| Basic Information | |
|---|---|
| Family ID | F087623 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.636 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13460 | NAD_binding_10 | 6.36 |
| PF03966 | Trm112p | 2.73 |
| PF12697 | Abhydrolase_6 | 2.73 |
| PF01274 | Malate_synthase | 2.73 |
| PF11774 | Lsr2 | 1.82 |
| PF13242 | Hydrolase_like | 1.82 |
| PF04672 | Methyltransf_19 | 1.82 |
| PF01494 | FAD_binding_3 | 1.82 |
| PF00440 | TetR_N | 1.82 |
| PF00583 | Acetyltransf_1 | 1.82 |
| PF00196 | GerE | 1.82 |
| PF00005 | ABC_tran | 0.91 |
| PF04237 | YjbR | 0.91 |
| PF02979 | NHase_alpha | 0.91 |
| PF10096 | DUF2334 | 0.91 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.91 |
| PF13344 | Hydrolase_6 | 0.91 |
| PF01408 | GFO_IDH_MocA | 0.91 |
| PF01594 | AI-2E_transport | 0.91 |
| PF03706 | LPG_synthase_TM | 0.91 |
| PF13450 | NAD_binding_8 | 0.91 |
| PF01872 | RibD_C | 0.91 |
| PF01625 | PMSR | 0.91 |
| PF00069 | Pkinase | 0.91 |
| PF00384 | Molybdopterin | 0.91 |
| PF05653 | Mg_trans_NIPA | 0.91 |
| PF08327 | AHSA1 | 0.91 |
| PF00271 | Helicase_C | 0.91 |
| PF04286 | DUF445 | 0.91 |
| PF01609 | DDE_Tnp_1 | 0.91 |
| PF01243 | Putative_PNPOx | 0.91 |
| PF01636 | APH | 0.91 |
| PF04542 | Sigma70_r2 | 0.91 |
| PF00903 | Glyoxalase | 0.91 |
| PF12680 | SnoaL_2 | 0.91 |
| PF04075 | F420H2_quin_red | 0.91 |
| PF04138 | GtrA | 0.91 |
| PF13635 | DUF4143 | 0.91 |
| PF07484 | Collar | 0.91 |
| PF02211 | NHase_beta | 0.91 |
| PF00106 | adh_short | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.64 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.64 |
| COG2225 | Malate synthase | Energy production and conversion [C] | 2.73 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.82 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.82 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.82 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.91 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.91 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.91 |
| COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 0.91 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.91 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.91 |
| COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 0.91 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.91 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.91 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.91 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.91 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.91 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.55 % |
| Unclassified | root | N/A | 45.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10277804 | Not Available | 612 | Open in IMG/M |
| 3300001356|JGI12269J14319_10287295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300005178|Ga0066688_10606676 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005332|Ga0066388_102237302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 988 | Open in IMG/M |
| 3300005436|Ga0070713_100279402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1531 | Open in IMG/M |
| 3300005439|Ga0070711_100711020 | Not Available | 846 | Open in IMG/M |
| 3300005440|Ga0070705_101457111 | Not Available | 572 | Open in IMG/M |
| 3300005587|Ga0066654_10531527 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005602|Ga0070762_10008911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4982 | Open in IMG/M |
| 3300005610|Ga0070763_10107617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1414 | Open in IMG/M |
| 3300006028|Ga0070717_10214895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1688 | Open in IMG/M |
| 3300006028|Ga0070717_10710166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300006102|Ga0075015_100755759 | Not Available | 581 | Open in IMG/M |
| 3300006173|Ga0070716_101427217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 563 | Open in IMG/M |
| 3300006175|Ga0070712_101897712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora arenicola | 522 | Open in IMG/M |
| 3300006176|Ga0070765_100579494 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300006755|Ga0079222_12058793 | Not Available | 563 | Open in IMG/M |
| 3300006914|Ga0075436_100740630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300009012|Ga0066710_101746127 | Not Available | 944 | Open in IMG/M |
| 3300009148|Ga0105243_12833376 | Not Available | 525 | Open in IMG/M |
| 3300009525|Ga0116220_10424143 | Not Available | 597 | Open in IMG/M |
| 3300009683|Ga0116224_10045584 | Not Available | 2145 | Open in IMG/M |
| 3300009698|Ga0116216_10192762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Flexivirga → Flexivirga oryzae | 1251 | Open in IMG/M |
| 3300009698|Ga0116216_10278641 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1020 | Open in IMG/M |
| 3300010152|Ga0126318_10110498 | Not Available | 916 | Open in IMG/M |
| 3300010371|Ga0134125_11670209 | Not Available | 693 | Open in IMG/M |
| 3300010373|Ga0134128_10419878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1493 | Open in IMG/M |
| 3300010373|Ga0134128_12927415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300010379|Ga0136449_100506292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2095 | Open in IMG/M |
| 3300010379|Ga0136449_100807691 | Not Available | 1548 | Open in IMG/M |
| 3300010379|Ga0136449_101862009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300012206|Ga0137380_10414317 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300012351|Ga0137386_10081682 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300012359|Ga0137385_10438839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1110 | Open in IMG/M |
| 3300013307|Ga0157372_11679364 | Not Available | 731 | Open in IMG/M |
| 3300014969|Ga0157376_12368934 | Not Available | 570 | Open in IMG/M |
| 3300016270|Ga0182036_10952098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300016341|Ga0182035_12079389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300016371|Ga0182034_10960545 | Not Available | 737 | Open in IMG/M |
| 3300016387|Ga0182040_11121956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 659 | Open in IMG/M |
| 3300016387|Ga0182040_11601183 | Not Available | 555 | Open in IMG/M |
| 3300016422|Ga0182039_12276233 | Not Available | 500 | Open in IMG/M |
| 3300016445|Ga0182038_11011685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 736 | Open in IMG/M |
| 3300017937|Ga0187809_10148598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 810 | Open in IMG/M |
| 3300018062|Ga0187784_11674949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300018090|Ga0187770_11518514 | Not Available | 545 | Open in IMG/M |
| 3300019885|Ga0193747_1054377 | Not Available | 993 | Open in IMG/M |
| 3300021180|Ga0210396_10908019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300021402|Ga0210385_11551729 | Not Available | 505 | Open in IMG/M |
| 3300021403|Ga0210397_11450710 | Not Available | 533 | Open in IMG/M |
| 3300021404|Ga0210389_10363993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Pedococcus → Pedococcus bigeumensis | 1136 | Open in IMG/M |
| 3300021432|Ga0210384_11316221 | Not Available | 627 | Open in IMG/M |
| 3300021478|Ga0210402_10481370 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300021478|Ga0210402_11380889 | Not Available | 632 | Open in IMG/M |
| 3300021479|Ga0210410_10414667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
| 3300021559|Ga0210409_10859734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 780 | Open in IMG/M |
| 3300021560|Ga0126371_10341305 | Not Available | 1631 | Open in IMG/M |
| 3300021560|Ga0126371_13305930 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300022529|Ga0242668_1088204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300024249|Ga0247676_1078755 | Not Available | 546 | Open in IMG/M |
