVPNVA* |
| Ga0070693_1001122102 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0066905_1001870121 | 3300005713 | Tropical Forest Soil | MSTWTTPTYTEINMSAEIGGYQDEFDERGSKPEDTIRTSEAPQSVPKEA* |
| Ga0066903_1070275782 | 3300005764 | Tropical Forest Soil | MITWTTPTYTEINMSAEIGGYQDEFDERGLKPEDTIRTSEAPQSVPKEA* |
| Ga0081455_1000490712 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNWEKPAYREVNMSAEIGGYQDDFDERGSKPEDTIRTGDAPQSVPKEA* |
| Ga0081455_104888131 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRTNDAPQSLPKEA* |
| Ga0075417_103825742 | 3300006049 | Populus Rhizosphere | LELARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0075417_104722531 | 3300006049 | Populus Rhizosphere | ELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERKSKPEDGIRKGDDSHSVPNEA* |
| Ga0075432_100213741 | 3300006058 | Populus Rhizosphere | ELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA* |
| Ga0070716_1013276442 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MITWTTPTYTEINMSAEIGGYQDDFDERNAKPEEAIRTVDDPQSVPNVA* |
| Ga0068871_1018338942 | 3300006358 | Miscanthus Rhizosphere | MSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0079221_102957282 | 3300006804 | Agricultural Soil | MNWEKPEYREVNMSAEIGGYQDDFDERTPKPDDTIRTADASRSVPTEA* |
| Ga0079220_113140061 | 3300006806 | Agricultural Soil | MIWTTPTYIEINMSAEIGGYQDDFDERNAKPEEVVRTVDDPQSVPNVA* |
| Ga0075428_1008008922 | 3300006844 | Populus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA* |
| Ga0075433_104433853 | 3300006852 | Populus Rhizosphere | EINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA* |
| Ga0075433_119284701 | 3300006852 | Populus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEV |
| Ga0075425_1004058122 | 3300006854 | Populus Rhizosphere | MATWTTPTYSEINMSAEIGGYQDDFDERIPKPEDAIRTNDAPQSLPKEA* |
| Ga0075425_1005523892 | 3300006854 | Populus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTADDPQSVPNVA* |
| Ga0075425_1011504832 | 3300006854 | Populus Rhizosphere | MATWTTPTYTEINMSAEIGGYQDDFDERKSKPEDGIRKGDDSHSVPNEA* |
| Ga0075425_1028865381 | 3300006854 | Populus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRT |
| Ga0075434_1001256113 | 3300006871 | Populus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSNPEEVVRTGDDPQSVPNVA* |
| Ga0075434_1003380052 | 3300006871 | Populus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRASDDPQSVPNVA* |
| Ga0075426_108536812 | 3300006903 | Populus Rhizosphere | MATWTTPTYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA* |
| Ga0079219_104023782 | 3300006954 | Agricultural Soil | MKTWTTPAYTEINMSAEIGGYQDDFDERAPRPDDAIRRSEAPQSQPNEA* |
| Ga0079219_125300692 | 3300006954 | Agricultural Soil | MATWTTPSYSEINMSAEIGGYQDDFDERIPKPDDAIRTNNAPQSLPKEA* |
| Ga0111539_102103411 | 3300009094 | Populus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDP |
| Ga0126376_105596162 | 3300010359 | Tropical Forest Soil | EINMSAEIGGYQDEFDERGSQHEDTIRTSEAPQSVPKEA* |
| Ga0126377_117207492 | 3300010362 | Tropical Forest Soil | MATWTTPTYTEINMSAEIGGYQDDFDERTPKPDNAIRTNDAPQSVPKEA* |
| Ga0134125_115206482 | 3300010371 | Terrestrial Soil | MATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSLPKEA* |
| Ga0134125_118573111 | 3300010371 | Terrestrial Soil | TTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0134125_120313272 | 3300010371 | Terrestrial Soil | MVTWTTPAYTEINMSAEIGGYLDDFEERGSKPEEVVRTGDDSQSVPNVA* |
| Ga0134128_118200372 | 3300010373 | Terrestrial Soil | MVIWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDD |
| Ga0126383_121894621 | 3300010398 | Tropical Forest Soil | MITWTTPTYTEINMSAEIGGYQDEFDERGSQPEDTIRTSEAPQSVPKEA* |
| Ga0134121_120036232 | 3300010401 | Terrestrial Soil | FMFTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0157300_10406411 | 3300012884 | Soil | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVR |
| Ga0157288_100030451 | 3300012901 | Soil | VFIVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0157295_103988071 | 3300012906 | Soil | VELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA* |
| Ga0157290_100280451 | 3300012909 | Soil | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVV |
| Ga0157302_103738802 | 3300012915 | Soil | YTEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSLPKEA* |
| Ga0126375_101707422 | 3300012948 | Tropical Forest Soil | MITWTTPTYTEINMSAEIGGYQDEFDERGAKPEDTIRMNEAPQSVPKEA* |
| Ga0164298_106725762 | 3300012955 | Soil | MIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGEHPQSVPNEA* |
| Ga0164299_107459911 | 3300012958 | Soil | MATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSFPKEA* |
| Ga0164301_106031872 | 3300012960 | Soil | MIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGDDPQSVPNEA* |
| Ga0164302_100328853 | 3300012961 | Soil | MITWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTVDDPQSVPNVA* |
| Ga0164302_111348742 | 3300012961 | Soil | EINMSAEIGGYQDDFEERAPRPEDAIRPDDDPQSLPNEA* |
| Ga0164309_101793572 | 3300012984 | Soil | MIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGDDPRSVPNEA* |
| Ga0164304_117881871 | 3300012986 | Soil | MIWTTPAYTEINMSAEIGGYQDDFDERNPKPEEAIRTGEGPQSFPNEA* |
| Ga0164307_100822533 | 3300012987 | Soil | MIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGEGPQSVPNEA* |
| Ga0164306_101912872 | 3300012988 | Soil | MIWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGDDPQSVPNKA* |
| Ga0164305_113833702 | 3300012989 | Soil | MITWTTPAYTEINMSAEIGGYQDDFDERNSKPEEAIRTGDDPQSLPNKA* |
| Ga0075311_10454241 | 3300014259 | Natural And Restored Wetlands | EISMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA* |
| Ga0075309_10377312 | 3300014268 | Natural And Restored Wetlands | MATWTTPTYTEINMSAEIGGYQDDFDERIPKPEDAIRPGDDPQSIPNEA* |
| Ga0075331_10500551 | 3300014310 | Natural And Restored Wetlands | MATWTTPTYTEINMSAEIGGYQDDFDERLPKPEDAIRPGDDPQSIPNEA* |
| Ga0163163_125598611 | 3300014325 | Switchgrass Rhizosphere | AYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVLNVA* |
| Ga0157377_100473804 | 3300014745 | Miscanthus Rhizosphere | VELARGVLMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA* |
| Ga0173483_100026311 | 3300015077 | Soil | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEQVVRTGDDSQSVPNVA* |
| Ga0132258_104626042 | 3300015371 | Arabidopsis Rhizosphere | MITWTTPTYTEINMSAEIGGYQDDFDERNSKPEEAIRTVDDPQSVPNVA* |
| Ga0132256_1033201191 | 3300015372 | Arabidopsis Rhizosphere | REHVEIPMATWTTPTYSEINMSAEIGGYQDDFDERIPKPDDAIRTNNAPQSLPKEA* |
| Ga0132257_1005215291 | 3300015373 | Arabidopsis Rhizosphere | TEINMSAEIGGYQDDFDERGSKPEEVVRTGDDRQSVPNVA* |
| Ga0173482_102049432 | 3300019361 | Soil | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTSDDPQSVPNVA |
| Ga0173479_102124212 | 3300019362 | Soil | MVTWPTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA |
| Ga0247753_10478541 | 3300022892 | Soil | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA |
| Ga0210087_10821642 | 3300025559 | Natural And Restored Wetlands | MATWTTPTYTEISMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA |
| Ga0210114_11200952 | 3300025795 | Natural And Restored Wetlands | ATWTTPTYTEINMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA |
| Ga0210113_10558522 | 3300025796 | Natural And Restored Wetlands | MATWTTPTYTEINMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA |
| Ga0207682_100115963 | 3300025893 | Miscanthus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDLQSVPNVA |
| Ga0207688_100442712 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDPQSVPNVA |
| Ga0207654_101640982 | 3300025911 | Corn Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVLNVA |
| Ga0207662_100716285 | 3300025918 | Switchgrass Rhizosphere | EINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA |
| Ga0207686_111468911 | 3300025934 | Miscanthus Rhizosphere | TIPHSTIPIELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA |
| Ga0207691_100687725 | 3300025940 | Miscanthus Rhizosphere | NMSAEIGGYQDEFEERVPKRDDAIHTVDAPPSVADEA |
| Ga0207691_104610521 | 3300025940 | Miscanthus Rhizosphere | IPPSAIPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA |
| Ga0207691_104610531 | 3300025940 | Miscanthus Rhizosphere | IPPSAIPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNVA |
| Ga0207711_120560081 | 3300025941 | Switchgrass Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTGDDSQSVPNVA |
| Ga0207689_100898882 | 3300025942 | Miscanthus Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTDDDPQSVPNVA |
| Ga0207661_108853972 | 3300025944 | Corn Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNV |
| Ga0207661_118050132 | 3300025944 | Corn Rhizosphere | ARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA |
| Ga0208654_10504421 | 3300026062 | Natural And Restored Wetlands | EINMSAEIGGYQDDFDERTPKPEDAIRPGDDPQSIPNEA |
| Ga0207675_1001184771 | 3300026118 | Switchgrass Rhizosphere | AMKWETPAFVEINMSAEIGGYKHDFAERGSKPEEIVRTSDDPQSVPNVA |
| Ga0207683_104644312 | 3300026121 | Miscanthus Rhizosphere | MATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRMNDAPQSLPKEA |
| Ga0209973_10317692 | 3300027252 | Arabidopsis Thaliana Rhizosphere | DPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA |
| Ga0209969_10003375 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA |
| Ga0209967_10022332 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTGDDPQSVPNVA |
| Ga0210000_10310261 | 3300027462 | Arabidopsis Thaliana Rhizosphere | STIPIELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTGDDSQSVPNV |
| Ga0209995_100033912 | 3300027471 | Arabidopsis Thaliana Rhizosphere | PPSAIPVELARGVFMVTWTTPAYTEINMSAEIGGYQDDFDERGSKPEEVVRTSDDPQSVPNVA |
| Ga0209814_102695752 | 3300027873 | Populus Rhizosphere | MATWTTPTYTEINMSAEIGGYQDDFDERKSKPEDGIRKGDDSHSVPNEA |
| Ga0247828_103989001 | 3300028587 | Soil | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRASDDP |
| Ga0310900_114106911 | 3300031908 | Soil | MATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRMN |
| Ga0310885_100552411 | 3300031943 | Soil | SRARTIPPSAIPLELARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA |
| Ga0310903_107113951 | 3300032000 | Soil | ARGVFMVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRTDDDPQSVPNVA |
| Ga0310897_104208781 | 3300032003 | Soil | MATWTTPTYTEINMSAEIGGYQDDFDERIPKPDDAIRTNDAPQSLPKEA |
| Ga0310906_104111702 | 3300032013 | Soil | MVTWTTPAYTEINMSAEIGGYQDDFEERGSKPEEVVRASDDPQSVPNVA |
| Ga0310899_105639942 | 3300032017 | Soil | INMSAEIGGYQDDFDERIPKPDDSIRTNDAPQSLPKEA |
| Ga0310810_102138535 | 3300033412 | Soil | GDLMKTWTTPAYTEINMSAEIGGYQDDFDERAPRPDDAIRRSEAPQSQPNEA |
| Ga0310810_110962491 | 3300033412 | Soil | MATWTTPTYSEINMSAEIGGYQDDFDERIPKPEDAIRTNDAPQSLPKEA |
| ⦗Top⦘ |