Metagenome Family F087624

Basic Information
Family ID	F087624
Family Type	Metagenome
Number of Sequences	110
Average Sequence Length	41 residues
Representative Sequence	ESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Number of Associated Samples	95
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	0.91 %
% of genes from short scaffolds (< 2000 bps)	0.91 %
Associated GOLD sequencing projects	90
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Most Common Taxonomy
Group	Unclassified (99.091 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.909 % of family members)
Environment Ontology (ENVO)	Unclassified (44.545 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (54.545 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF06197	DUF998	9.09
PF05147	LANC_like	3.64
PF05988	DUF899	3.64
PF08448	PAS_4	3.64
PF13847	Methyltransf_31	2.73
PF00903	Glyoxalase	2.73
PF08031	BBE	2.73
PF01872	RibD_C	2.73
PF07883	Cupin_2	1.82
PF04237	YjbR	1.82
PF08241	Methyltransf_11	1.82
PF13649	Methyltransf_25	1.82
PF02566	OsmC	1.82
PF00174	Oxidored_molyb	1.82
PF00126	HTH_1	0.91
PF06772	LtrA	0.91
PF10431	ClpB_D2-small	0.91
PF08734	GYD	0.91
PF07690	MFS_1	0.91
PF08240	ADH_N	0.91
PF05544	Pro_racemase	0.91
PF00246	Peptidase_M14	0.91
PF00210	Ferritin	0.91
PF02735	Ku	0.91
PF14269	Arylsulfotran_2	0.91
PF13463	HTH_27	0.91
PF00664	ABC_membrane	0.91
PF13671	AAA_33	0.91
PF00248	Aldo_ket_red	0.91
PF02683	DsbD	0.91
PF02371	Transposase_20	0.91
PF13602	ADH_zinc_N_2	0.91
PF12802	MarR_2	0.91
PF01242	PTPS	0.91
PF04993	TfoX_N	0.91
PF00501	AMP-binding	0.91
PF13191	AAA_16	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG3371	Uncharacterized membrane protein	Function unknown [S]	9.09
COG4403	Lantibiotic modifying enzyme	Defense mechanisms [V]	3.64
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	3.64
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	2.73
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	2.73
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	2.73
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	1.82
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	1.82
COG2041	Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases	Energy production and conversion [C]	1.82
COG2315	Predicted DNA-binding protein with Ã¢â‚¬Ëœdouble-wingÃ¢â‚¬â„¢ structural motif, MmcQ/YjbR family	Transcription [K]	1.82
COG3915	Uncharacterized conserved protein	Function unknown [S]	1.82
COG3070	Transcriptional regulator of competence genes, TfoX/Sxy family	Transcription [K]	0.91
COG1273	Non-homologous end joining protein Ku, dsDNA break repair	Replication, recombination and repair [L]	0.91
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.91
COG3938	Proline racemase/hydroxyproline epimerase	Amino acid transport and metabolism [E]	0.91
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	0.91
COG4292	Low temperature requirement protein LtrA (function unknown)	Function unknown [S]	0.91
COG0720	6-pyruvoyl-tetrahydropterin synthase	Coenzyme transport and metabolism [H]	0.91

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
All Organisms	root	All Organisms	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
cellular organisms	root	All Organisms → cellular organisms	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.91 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005365\|Ga0070688_100208110	All Organisms → cellular organisms → Bacteria	1372	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.55%
Host-Associated	Host-Associated	35.45%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.82%
Plants	Host-Associated → Plants	35.45%