| 3300025898|Ga0207692_10186997 | Not Available | 1210 | Open in IMG/M |
| 3300025906|Ga0207699_10041217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2665 | Open in IMG/M |
| 3300025906|Ga0207699_10317557 | Not Available | 1092 | Open in IMG/M |
| 3300025911|Ga0207654_11284164 | Not Available | 534 | Open in IMG/M |
| 3300025913|Ga0207695_11403503 | Not Available | 579 | Open in IMG/M |
| 3300025915|Ga0207693_10144222 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300025915|Ga0207693_10361841 | Not Available | 1135 | Open in IMG/M |
| 3300025929|Ga0207664_11519712 | Not Available | 591 | Open in IMG/M |
| 3300026497|Ga0257164_1056703 | Not Available | 636 | Open in IMG/M |
| 3300027884|Ga0209275_10073158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1701 | Open in IMG/M |
| 3300028715|Ga0307313_10106700 | Not Available | 853 | Open in IMG/M |
| 3300028906|Ga0308309_11619679 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300028906|Ga0308309_11859749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300031543|Ga0318516_10871008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 507 | Open in IMG/M |
| 3300031547|Ga0310887_10959102 | Not Available | 544 | Open in IMG/M |
| 3300031549|Ga0318571_10027915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1544 | Open in IMG/M |
| 3300031564|Ga0318573_10152076 | Not Available | 1214 | Open in IMG/M |
| 3300031572|Ga0318515_10502104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
| 3300031640|Ga0318555_10300353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
| 3300031708|Ga0310686_102541829 | Not Available | 1076 | Open in IMG/M |
| 3300031713|Ga0318496_10194031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1115 | Open in IMG/M |
| 3300031713|Ga0318496_10326457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
| 3300031719|Ga0306917_10173898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1615 | Open in IMG/M |
| 3300031719|Ga0306917_11274934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 569 | Open in IMG/M |
| 3300031747|Ga0318502_10326946 | Not Available | 905 | Open in IMG/M |
| 3300031747|Ga0318502_11002347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 509 | Open in IMG/M |
| 3300031751|Ga0318494_10559047 | Not Available | 668 | Open in IMG/M |
| 3300031763|Ga0318537_10297225 | Not Available | 598 | Open in IMG/M |
| 3300031764|Ga0318535_10051221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1724 | Open in IMG/M |
| 3300031765|Ga0318554_10784643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 533 | Open in IMG/M |
| 3300031779|Ga0318566_10284696 | Not Available | 818 | Open in IMG/M |
| 3300031781|Ga0318547_10228685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 1117 | Open in IMG/M |
| 3300031792|Ga0318529_10598010 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031796|Ga0318576_10094974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1355 | Open in IMG/M |
| 3300031805|Ga0318497_10805564 | Not Available | 527 | Open in IMG/M |
| 3300031845|Ga0318511_10002660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5086 | Open in IMG/M |
| 3300031845|Ga0318511_10159238 | Not Available | 990 | Open in IMG/M |
| 3300031846|Ga0318512_10057738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia saprophytica | 1748 | Open in IMG/M |
| 3300031846|Ga0318512_10265410 | Not Available | 849 | Open in IMG/M |
| 3300031910|Ga0306923_12470173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300031912|Ga0306921_11263152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 819 | Open in IMG/M |
| 3300032008|Ga0318562_10353629 | Not Available | 854 | Open in IMG/M |
| 3300032008|Ga0318562_10699304 | Not Available | 583 | Open in IMG/M |
| 3300032010|Ga0318569_10518734 | Not Available | 555 | Open in IMG/M |
| 3300032074|Ga0308173_11592997 | Not Available | 614 | Open in IMG/M |
| 3300032160|Ga0311301_11834610 | Not Available | 719 | Open in IMG/M |
| 3300032898|Ga0335072_10182210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2520 | Open in IMG/M |
| 3300032954|Ga0335083_10922946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102778041 | 3300001356 | Peatlands Soil | GYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRDAAAGRRGGAA* |
| JGI12269J14319_102872951 | 3300001356 | Peatlands Soil | YAAFTSALHDALYLSATLLAAAALLSAVTLRRHHHAP* |
| JGI25615J43890_10606892 | 3300002910 | Grasslands Soil | AGYAAFESALHLALYLSAALLAGAALLAAITLRRRPQVAESTSSRRS* |
| Ga0066688_106066762 | 3300005178 | Soil | VQAGYAAFTSALHGALYLSAALLAGAALLSAVTLRQRRHAAESAYGEQAG* |
| Ga0066388_1022373021 | 3300005332 | Tropical Forest Soil | GGSTGGSSPIDQLVQAGFGAFTDALHAALYLSAALVAGAALLSAVTLRQRRHVT* |
| Ga0070713_1002794021 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SPLDQIIQAGYAAFTSALHAALYLSAALLAGAALLAAITLRQRRHAA* |
| Ga0070711_1007110201 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | STGNGPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT* |
| Ga0070705_1014571111 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAITLRQRRHAT* |
| Ga0070706_1003016691 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QAGYAAFESALHVALFLSAALLAGAALLAAITLRRRPQVAESTSSRRS* |
| Ga0066654_105315272 | 3300005587 | Soil | AFTSALHGALYLSAALLAGAALLSAVTLRQRRHAAESAYGEQAG* |
| Ga0070762_100089119 | 3300005602 | Soil | LDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT* |
| Ga0070763_101076171 | 3300005610 | Soil | PTGNDPLDQIIRAGYDAFTGALHDALYLSAALLAAAALLSAVTLRQRRHAT* |
| Ga0070717_102148954 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GSTGNGPLDQIIQAGYAAFTSALHAALYLSAALLAGAALLAAITLRQRRHAA* |
| Ga0070717_107101661 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DQIIQAGYAAFTSALHDALYLSAALLLGAALLSAVTLRRHRHAT* |
| Ga0075015_1007557591 | 3300006102 | Watersheds | NGPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT* |
| Ga0070716_1014272172 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT* |
| Ga0070712_1018977121 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TGNGPLDQIIQAGYAAFTGALHDALYLSAALLAGAALLSAVTLRQRRHAT* |
| Ga0070765_1005794944 | 3300006176 | Soil | STGSSPLDQIIQAGYAAFTSALHDALYLSAALLVGAALLSAVTLRPRRRACQPALTGST* |
| Ga0079222_120587931 | 3300006755 | Agricultural Soil | LIQAGFAAFTGALHSALYLSAALLAGAALLSAVTLRPRRQ* |
| Ga0075436_1007406302 | 3300006914 | Populus Rhizosphere | FTSALHAALYLSAALLAGAALLSAITMGAITSRQRRHAA* |
| Ga0066710_1017461271 | 3300009012 | Grasslands Soil | GSTGNGPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0105243_128333761 | 3300009148 | Miscanthus Rhizosphere | PIDQLIQAGFAAFTGALHSALYLSAALLAGAALLSAITLRQRRH* |
| Ga0116220_104241431 | 3300009525 | Peatlands Soil | AFTSALHDALYPSAALLAGAALLSAVTLRQRRDAAAGRRGGAA* |
| Ga0116224_100455841 | 3300009683 | Peatlands Soil | QAGYAAFTSALHAALYLSAALLGGAALLSAVTLRRR* |
| Ga0116216_101927621 | 3300009698 | Peatlands Soil | SPTGNSPLDQIVRAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT* |
| Ga0116216_102786412 | 3300009698 | Peatlands Soil | GHGSPTGNSPLDQIVRAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT* |
| Ga0126318_101104982 | 3300010152 | Soil | AGFAAFTGALHSALYLSAALLAGAALLSAVTLRQRRQ* |
| Ga0134125_116702091 | 3300010371 | Terrestrial Soil | NGPLDQIIQAGYAAFTSALHDALYLSAALLAAAALLSAVTLRQRRHAA* |
| Ga0134128_104198784 | 3300010373 | Terrestrial Soil | IQAGYAAFTSALHAALYLSAALLAGAALLAAITLRQRRHAA* |
| Ga0134128_129274152 | 3300010373 | Terrestrial Soil | LDQIIQAGYAAFTSALHAALYLSAALLAGAALLAAITLRQRRHAA* |
| Ga0136449_1005062921 | 3300010379 | Peatlands Soil | LDQIIRAGYAAFTSALHDALYLSATLLAAAALLSAVTLRRHHHAP* |
| Ga0136449_1008076912 | 3300010379 | Peatlands Soil | LDQIIRAGYAAFTSALHDALYLSATLLAAAALLSAVTLRRRRQDT* |
