| Basic Information | |
|---|---|
| Family ID | F087624 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.91 % |
| % of genes from short scaffolds (< 2000 bps) | 0.91 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.091 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF06197 | DUF998 | 9.09 |
| PF05147 | LANC_like | 3.64 |
| PF05988 | DUF899 | 3.64 |
| PF08448 | PAS_4 | 3.64 |
| PF13847 | Methyltransf_31 | 2.73 |
| PF00903 | Glyoxalase | 2.73 |
| PF08031 | BBE | 2.73 |
| PF01872 | RibD_C | 2.73 |
| PF07883 | Cupin_2 | 1.82 |
| PF04237 | YjbR | 1.82 |
| PF08241 | Methyltransf_11 | 1.82 |
| PF13649 | Methyltransf_25 | 1.82 |
| PF02566 | OsmC | 1.82 |
| PF00174 | Oxidored_molyb | 1.82 |
| PF00126 | HTH_1 | 0.91 |
| PF06772 | LtrA | 0.91 |
| PF10431 | ClpB_D2-small | 0.91 |
| PF08734 | GYD | 0.91 |
| PF07690 | MFS_1 | 0.91 |
| PF08240 | ADH_N | 0.91 |
| PF05544 | Pro_racemase | 0.91 |
| PF00246 | Peptidase_M14 | 0.91 |
| PF00210 | Ferritin | 0.91 |
| PF02735 | Ku | 0.91 |
| PF14269 | Arylsulfotran_2 | 0.91 |
| PF13463 | HTH_27 | 0.91 |
| PF00664 | ABC_membrane | 0.91 |
| PF13671 | AAA_33 | 0.91 |
| PF00248 | Aldo_ket_red | 0.91 |
| PF02683 | DsbD | 0.91 |
| PF02371 | Transposase_20 | 0.91 |
| PF13602 | ADH_zinc_N_2 | 0.91 |
| PF12802 | MarR_2 | 0.91 |
| PF01242 | PTPS | 0.91 |
| PF04993 | TfoX_N | 0.91 |
| PF00501 | AMP-binding | 0.91 |
| PF13191 | AAA_16 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 9.09 |
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 3.64 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 3.64 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 2.73 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.73 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.73 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.82 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.82 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.82 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.82 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.82 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.91 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.91 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.91 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.91 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.09 % |
| All Organisms | root | All Organisms | 0.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005365|Ga0070688_100208110 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.36% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.55% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25406J46586_101979102 | 3300003203 | Tabebuia Heterophylla Rhizosphere | ETANVWVPHLVVGLAAIFLGLTTVQRGGYSYRKRPAAAAG* |
| Ga0063356_1024695671 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VSPWLFGFADEGANAWAPFVVVRLAAVVLGLTTKQRGRDSYRKTPAAT* |
| Ga0062595_1014658781 | 3300004479 | Soil | FGFADDPANVWIWFVVVGLAAIFLGLTTRQSGGYSYGRAEHPAIG* |
| Ga0070690_1001464451 | 3300005330 | Switchgrass Rhizosphere | NVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR* |
| Ga0070670_1010877441 | 3300005331 | Switchgrass Rhizosphere | WLFGFADEGANFWVPFVVIGVAAIFLGLTTKQAGGYGYRKTSTPTTA* |
| Ga0070660_1001106583 | 3300005339 | Corn Rhizosphere | FGFADNSANVWVPHLVVGLAAIFLGLTTVQQGGYSYRTASTAH* |
| Ga0070689_1003359111 | 3300005340 | Switchgrass Rhizosphere | GANFWVPFVVIGVAAIFLGLTTKQAGGYGYRKTSTPTTA* |
| Ga0070692_105212361 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ESTNVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR* |