Aquatic	Environmental → Aquatic	2.73%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	61.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.18%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.27%
Sediment	Environmental → Aquatic → Sediment	2.73%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	21.82%
Loam	Environmental → Terrestrial → Soil → Loam	17.27%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.36%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.45%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.82%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	30.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	21.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	16.36%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.36%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.45%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.82%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.91%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.91%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.91%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.91%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	20.91%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	11.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	6.36%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	5.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.55%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.64%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.64%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.73%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.73%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.82%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.82%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.82%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.82%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.82%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.91%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.91%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.91%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.91%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.91%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.91%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.91%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.91%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.91%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.91%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012003	Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M	Environmental	Open in IMG/M
3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Host-Associated	Open in IMG/M
3300012514	Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510	Environmental	Open in IMG/M
3300012902	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014265	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2	Environmental	Open in IMG/M
3300014488	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG	Environmental	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300028710	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380	Environmental	Open in IMG/M
3300028716	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198	Environmental	Open in IMG/M
3300028719	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182	Environmental	Open in IMG/M
3300028755	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356	Environmental	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028810	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028876	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140	Environmental	Open in IMG/M
3300028880	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25406J46586_101979102	3300003203	Tabebuia Heterophylla Rhizosphere	ETANVWVPHLVVGLAAIFLGLTTVQRGGYSYRKRPAAAAG*
Ga0063356_1024695671	3300004463	Arabidopsis Thaliana Rhizosphere	VSPWLFGFADEGANAWAPFVVVRLAAVVLGLTTKQRGRDSYRKTPAAT*
Ga0062595_1014658781	3300004479	Soil	FGFADDPANVWIWFVVVGLAAIFLGLTTRQSGGYSYGRAEHPAIG*
Ga0070690_1001464451	3300005330	Switchgrass Rhizosphere	NVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0070670_1010877441	3300005331	Switchgrass Rhizosphere	WLFGFADEGANFWVPFVVIGVAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0070660_1001106583	3300005339	Corn Rhizosphere	FGFADNSANVWVPHLVVGLAAIFLGLTTVQQGGYSYRTASTAH*
Ga0070689_1003359111	3300005340	Switchgrass Rhizosphere	GANFWVPFVVIGVAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0070692_105212361	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	ESTNVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0070688_1002081103	3300005365	Switchgrass Rhizosphere	ADETANVWVPHLIVGLAAVFLGVTTKQQGGYTYGKAETQRTVIG*
Ga0070688_1003533672	3300005365	Switchgrass Rhizosphere	PWLFGFADEGANFWVPFVVIGMAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0070711_1005748303	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	ESANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG*
Ga0070662_1007926282	3300005457	Corn Rhizosphere	GANFWVPFVVIGMAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0066697_103004482	3300005540	Soil	FGFADETANVWLPHLIVGLAAVFLGLTTKQGGYSYRKVDTPRAAIG*
Ga0070672_1011705081	3300005543	Miscanthus Rhizosphere	FADETANVWVPHLIVGLAAVFLGVTTKQQGGYTYGKAETQRTVIG*
Ga0070704_1009886573	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	DESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG*
Ga0066905_1013347951	3300005713	Tropical Forest Soil	FGFADESANVWVPFVVVGIAAIVLGLTTKQQGGYSYRKPTAATP*
Ga0068870_106346322	3300005840	Miscanthus Rhizosphere	WLPHVVVGLAATFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0075432_104151121	3300006058	Populus Rhizosphere	ESANVWVPHVIVGLAATFLGLTTVQRAGYSYRKRTTPTTAAG*
Ga0070716_1013995031	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	PHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0070712_1014592061	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	NVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG*
Ga0075422_103879111	3300006196	Populus Rhizosphere	AWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0066659_104847502	3300006797	Soil	FGFADETANVWLPHLIVGLAAVFLGLTTKQQGGYSYRKADTPRTAIG*
Ga0066660_113427402	3300006800	Soil	GFADDSANVWVPHLVVGLAAVFLGLTTKQQGGYGYRKVDTPSAAVG*
Ga0075431_1001225646	3300006847	Populus Rhizosphere	EGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0075433_114762141	3300006852	Populus Rhizosphere	ADEGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG*
Ga0075425_1021674192	3300006854	Populus Rhizosphere	AWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG*
Ga0075425_1022267952	3300006854	Populus Rhizosphere	FADEGANAWLPLVVVGVAAIFLGLTTKQRGGYSYRRRDAAGTAA*
Ga0075424_1016215041	3300006904	Populus Rhizosphere	VWVPHVVVGLAAVFLGLTTIQQGYSYRRSGATTAAG*
Ga0075424_1018637301	3300006904	Populus Rhizosphere	WVPFVVIGLAAIFLGLTTKQAGGYRYGTSPRTTATG*
Ga0066710_1044606351	3300009012	Grasslands Soil	NVWVPHLVVGLAAVFLGLTTKQQGGYSYRKAEPRSAAVG
Ga0105245_102874184	3300009098	Miscanthus Rhizosphere	NVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG*
Ga0075418_106436102	3300009100	Populus Rhizosphere	FADDGANFWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA*