| Ga0136449_1018620093 | 3300010379 | Peatlands Soil | GHGSPTGNSPLDQIIRAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAP* |
| Ga0137380_104143172 | 3300012206 | Vadose Zone Soil | GNGPLDQIIQAGYAAFTGALHAALYLSAALLAAAALLSAVTLRHRRHAT* |
| Ga0137386_100816821 | 3300012351 | Vadose Zone Soil | TGNGPLDQIIQAGYAAFTGALHDALYLSAALLAGAALLSAVTLRQRRHAA* |
| Ga0137385_104388391 | 3300012359 | Vadose Zone Soil | AFTSALHAALYLSAALLAGAALLSAVTLRRRPAT* |
| Ga0157372_116793642 | 3300013307 | Corn Rhizosphere | IQAGFAAFTGALHSALYLSAALLAGAALLSAITLRQRRH* |
| Ga0157376_123689342 | 3300014969 | Miscanthus Rhizosphere | PLDQIIQAGFTAFTSALHDALYLSAALLAAAALLSAVTLRQRRHAT* |
| Ga0182036_109520981 | 3300016270 | Soil | GSSPLDQIIQAGYAAFTGALHAALYLSAALLGAAALLSAVTLRQRRHAPRAAETVT |
| Ga0182035_120793891 | 3300016341 | Soil | LGHGGSTGNSPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0182034_109605451 | 3300016371 | Soil | IIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRRRRPAG |
| Ga0182040_111219562 | 3300016387 | Soil | GNSPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRRRRHAT |
| Ga0182040_116011831 | 3300016387 | Soil | IIQAGYAAFTSALHDALYLSAALLAAAALLSAVTLRQRRHAA |
| Ga0182039_122762332 | 3300016422 | Soil | ALHDALYLSAALLAGAALLSFVTLRQRRRLETPGAL |
| Ga0182038_110116851 | 3300016445 | Soil | DQIIQAGYAAFTGALHDALYLSAALLAGAALLSAVTLRPRRRPA |
| Ga0187809_101485983 | 3300017937 | Freshwater Sediment | STGGNSPLDQLIQAGYGAFTSALHAALYLSAALLAGAALLSAITLRQRRHAP |
| Ga0187784_116749491 | 3300018062 | Tropical Peatland | LDQIVGAGYAAFTGALHDALYLSAALLAAAALLSAVTLRQRRRAA |
| Ga0187770_115185141 | 3300018090 | Tropical Peatland | PLDQIVGAGYAAFTGALHDALYLSAALLAGAALLSAVTLRRASHAN |
| Ga0193747_10543772 | 3300019885 | Soil | PHGGSSEGNSPLDQIIQAGFAAFTGALHAALYLSAALLAVAALLSFVTLRPRRHAA |
| Ga0210396_109080193 | 3300021180 | Soil | YAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0210385_115517291 | 3300021402 | Soil | LDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0210397_114507101 | 3300021403 | Soil | LDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRRRRPAT |
| Ga0210389_103639931 | 3300021404 | Soil | IQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAS |
| Ga0210384_113162211 | 3300021432 | Soil | IIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAS |
| Ga0210402_104813701 | 3300021478 | Soil | RPDGGSSTGDGPLDQIIQAGYAAFTSALHSALYLSAALLAAAALLSAVTLRQRRHAP |
| Ga0210402_113808891 | 3300021478 | Soil | QLIQAGFAAFTGALHSALYLSAALLAGAALLSAVTLRQRRQ |
| Ga0210410_104146673 | 3300021479 | Soil | NSPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0210409_108597342 | 3300021559 | Soil | AGYAAFTGALHAALYLSAALLAAAALLSAVTLRQRRHATR |
| Ga0126371_103413051 | 3300021560 | Tropical Forest Soil | AAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0126371_133059302 | 3300021560 | Tropical Forest Soil | AFTSALHAALYLSAALVAGAALLSALTLRQRRRAT |
| Ga0242668_10882042 | 3300022529 | Soil | GYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRDAA |
| Ga0247676_10787551 | 3300024249 | Soil | PIDQLIQAGFAAFTGALHSALYLSAALLAGAALLSAVTLRQRRQ |
| Ga0207692_101869971 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GYAAFTSALHDALYLSAALLAAAALLSAVTLRQRRHAT |
| Ga0207699_100412171 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QAGFAAFTGALHSALYLSAALLAGAALLSAVTLRQRRQ |
| Ga0207699_103175572 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LGHGGSTGNGPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0207654_112841642 | 3300025911 | Corn Rhizosphere | IQAGFAAFTGALHSALYLSAALLAGAALLSAVTLRQRRQ |
| Ga0207695_114035032 | 3300025913 | Corn Rhizosphere | FAAFTGALHSALYLSAALLAGAALLSAVTLRQRRQ |
| Ga0207693_101442221 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GNGPLDQIIQAGYAAFTSALHDALYLSAALLAAAALLSAVTLRQRRHAT |
| Ga0207693_103618412 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GNGPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0207664_115197121 | 3300025929 | Agricultural Soil | IIQAGYAAFTGALHAALYLSAALLAAAALLSAVTLRQRRHAT |
| Ga0257164_10567032 | 3300026497 | Soil | IQAGYAAFTGALHDALYLSAALLAGAALLSAVTLRQRRHAA |
| Ga0209275_100731582 | 3300027884 | Soil | HQIIQAGYDAFTSALHGALYLSAALLAGAALLSAVTLGQRRRAS |
| Ga0307313_101067001 | 3300028715 | Soil | DQIIQAGFAAFTGALHSALYLSAALLAGAALLSAVTLRQRRH |
| Ga0308309_116196791 | 3300028906 | Soil | QAGYAAFTGALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0308309_118597491 | 3300028906 | Soil | PLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0318516_108710082 | 3300031543 | Soil | LGHGGSTGNGPLDQIIQAGYAAFTSALHAALYLSAALLAGAALLSATTLRQRRHTT |
| Ga0310887_109591022 | 3300031547 | Soil | GGSSPLDQIINAGFAAFTGALHSALYLSAALLAGAALLSAVTLRQRRQ |
| Ga0318571_100279153 | 3300031549 | Soil | STGGNSPLDQIVQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRRRRHAT |
| Ga0318573_101520761 | 3300031564 | Soil | SSTGNGPLDQIIQAGYAAFTDALHGALYLSAGLLAAAALLSAIALRGRRHAN |
| Ga0318515_105021042 | 3300031572 | Soil | NGPLDQIIQAGYAAFTSALHAALYLSAALLAGAALLSATTLRQRRHTT |
| Ga0318555_103003531 | 3300031640 | Soil | GYAAFTGALHDALYLSAALLAGAALLSAVTLRQRRHAI |
| Ga0310686_1025418291 | 3300031708 | Soil | YAAFTGALHDALYLSAALLVGAALLSAVTLRPRRHAP |
| Ga0318496_101940311 | 3300031713 | Soil | GYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAI |
| Ga0318496_103264571 | 3300031713 | Soil | GPLDQIIQAGYAAFTSALHAALYLSAALLAGAALLSATTLRQRRHTT |
| Ga0306917_101738981 | 3300031719 | Soil | NGPLDQIIQAGYAAFTDALHGALYLSAALLAAAALLSAVTLRPRRRPA |
| Ga0306917_112749341 | 3300031719 | Soil | GYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRRPA |
| Ga0318502_103269462 | 3300031747 | Soil | QAGYAAFTDALHGALYLSAGLLAAAALLSAVALRGRRHAT |
| Ga0318502_110023472 | 3300031747 | Soil | GYAAFTSALHAALYLSAALLAGAALLSATTLRQRRHTT |
| Ga0318494_105590471 | 3300031751 | Soil | LDQIVQSGYAAFTSALHDALYLSAALLAAAALLSAVTLRQRRHAT |
| Ga0318537_102972252 | 3300031763 | Soil | GYAAFTGALHDALYLSAALLAGAALLSAVTLRPRRRPA |
| Ga0318535_100512211 | 3300031764 | Soil | YAAFTSALHDALYLSAALLAAAALLSAVTLRQRRHAT |
| Ga0318554_107846431 | 3300031765 | Soil | GSTGNGPLDQIIQAGYAAFTSALHAALYLSAALLAGAALLSATTLRQRRHTT |
| Ga0318566_102846962 | 3300031779 | Soil | QIIRAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAA |
| Ga0318547_102286854 | 3300031781 | Soil | DQIIQAGYAAFTDALHGALYLSAALLAAAALLSAVTLRSRRRPA |
| Ga0318529_105980101 | 3300031792 | Soil | DQIVQAGYAAFTGALHAALYLSAALLGAAALLSAVTLRQRRHAPRAAETVT |
| Ga0318576_100949741 | 3300031796 | Soil | LGHGGSTGNSPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAI |
| Ga0318497_108055642 | 3300031805 | Soil | LPHGSSSTGNGPLDQIIQAGYAAFTDALHGALYLSAALLAAAALLSAVTLRPRRRPA |
| Ga0318511_100026601 | 3300031845 | Soil | IIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRRPA |
| Ga0318511_101592382 | 3300031845 | Soil | TGNSPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0318512_100577381 | 3300031846 | Soil | AFTSALHDALYLSAALLAGAALLSAVTLRQRRRPA |
| Ga0318512_102654101 | 3300031846 | Soil | AFTSALHDALYLSAALLAAAALLSAVTLRQRRHAT |
| Ga0306923_124701731 | 3300031910 | Soil | GSTGNSPLDQIIQAGYAAFTSALHDALYLSAALLAGAALLSAVTLRQRRHAT |
| Ga0306921_112631522 | 3300031912 | Soil | IQAGYAAFTSALHAALYLSAALLAGAALLSATTLRQRRHTT |
| Ga0318562_103536291 | 3300032008 | Soil | QIIQAGYAAFTDALHGALYLSAGLLAAAALLSAVALRGRRHAT |
| Ga0318562_106993042 | 3300032008 | Soil | NGPLDQIIQAGYAAFTDALHGALYLSAGLLAAAALLSAVALRGRRHAN |
| Ga0318569_105187342 | 3300032010 | Soil | LPHGSSSTGNGPLDQIIQAGYAAFTDALHGALYLSAGLLAAAALLSAVALRGRRHAT |
| Ga0308173_115929971 | 3300032074 | Soil | WGSSPIDQLIQAGFAAFTGALHSALYLSAALLAGAALLSAVTLRPRRQ |
| Ga0311301_118346101 | 3300032160 | Peatlands Soil | FTSALHDALYLSAALLAGAALLSAVTLRQRRDAAAGRRGGAA |
| Ga0335072_101822101 | 3300032898 | Soil | QIVRAGYAAFTSALHDALYLSAALLIGAALLSAVTLRDRRQSAREDQLPDADVA |
| Ga0335083_109229463 | 3300032954 | Soil | GYAAFTSALHGALYLSAGLLAAAALLSAVTLRPRRRAA |
| ⦗Top⦘ |