| Ga0070688_1002081103 | 3300005365 | Switchgrass Rhizosphere | ADETANVWVPHLIVGLAAVFLGVTTKQQGGYTYGKAETQRTVIG* |
| Ga0070688_1003533672 | 3300005365 | Switchgrass Rhizosphere | PWLFGFADEGANFWVPFVVIGMAAIFLGLTTKQAGGYGYRKTSTPTTA* |
| Ga0070711_1005748303 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ESANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG* |
| Ga0070662_1007926282 | 3300005457 | Corn Rhizosphere | GANFWVPFVVIGMAAIFLGLTTKQAGGYGYRKTSTPTTA* |
| Ga0066697_103004482 | 3300005540 | Soil | FGFADETANVWLPHLIVGLAAVFLGLTTKQGGYSYRKVDTPRAAIG* |
| Ga0070672_1011705081 | 3300005543 | Miscanthus Rhizosphere | FADETANVWVPHLIVGLAAVFLGVTTKQQGGYTYGKAETQRTVIG* |
| Ga0070704_1009886573 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | DESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG* |
| Ga0066905_1013347951 | 3300005713 | Tropical Forest Soil | FGFADESANVWVPFVVVGIAAIVLGLTTKQQGGYSYRKPTAATP* |
| Ga0068870_106346322 | 3300005840 | Miscanthus Rhizosphere | WLPHVVVGLAATFLGLTTKQAGGYSYRKPGTGTPTAATR* |
| Ga0075432_104151121 | 3300006058 | Populus Rhizosphere | ESANVWVPHVIVGLAATFLGLTTVQRAGYSYRKRTTPTTAAG* |
| Ga0070716_1013995031 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR* |
| Ga0070712_1014592061 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG* |
| Ga0075422_103879111 | 3300006196 | Populus Rhizosphere | AWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG* |
| Ga0066659_104847502 | 3300006797 | Soil | FGFADETANVWLPHLIVGLAAVFLGLTTKQQGGYSYRKADTPRTAIG* |
| Ga0066660_113427402 | 3300006800 | Soil | GFADDSANVWVPHLVVGLAAVFLGLTTKQQGGYGYRKVDTPSAAVG* |
| Ga0075431_1001225646 | 3300006847 | Populus Rhizosphere | EGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG* |
| Ga0075433_114762141 | 3300006852 | Populus Rhizosphere | ADEGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG* |
| Ga0075425_1021674192 | 3300006854 | Populus Rhizosphere | AWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG* |
| Ga0075425_1022267952 | 3300006854 | Populus Rhizosphere | FADEGANAWLPLVVVGVAAIFLGLTTKQRGGYSYRRRDAAGTAA* |
| Ga0075424_1016215041 | 3300006904 | Populus Rhizosphere | VWVPHVVVGLAAVFLGLTTIQQGYSYRRSGATTAAG* |
| Ga0075424_1018637301 | 3300006904 | Populus Rhizosphere | WVPFVVIGLAAIFLGLTTKQAGGYRYGTSPRTTATG* |
| Ga0066710_1044606351 | 3300009012 | Grasslands Soil | NVWVPHLVVGLAAVFLGLTTKQQGGYSYRKAEPRSAAVG |
| Ga0105245_102874184 | 3300009098 | Miscanthus Rhizosphere | NVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG* |
| Ga0075418_106436102 | 3300009100 | Populus Rhizosphere | FADDGANFWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA* |
| Ga0105247_112547942 | 3300009101 | Switchgrass Rhizosphere | LFGFADEGANFWVPFVVIGGAAIFLGLTTKQAGGYGYRKTSTPTTA* |
| Ga0111538_141185502 | 3300009156 | Populus Rhizosphere | ANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG* |
| Ga0075423_102646223 | 3300009162 | Populus Rhizosphere | FWVPFVVIGLAAIFLGLTTKQVGGYRYGTSPRTTATG* |
| Ga0075423_122729763 | 3300009162 | Populus Rhizosphere | VVGLAAIFLGLTTKQQGGYSYRKSGTRTPTTASL* |
| Ga0075423_131251502 | 3300009162 | Populus Rhizosphere | DESANVWVPHLVVGLVAVFLGLTTIQQGYSYRRSGATTAAG* |
| Ga0105242_100786104 | 3300009176 | Miscanthus Rhizosphere | DPANVWIWFVVVGLAAIFLGLTTKQSGSYSYRRSEHPVTG* |
| Ga0105248_128300091 | 3300009177 | Switchgrass Rhizosphere | DESANVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR* |
| Ga0105238_117571541 | 3300009551 | Corn Rhizosphere | SANVWVPHVVVGLAAIFLGLTTIQHGGYSYRAATTAH* |
| Ga0105340_13238681 | 3300009610 | Soil | ADESASVWLPHVVVGLAAIFLGLTTKQRGGYRYGRHTDAASTSVG* |
| Ga0126304_103959942 | 3300010037 | Serpentine Soil | ADESANVWAPHVVVGLAAIFLGLTTVQRGYSYRKTTTPTTAAG* |
| Ga0126382_110839892 | 3300010047 | Tropical Forest Soil | NFWLPFVVIGVAAIFLGFTTKQQGGYSYGKTSTPTTA* |
| Ga0126382_122783001 | 3300010047 | Tropical Forest Soil | DEGPNAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG* |
| Ga0134125_120132201 | 3300010371 | Terrestrial Soil | ESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG* |
| Ga0134126_104961711 | 3300010396 | Terrestrial Soil | ETANVWAPFVVIGLAAVFLGLTTKQVGGYSYRRRPTAATG* |
| Ga0134123_108112482 | 3300010403 | Terrestrial Soil | VWVPHVAVGLAAIFLGLTTKQAGGYGYRKTSTPTTA* |
| Ga0137393_106276641 | 3300011271 | Vadose Zone Soil | ASVWVPHLVVGLAAVFLGLTTKQQGGYSYRKAETPRTAIG* |
| Ga0120163_11095511 | 3300012003 | Permafrost | SANVWLPHVIVGAAAIFLGLATKQSGGYSYRKSIDTPTTAAG* |
| Ga0157341_10508232 | 3300012494 | Arabidopsis Rhizosphere | PFVVIGVAAIFLGLTTKQVGGYRYGTSPRTTATG* |
| Ga0157330_10210702 | 3300012514 | Soil | GFADESANVWLPHVVVGLAAVFLGLTTVQRGYSYLRAEHPAAG* |
| Ga0157291_101692991 | 3300012902 | Soil | ETANVWLPFVVVGLAAIFLGLTTDQQGGYSYSKSRSTQTPAAG* |
| Ga0157283_100239691 | 3300012907 | Soil | FWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA* |
| Ga0126375_112071713 | 3300012948 | Tropical Forest Soil | WLPFVVIGAAAVFLGLTTKQQGGYSYGASRTAAG* |
| Ga0164301_115208952 | 3300012960 | Soil | FGFADESANVWVPFVVVGLAAVFLGLTTKQAGGYSYRRAETHPAAG* |
| Ga0157372_104365151 | 3300013307 | Corn Rhizosphere | SANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH* |
| Ga0157372_110951741 | 3300013307 | Corn Rhizosphere | DSANVWVPHVVVGLAAIFLGLTTIQQGGYSYRAATTAH* |
| Ga0134079_107638161 | 3300014166 | Grasslands Soil | GFADESANVWLPHLVVGLAAVFLGLTTKQAGGYRYGKASTAVG* |
| Ga0075314_11538842 | 3300014265 | Natural And Restored Wetlands | ANAWAPFVVVGLAAVFLGLTTKQRGGYSYRKTPAAT* |
| Ga0182001_105384181 | 3300014488 | Soil | HLVVGLAAVFLGLTTKQAGGYSYRKADRPSTAIG* |
| Ga0173483_108487442 | 3300015077 | Soil | LFGFADEGANAWAPFVVVGLAAVVLGLTTKQRGRDSYRKTPAAT* |
| Ga0132255_1006325554 | 3300015374 | Arabidopsis Rhizosphere | ADEGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG* |
| Ga0132255_1044250632 | 3300015374 | Arabidopsis Rhizosphere | LFGFADQGTNFWLPFVVIGVAAVFLGLTTKQAGGYSYGKTSTPSRA* |
| Ga0184608_100399481 | 3300018028 | Groundwater Sediment | ESANVWAPHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG |
| Ga0184619_100165151 | 3300018061 | Groundwater Sediment | TANVWVPHVVVGLAAIFLGLTTVQQGYSYRKSSAPTTATG |
| Ga0190270_114182331 | 3300018469 | Soil | FADESANVWAPHVVVGLAAIFLGLTTVQQGYSYRKGGTTQTTAAG |
| Ga0066669_114208271 | 3300018482 | Grasslands Soil | WVPHLVVGPAANFLGLTTVQQGGYSYRKRTTPTTAAG |
| Ga0173479_101369802 | 3300019362 | Soil | ANVWLPFVVVGLAAIFLGLTTKQQGGYSYSKSRSTQTPAAG |
| Ga0207685_107023841 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SDESANVWLPHVVVGLAAIFLGLTTVQRGYSYHRAEHQAAG |
| Ga0207643_103075362 | 3300025908 | Miscanthus Rhizosphere | LPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR |
| Ga0207707_104583442 | 3300025912 | Corn Rhizosphere | AGESTNVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR |
| Ga0207707_115785921 | 3300025912 | Corn Rhizosphere | DESANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEYPAAG |
| Ga0207671_116013981 | 3300025914 | Corn Rhizosphere | ANVWVPHVVVGLAAIFLGLTTIQQGGYSYRAATTAH |
| Ga0207663_110326171 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | WVPHVVVGLAAVFLGLTTKQSGGYSYRRAETPRPAAG |
| Ga0207660_104011731 | 3300025917 | Corn Rhizosphere | ADNSANVWVPHVVVGLAAIFLGLTTIQHGGYSYRAATTAH |
| Ga0207657_105946981 | 3300025919 | Corn Rhizosphere | ADNSANVWVPHLVVGLAAIFLGLTTIQQGGYSYRKSPNAVTG |
| Ga0207649_116635331 | 3300025920 | Corn Rhizosphere | ADNSANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH |
| Ga0207659_118673331 | 3300025926 | Miscanthus Rhizosphere | PHVVVGLAAIFLGLTTKQAGGYSYRKRGTGTPTAATR |
| Ga0207687_105576131 | 3300025927 | Miscanthus Rhizosphere | SANVWAPFVVVGLAAIFLGLTTKQAGGYSYRRTETHPAAG |
| Ga0207687_112719463 | 3300025927 | Miscanthus Rhizosphere | ADESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG |
| Ga0207664_104763623 | 3300025929 | Agricultural Soil | ANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG |
| Ga0207709_107655611 | 3300025935 | Miscanthus Rhizosphere | ANVCAPLVVVGLAAIFLGLTTKQRGGYSYRKRGADTSTTAAG |
| Ga0207661_107143921 | 3300025944 | Corn Rhizosphere | SANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH |
| Ga0207661_107290601 | 3300025944 | Corn Rhizosphere | STNVWAPHVIVGVAAIFLGLTTKQSGGYRYRRAETPAAG |
| Ga0207661_112221282 | 3300025944 | Corn Rhizosphere | VPHVVVGLAAVFLGLTTVQKAGYSYRKSTTPTTAAG |
| Ga0207677_104872561 | 3300026023 | Miscanthus Rhizosphere | DPANVWIWFVVVGLAAIFLGLTTKQSGSYSYRRSEHPVTG |
| Ga0209474_101191501 | 3300026550 | Soil | GFADETANAWVPHLVVGPAANFLGLTTVQRGGYSYRKGAAAAAG |
| Ga0209689_11544011 | 3300027748 | Soil | ETANVWVPHLVVGIAAIFLGLTTVQQGGYSYRKSGTTQTAAG |
| Ga0247818_111611902 | 3300028589 | Soil | NVWAPLVVVGLAAIFLGLTTKQRGGYSYRKRGADTSTTAAG |
| Ga0307322_100442893 | 3300028710 | Soil | GFADESANVWVPHLVVGLAAIFLGLTTIQQGYGYRRSPTTAAG |
| Ga0307311_100038836 | 3300028716 | Soil | DESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG |
| Ga0307311_102509701 | 3300028716 | Soil | SAHVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG |
| Ga0307301_100910791 | 3300028719 | Soil | NVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG |
| Ga0307316_102019681 | 3300028755 | Soil | SANVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG |
| Ga0307288_101867611 | 3300028778 | Soil | WIFGFADEGANVWAPFVVVGIAAIGLGLTTKQKGGYSYRRTSTVTG |
| Ga0307284_101996911 | 3300028799 | Soil | DESANVWAPHLIVGLAAIFLGLTTIQQGYSYRRSGATTAAG |
| Ga0307284_103667691 | 3300028799 | Soil | FADESANVWAQHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG |
| Ga0307503_101270201 | 3300028802 | Soil | RGLHSAWILNVVIGLAAVFLGLTTKQSGGYSYGRSEHPATG |
| Ga0307294_101545041 | 3300028810 | Soil | ESANVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG |
| Ga0307294_102764631 | 3300028810 | Soil | SANVWAPHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG |
| Ga0307292_100691783 | 3300028811 | Soil | WVPHLVVGLAAVFLGLATKQQGGYSYRKSGATPTTAAG |
| Ga0307312_102215561 | 3300028828 | Soil | TANVWVPHVIVGLAAVFLGLTTKQQGGYSYRKADTPRTAVG |
| Ga0307286_100515443 | 3300028876 | Soil | ADEGTNVWLPHVVVGLAAIFLGLTTKQSGGYSYGRTEHPATG |
| Ga0307300_101201193 | 3300028880 | Soil | FGFANESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG |
| Ga0247826_102819731 | 3300030336 | Soil | EGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG |
| Ga0307501_100986152 | 3300031152 | Soil | DYIVGAADRPQLIVGIAAVFLGLTTVQQGYSYRRSATTASG |
| Ga0310887_103688632 | 3300031547 | Soil | WLFGFADDGTNFWLPFVVIGVAAMFLGLTTKQQGGYSYGKTSTPTTA |
| Ga0310892_102361041 | 3300031858 | Soil | DEGANAWAPFVVVGVAAIFLGLTTKQRGGYSYRKSPATT |
| Ga0307470_100935941 | 3300032174 | Hardwood Forest Soil | FGFADEGTNVWLPHVIVGVAAIFLGLTTKQSGSYSYRRSEHPVTG |
| Ga0310896_105356112 | 3300032211 | Soil | ADEGANFWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA |
| ⦗Top⦘ |