Ga0105247_112547942	3300009101	Switchgrass Rhizosphere	LFGFADEGANFWVPFVVIGGAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0111538_141185502	3300009156	Populus Rhizosphere	ANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0075423_102646223	3300009162	Populus Rhizosphere	FWVPFVVIGLAAIFLGLTTKQVGGYRYGTSPRTTATG*
Ga0075423_122729763	3300009162	Populus Rhizosphere	VVGLAAIFLGLTTKQQGGYSYRKSGTRTPTTASL*
Ga0075423_131251502	3300009162	Populus Rhizosphere	DESANVWVPHLVVGLVAVFLGLTTIQQGYSYRRSGATTAAG*
Ga0105242_100786104	3300009176	Miscanthus Rhizosphere	DPANVWIWFVVVGLAAIFLGLTTKQSGSYSYRRSEHPVTG*
Ga0105248_128300091	3300009177	Switchgrass Rhizosphere	DESANVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR*
Ga0105238_117571541	3300009551	Corn Rhizosphere	SANVWVPHVVVGLAAIFLGLTTIQHGGYSYRAATTAH*
Ga0105340_13238681	3300009610	Soil	ADESASVWLPHVVVGLAAIFLGLTTKQRGGYRYGRHTDAASTSVG*
Ga0126304_103959942	3300010037	Serpentine Soil	ADESANVWAPHVVVGLAAIFLGLTTVQRGYSYRKTTTPTTAAG*
Ga0126382_110839892	3300010047	Tropical Forest Soil	NFWLPFVVIGVAAIFLGFTTKQQGGYSYGKTSTPTTA*
Ga0126382_122783001	3300010047	Tropical Forest Soil	DEGPNAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0134125_120132201	3300010371	Terrestrial Soil	ESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG*
Ga0134126_104961711	3300010396	Terrestrial Soil	ETANVWAPFVVIGLAAVFLGLTTKQVGGYSYRRRPTAATG*
Ga0134123_108112482	3300010403	Terrestrial Soil	VWVPHVAVGLAAIFLGLTTKQAGGYGYRKTSTPTTA*
Ga0137393_106276641	3300011271	Vadose Zone Soil	ASVWVPHLVVGLAAVFLGLTTKQQGGYSYRKAETPRTAIG*
Ga0120163_11095511	3300012003	Permafrost	SANVWLPHVIVGAAAIFLGLATKQSGGYSYRKSIDTPTTAAG*
Ga0157341_10508232	3300012494	Arabidopsis Rhizosphere	PFVVIGVAAIFLGLTTKQVGGYRYGTSPRTTATG*
Ga0157330_10210702	3300012514	Soil	GFADESANVWLPHVVVGLAAVFLGLTTVQRGYSYLRAEHPAAG*
Ga0157291_101692991	3300012902	Soil	ETANVWLPFVVVGLAAIFLGLTTDQQGGYSYSKSRSTQTPAAG*
Ga0157283_100239691	3300012907	Soil	FWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA*
Ga0126375_112071713	3300012948	Tropical Forest Soil	WLPFVVIGAAAVFLGLTTKQQGGYSYGASRTAAG*
Ga0164301_115208952	3300012960	Soil	FGFADESANVWVPFVVVGLAAVFLGLTTKQAGGYSYRRAETHPAAG*
Ga0157372_104365151	3300013307	Corn Rhizosphere	SANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH*
Ga0157372_110951741	3300013307	Corn Rhizosphere	DSANVWVPHVVVGLAAIFLGLTTIQQGGYSYRAATTAH*
Ga0134079_107638161	3300014166	Grasslands Soil	GFADESANVWLPHLVVGLAAVFLGLTTKQAGGYRYGKASTAVG*
Ga0075314_11538842	3300014265	Natural And Restored Wetlands	ANAWAPFVVVGLAAVFLGLTTKQRGGYSYRKTPAAT*
Ga0182001_105384181	3300014488	Soil	HLVVGLAAVFLGLTTKQAGGYSYRKADRPSTAIG*
Ga0173483_108487442	3300015077	Soil	LFGFADEGANAWAPFVVVGLAAVVLGLTTKQRGRDSYRKTPAAT*
Ga0132255_1006325554	3300015374	Arabidopsis Rhizosphere	ADEGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRAHTAAG*
Ga0132255_1044250632	3300015374	Arabidopsis Rhizosphere	LFGFADQGTNFWLPFVVIGVAAVFLGLTTKQAGGYSYGKTSTPSRA*
Ga0184608_100399481	3300018028	Groundwater Sediment	ESANVWAPHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG
Ga0184619_100165151	3300018061	Groundwater Sediment	TANVWVPHVVVGLAAIFLGLTTVQQGYSYRKSSAPTTATG
Ga0190270_114182331	3300018469	Soil	FADESANVWAPHVVVGLAAIFLGLTTVQQGYSYRKGGTTQTTAAG
Ga0066669_114208271	3300018482	Grasslands Soil	WVPHLVVGPAANFLGLTTVQQGGYSYRKRTTPTTAAG
Ga0173479_101369802	3300019362	Soil	ANVWLPFVVVGLAAIFLGLTTKQQGGYSYSKSRSTQTPAAG
Ga0207685_107023841	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	SDESANVWLPHVVVGLAAIFLGLTTVQRGYSYHRAEHQAAG
Ga0207643_103075362	3300025908	Miscanthus Rhizosphere	LPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR
Ga0207707_104583442	3300025912	Corn Rhizosphere	AGESTNVWLPHVVVGLAAIFLGLTTKQAGGYSYRKPGTGTPTAATR
Ga0207707_115785921	3300025912	Corn Rhizosphere	DESANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEYPAAG
Ga0207671_116013981	3300025914	Corn Rhizosphere	ANVWVPHVVVGLAAIFLGLTTIQQGGYSYRAATTAH
Ga0207663_110326171	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	WVPHVVVGLAAVFLGLTTKQSGGYSYRRAETPRPAAG
Ga0207660_104011731	3300025917	Corn Rhizosphere	ADNSANVWVPHVVVGLAAIFLGLTTIQHGGYSYRAATTAH
Ga0207657_105946981	3300025919	Corn Rhizosphere	ADNSANVWVPHLVVGLAAIFLGLTTIQQGGYSYRKSPNAVTG
Ga0207649_116635331	3300025920	Corn Rhizosphere	ADNSANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH
Ga0207659_118673331	3300025926	Miscanthus Rhizosphere	PHVVVGLAAIFLGLTTKQAGGYSYRKRGTGTPTAATR
Ga0207687_105576131	3300025927	Miscanthus Rhizosphere	SANVWAPFVVVGLAAIFLGLTTKQAGGYSYRRTETHPAAG
Ga0207687_112719463	3300025927	Miscanthus Rhizosphere	ADESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Ga0207664_104763623	3300025929	Agricultural Soil	ANVWLPHVVVGLAAVFLGLTTVQRGYSYHRAEHPAAG
Ga0207709_107655611	3300025935	Miscanthus Rhizosphere	ANVCAPLVVVGLAAIFLGLTTKQRGGYSYRKRGADTSTTAAG
Ga0207661_107143921	3300025944	Corn Rhizosphere	SANVWVPHVIVGLAAIFLGLTTVQQGGYSYRTATHAH
Ga0207661_107290601	3300025944	Corn Rhizosphere	STNVWAPHVIVGVAAIFLGLTTKQSGGYRYRRAETPAAG
Ga0207661_112221282	3300025944	Corn Rhizosphere	VPHVVVGLAAVFLGLTTVQKAGYSYRKSTTPTTAAG
Ga0207677_104872561	3300026023	Miscanthus Rhizosphere	DPANVWIWFVVVGLAAIFLGLTTKQSGSYSYRRSEHPVTG
Ga0209474_101191501	3300026550	Soil	GFADETANAWVPHLVVGPAANFLGLTTVQRGGYSYRKGAAAAAG
Ga0209689_11544011	3300027748	Soil	ETANVWVPHLVVGIAAIFLGLTTVQQGGYSYRKSGTTQTAAG
Ga0247818_111611902	3300028589	Soil	NVWAPLVVVGLAAIFLGLTTKQRGGYSYRKRGADTSTTAAG
Ga0307322_100442893	3300028710	Soil	GFADESANVWVPHLVVGLAAIFLGLTTIQQGYGYRRSPTTAAG
Ga0307311_100038836	3300028716	Soil	DESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Ga0307311_102509701	3300028716	Soil	SAHVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG
Ga0307301_100910791	3300028719	Soil	NVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Ga0307316_102019681	3300028755	Soil	SANVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG
Ga0307288_101867611	3300028778	Soil	WIFGFADEGANVWAPFVVVGIAAIGLGLTTKQKGGYSYRRTSTVTG
Ga0307284_101996911	3300028799	Soil	DESANVWAPHLIVGLAAIFLGLTTIQQGYSYRRSGATTAAG
Ga0307284_103667691	3300028799	Soil	FADESANVWAQHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG
Ga0307503_101270201	3300028802	Soil	RGLHSAWILNVVIGLAAVFLGLTTKQSGGYSYGRSEHPATG
Ga0307294_101545041	3300028810	Soil	ESANVWVPHVVVGLAAVFLGLATVQRAGYSYRKTATTATG
Ga0307294_102764631	3300028810	Soil	SANVWAPHLIVGLAAIFLGLTTIQQGYGYRRSGATTAAG
Ga0307292_100691783	3300028811	Soil	WVPHLVVGLAAVFLGLATKQQGGYSYRKSGATPTTAAG
Ga0307312_102215561	3300028828	Soil	TANVWVPHVIVGLAAVFLGLTTKQQGGYSYRKADTPRTAVG
Ga0307286_100515443	3300028876	Soil	ADEGTNVWLPHVVVGLAAIFLGLTTKQSGGYSYGRTEHPATG
Ga0307300_101201193	3300028880	Soil	FGFANESANVWVPHLVVGLAAIFLGLTTIQQGYSYRRSPTTAAG
Ga0247826_102819731	3300030336	Soil	EGANAWAPLVVVGLAAIFLGLTTKQSGGYRYRRPHTAAG
Ga0307501_100986152	3300031152	Soil	DYIVGAADRPQLIVGIAAVFLGLTTVQQGYSYRRSATTASG
Ga0310887_103688632	3300031547	Soil	WLFGFADDGTNFWLPFVVIGVAAMFLGLTTKQQGGYSYGKTSTPTTA
Ga0310892_102361041	3300031858	Soil	DEGANAWAPFVVVGVAAIFLGLTTKQRGGYSYRKSPATT
Ga0307470_100935941	3300032174	Hardwood Forest Soil	FGFADEGTNVWLPHVIVGVAAIFLGLTTKQSGSYSYRRSEHPVTG
Ga0310896_105356112	3300032211	Soil	ADEGANFWVPFVVIGVAAIFLGLTTKQAGGYSYRKTSTPTTA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F087624

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign