| Basic Information | |
|---|---|
| Family ID | F087618 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | AYDVRWPDEERLTAKRPATATRKLGSMTRRAGRVRGAVSAESR |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.27 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.818 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.45% β-sheet: 0.00% Coil/Unstructured: 91.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 90.91 |
| PF00581 | Rhodanese | 5.45 |
| PF05995 | CDO_I | 3.64 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 3.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.82 % |
| Unclassified | root | N/A | 38.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZTSFBX01DRT28 | Not Available | 512 | Open in IMG/M |
| 3300003218|JGI26339J46600_10019512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1969 | Open in IMG/M |
| 3300004478|Ga0068972_1019923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 876 | Open in IMG/M |
| 3300004598|Ga0068975_1235219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300004606|Ga0068962_1333264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300004617|Ga0068955_1400057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300004635|Ga0062388_101208269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
| 3300004803|Ga0058862_12775736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae | 656 | Open in IMG/M |
| 3300005104|Ga0066818_1017574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300005435|Ga0070714_101558001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300005437|Ga0070710_10681807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
| 3300005564|Ga0070664_101274842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300005617|Ga0068859_103160735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300005618|Ga0068864_102606147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300005841|Ga0068863_100598119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1091 | Open in IMG/M |
| 3300006034|Ga0066656_10362551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 937 | Open in IMG/M |
| 3300006059|Ga0075017_101260447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
| 3300006059|Ga0075017_101427793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300006173|Ga0070716_101657393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300006175|Ga0070712_101346702 | Not Available | 622 | Open in IMG/M |
| 3300006176|Ga0070765_100282531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1530 | Open in IMG/M |
| 3300006797|Ga0066659_11167120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
| 3300007788|Ga0099795_10456555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300009038|Ga0099829_10320174 | Not Available | 1273 | Open in IMG/M |
| 3300009137|Ga0066709_100831524 | Not Available | 1340 | Open in IMG/M |
| 3300009520|Ga0116214_1180023 | Not Available | 792 | Open in IMG/M |
| 3300009672|Ga0116215_1439341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300009683|Ga0116224_10437061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
| 3300009698|Ga0116216_10148861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1439 | Open in IMG/M |
| 3300009824|Ga0116219_10541586 | Not Available | 642 | Open in IMG/M |
| 3300010159|Ga0099796_10096308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1107 | Open in IMG/M |
| 3300011018|Ga0138527_118076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300011120|Ga0150983_15808053 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300011120|Ga0150983_16477209 | Not Available | 737 | Open in IMG/M |
| 3300012212|Ga0150985_115713721 | Not Available | 682 | Open in IMG/M |
| 3300012359|Ga0137385_11291453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300012685|Ga0137397_10806115 | Not Available | 697 | Open in IMG/M |
| 3300012924|Ga0137413_11810602 | Not Available | 504 | Open in IMG/M |
| 3300012987|Ga0164307_10549772 | Not Available | 881 | Open in IMG/M |
| 3300013105|Ga0157369_11925990 | Not Available | 600 | Open in IMG/M |
| 3300013105|Ga0157369_12525944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300016341|Ga0182035_10456911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
| 3300017937|Ga0187809_10051207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1333 | Open in IMG/M |
| 3300017973|Ga0187780_10877243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300018001|Ga0187815_10410241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300018006|Ga0187804_10210923 | Not Available | 831 | Open in IMG/M |
| 3300018044|Ga0187890_10330469 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300018046|Ga0187851_10415854 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300018058|Ga0187766_10877674 | Not Available | 631 | Open in IMG/M |
| 3300018062|Ga0187784_11081345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
| 3300019162|Ga0184597_103580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300019188|Ga0184599_108875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300019888|Ga0193751_1262591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300021171|Ga0210405_10953617 | Not Available | 649 | Open in IMG/M |
| 3300021180|Ga0210396_11351167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300021401|Ga0210393_10291465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1325 | Open in IMG/M |
| 3300021402|Ga0210385_10184936 | Not Available | 1508 | Open in IMG/M |
| 3300021402|Ga0210385_10300807 | Not Available | 1189 | Open in IMG/M |
| 3300021855|Ga0213854_1344954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 581 | Open in IMG/M |
| 3300022533|Ga0242662_10231882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300022715|Ga0242678_1032204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300023551|Ga0247546_102628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
| 3300024249|Ga0247676_1007118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1683 | Open in IMG/M |
| 3300025735|Ga0207713_1160958 | Not Available | 716 | Open in IMG/M |
| 3300025915|Ga0207693_11156579 | Not Available | 585 | Open in IMG/M |
| 3300025923|Ga0207681_10412619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300025928|Ga0207700_10817117 | Not Available | 834 | Open in IMG/M |
| 3300025939|Ga0207665_10084322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2193 | Open in IMG/M |
| 3300027512|Ga0209179_1107807 | Not Available | 621 | Open in IMG/M |
| 3300027853|Ga0209274_10496216 | Not Available | 632 | Open in IMG/M |
| 3300027869|Ga0209579_10594224 | Not Available | 600 | Open in IMG/M |
| 3300027903|Ga0209488_10553703 | Not Available | 838 | Open in IMG/M |
| 3300028780|Ga0302225_10357568 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300028789|Ga0302232_10012915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 4944 | Open in IMG/M |
| 3300028789|Ga0302232_10672889 | Not Available | 508 | Open in IMG/M |
| 3300028876|Ga0307286_10220383 | Not Available | 691 | Open in IMG/M |
| 3300028877|Ga0302235_10359806 | Not Available | 625 | Open in IMG/M |
| 3300029944|Ga0311352_10765106 | Not Available | 757 | Open in IMG/M |
| 3300029951|Ga0311371_11311750 | Not Available | 824 | Open in IMG/M |
| 3300030007|Ga0311338_11055712 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300030503|Ga0311370_12131609 | Not Available | 554 | Open in IMG/M |
| 3300030549|Ga0210257_10315125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 965 | Open in IMG/M |
| 3300030629|Ga0210268_1046977 | Not Available | 984 | Open in IMG/M |
| 3300030632|Ga0210250_10775233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300030659|Ga0316363_10399628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300030739|Ga0302311_10376153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1006 | Open in IMG/M |
| 3300030741|Ga0265459_10910741 | Not Available | 903 | Open in IMG/M |
| 3300030902|Ga0308202_1125270 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031057|Ga0170834_108804596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300031236|Ga0302324_101354249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
| 3300031543|Ga0318516_10422363 | Not Available | 767 | Open in IMG/M |
| 3300031549|Ga0318571_10238884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
| 3300031718|Ga0307474_11208204 | Not Available | 598 | Open in IMG/M |
| 3300031723|Ga0318493_10617244 | Not Available | 605 | Open in IMG/M |
| 3300031754|Ga0307475_10294713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1302 | Open in IMG/M |
| 3300031764|Ga0318535_10018510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2644 | Open in IMG/M |
| 3300031765|Ga0318554_10681773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300031780|Ga0318508_1168718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300031795|Ga0318557_10305089 | Not Available | 731 | Open in IMG/M |
| 3300032055|Ga0318575_10312443 | Not Available | 795 | Open in IMG/M |
| 3300032066|Ga0318514_10314513 | Not Available | 828 | Open in IMG/M |
| 3300032074|Ga0308173_12351615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300032091|Ga0318577_10277614 | Not Available | 802 | Open in IMG/M |
| 3300032094|Ga0318540_10304988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
| 3300032121|Ga0316040_104593 | Not Available | 848 | Open in IMG/M |
| 3300032174|Ga0307470_11193645 | Not Available | 617 | Open in IMG/M |
| 3300032180|Ga0307471_101773216 | Not Available | 769 | Open in IMG/M |
| 3300032515|Ga0348332_11575527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
| 3300033158|Ga0335077_10441708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1388 | Open in IMG/M |
| 3300033158|Ga0335077_10531663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1238 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004598 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004606 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004617 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300011018 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 5 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019162 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023551 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030632 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032121 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_05367330 | 2170459024 | Grass Soil | PDEERLTAKRPATATKKLGSMTRRSSQVRDAATAESR |
| JGI26339J46600_100195121 | 3300003218 | Bog Forest Soil | KLGWAYDVRWPDEERLSAKRPATATRKLGSMTRRADPVRGAVSAESR* |
| Ga0068972_10199231 | 3300004478 | Peatlands Soil | LEKLGWAYDVRWPDEERLSAKRPATATRKLGSMTRRADRVRDAVSAESR* |
| Ga0068975_12352191 | 3300004598 | Peatlands Soil | VRWPDEERLSAKRPATATRKLGSMTRRADRVRDAVSAESR* |
| Ga0068962_13332641 | 3300004606 | Peatlands Soil | GWAYDVRWPDEERLSAKRPATATRKLGSMTRRADRVRDAVSAESR* |
| Ga0068955_14000572 | 3300004617 | Peatlands Soil | DVRWPDEERLSAKRPATATRKLGSMTRRADRVRDAVSAESR* |
| Ga0062388_1012082692 | 3300004635 | Bog Forest Soil | LEKLGWAYDVRWPDEDRLAAKRPATATKKLGSMTIRRAGQGRGAVAAEPQ* |
| Ga0058862_127757361 | 3300004803 | Host-Associated | EKLGWAYDVRWPDENRLAAKRPATAKRKFGSMTRRAGRVRGVVSAEPR* |
| Ga0066818_10175742 | 3300005104 | Soil | RWPDEERLTAKRPATATKKLGSMTRRSSQVRDAVTAESR* |
| Ga0070714_1015580011 | 3300005435 | Agricultural Soil | LGWAYDVRWPDENRLAAKRPATAKRKFGSMTRRAGRVRGAVSAESR* |
| Ga0070710_106818072 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | KLGWAYDVRWPDEERLTAKRPAAATRKLGNWTRLAARGRGAVSAESR* |
| Ga0070664_1012748421 | 3300005564 | Corn Rhizosphere | EKLGWAYDVRWPDEDRLAAKRPATATRKLGNWTRLAARGRGAVSAESR* |
| Ga0068859_1031607351 | 3300005617 | Switchgrass Rhizosphere | RWPDENRLAAKRPATAKKKFGSMTRRAGRVRGVVSAESR* |
| Ga0068864_1026061471 | 3300005618 | Switchgrass Rhizosphere | DENRLAAKRPATAKKKFGSMTRRAGRVRGAVSAESR* |
| Ga0068863_1005981191 | 3300005841 | Switchgrass Rhizosphere | GWAYDVRWPDENRLAAKRPATAKKKFGSMTRRAGRVRGVVSAESR* |
| Ga0066656_103625511 | 3300006034 | Soil | DVRWPDEDRLTAKRPATATRKLGSMTRRTGRVRGAVSAESR* |
| Ga0075017_1012604471 | 3300006059 | Watersheds | LGWAYDVRWPDEERLSAKRPATATRKLGSMTRRADRVRGAVSAEPQ* |
| Ga0075017_1014277932 | 3300006059 | Watersheds | VRWPDEERLEAKRPATATRKLGSMTRRAGRVRDAVAAESQ* |
| Ga0070716_1016573932 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DEERLTAKRPATATRKLGSMTRRAGRVRGAVSAESR* |
| Ga0070712_1013467021 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RWPDEERLTAKRPATATRKLGSMTRRAGRVRGAVSAESR* |
| Ga0070765_1002825314 | 3300006176 | Soil | AYDVRWPEETRLSAKRPATATRKLGSMTRRADRVRGAVPAESR* |
| Ga0066659_111671201 | 3300006797 | Soil | YDVRWPDEDRLAAKRPATARRKFGSMTRRAGQVRGTVSAKSR* |
| Ga0099795_104565551 | 3300007788 | Vadose Zone Soil | KLGWAYDVRWPDEERLSAKRPATATRKLGSMTRRVSQVRNAVSAESR* |
| Ga0099829_103201743 | 3300009038 | Vadose Zone Soil | LGWAYDVRWPDEDRLAAKRPATATRKFGSMTRRADQVRGTVSAGSR* |
| Ga0066709_1008315244 | 3300009137 | Grasslands Soil | ALEKLGWAYDVRWPDENRLAAKPPATAKRKFGSMTRRAGRVRGVVSAESR* |
| Ga0116214_11800232 | 3300009520 | Peatlands Soil | EERLTAKRPANATRKLGSMTRRAGRARGAVSALPQ* |
| Ga0116215_14393412 | 3300009672 | Peatlands Soil | YDVRWPDEERLSAKRPATATRKLGSMTRRADRVRDAVSAESR* |
| Ga0116224_104370611 | 3300009683 | Peatlands Soil | VRWPDEDRLSAKRPATATRKLGSMTRRATRVGGAASAEPR* |
| Ga0116216_101488614 | 3300009698 | Peatlands Soil | ALEKLGWAYDVRWPDEERLSAKRPATATRKLGSMTRRADQARGAVSAESR* |
| Ga0116219_105415862 | 3300009824 | Peatlands Soil | AYDVRWPDEERLSAKRPATATRKLGSMTRRADPVRGAVSAESR* |
| Ga0099796_100963081 | 3300010159 | Vadose Zone Soil | DENRLAAKRPATAKKKFGSMTRRAGRVRGVVSAESR* |
| Ga0138527_1180761 | 3300011018 | Peatlands Soil | KLGWAYDVRWPDEERLSAKRPATATRKLGSMTRRADRVRDAVSAESR* |
| Ga0150983_158080532 | 3300011120 | Forest Soil | EDRLAAKRPATATRKLGSMTMQRIGKVRGVVPAEPQ* |
| Ga0150983_164772091 | 3300011120 | Forest Soil | DEDRLSAKRPATATRKLGSMTRRAARVGSAVSAEPQ* |
| Ga0150985_1157137211 | 3300012212 | Avena Fatua Rhizosphere | EKLGWAYDVRWPDENRLAAKRPAPAKRKFGSMTRRAGRVRGVMSAESR* |
| Ga0137385_112914531 | 3300012359 | Vadose Zone Soil | DVRWPDEERLTAKRPATATRKLGSMTRRAARVRGAVSAEPR* |
| Ga0137397_108061152 | 3300012685 | Vadose Zone Soil | EERLTAKRPATATKKLGSMTRRSSQVRDAATAESR* |
| Ga0137413_118106021 | 3300012924 | Vadose Zone Soil | EKLGWAYDVRWPDEERLTAKRPATAKRKLGSWTRLAARGRGAATAESR* |
| Ga0164307_105497721 | 3300012987 | Soil | LGWAYGVRWPDEERLTAKRPATAKRKFGSMTRRADRERGAVPAESR* |
| Ga0157369_119259901 | 3300013105 | Corn Rhizosphere | DVRWPDENRLAAKRPATAKKKFGSMTRRAGRVRGAVSVESR* |
| Ga0157369_125259441 | 3300013105 | Corn Rhizosphere | KLGWAYDVRWPDENRLAAKRPATAKKKFGSMTRRAGRVRGVVSAESR* |
| Ga0182035_104569113 | 3300016341 | Soil | WAYDVRWPDEDRLTAKRPATATRKLGSMTRRARVHGTVPAKPQ |
| Ga0187809_100512071 | 3300017937 | Freshwater Sediment | WAYDVRWPDEERLTAKRPATATRKLGSMTRRALTPARQNGRVPGAASAEPQ |
| Ga0187780_108772431 | 3300017973 | Tropical Peatland | LEKLGWAYDVRWPDESRLEAKRPATATRKLGSMTIRKTRRADRVRSATSAESP |
| Ga0187815_104102412 | 3300018001 | Freshwater Sediment | AYDVRWPDEDRLTAKRPATATRKLGSMTRRALTPARQNGRVPGAASAEPQ |
| Ga0187804_102109231 | 3300018006 | Freshwater Sediment | WAYDVRWPDEERLSAKRPATATRKLGSMTRRADPVRDAVSAESR |
| Ga0187890_103304692 | 3300018044 | Peatland | DEERLSAKRPANATRKLGSMTRRADQVVRSAAVPEPQ |
| Ga0187851_104158541 | 3300018046 | Peatland | PDEDRLAAKRPATATRKLGSMTIRRAGQVRGAVAAEPQ |
| Ga0187766_108776742 | 3300018058 | Tropical Peatland | ALEKLGWEYDVRWPDEDRLTAKRPATATRKLGSMTRRTGQARSAVSADSP |
| Ga0187784_110813452 | 3300018062 | Tropical Peatland | DESRLEAKRPATATRKLGSMTIRKTRRADRARSAMSAESP |
| Ga0184597_1035802 | 3300019162 | Soil | WAYDVRWPDEERLSAKRPATATRKLGSMARRADRVPGAVSAESR |
| Ga0184599_1088752 | 3300019188 | Soil | EERLSAKRPATATKKLGSMTRRADRVHGAVSAESR |
| Ga0193751_12625911 | 3300019888 | Soil | LGWAYDVRWPDEERLAAKRPATATRKLGSMTRRAGRVRSAVSAEPR |
| Ga0210405_109536171 | 3300021171 | Soil | LEKLGWAYDVRWPDEERLTAKRPATATRKLGSMTRRAGRVRGAVSAESR |
| Ga0210396_113511671 | 3300021180 | Soil | YDVRWPDEERLTAKRPATATRKLGSMTRRAGRVRGAVSAESR |
| Ga0210393_102914651 | 3300021401 | Soil | WPDEDRLSAKRPATATRKLGSMTRRAARVGSAVSAEPQ |
| Ga0210385_101849361 | 3300021402 | Soil | VRWPDEERLSAKRPAGAKRKLGYMTMRALSRDGSATRSGRARGAVSAEPQ |
| Ga0210385_103008071 | 3300021402 | Soil | AYDVRWPDEDRLAAKRPATATKKLGSMTIRRAGQVRGAVAAEPQ |
| Ga0213854_13449542 | 3300021855 | Watersheds | EKLGWAYDVRWPDEERLSAKRPATATRKLGSMARRADRVPGAVSAESR |
| Ga0242662_102318822 | 3300022533 | Soil | WPDEDRLAAKRPGTATRKFGSMTRRAGRVRGAVSAESR |
| Ga0242678_10322042 | 3300022715 | Soil | LGWAYDVRWPDEDRLSAKRPATATRKLGSMTRRAARVGSAVSAEPQ |
| Ga0247546_1026281 | 3300023551 | Soil | EERLEAKRPATATRKLGSMTRRADRVRDAVSAESR |
| Ga0247676_10071184 | 3300024249 | Soil | LEKLGWAYDVRWPDENRLAAKRPATAKKKFGSMTRRAGRVRGVVSAESR |
| Ga0207713_11609581 | 3300025735 | Switchgrass Rhizosphere | GWAYDVRWPDENRLAAKRPATAKKKFGSMTRRAGRVRGVVSAESR |
| Ga0207693_111565792 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PDEERLSAKRPATATRKLGSMTRRAGRVRGAVSAESR |
| Ga0207681_104126191 | 3300025923 | Switchgrass Rhizosphere | KLGWAYDVRWPDENRLAAKRPATAKKKFGSMTRRAGRVRGVVSAESR |
| Ga0207700_108171172 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RWPDEERLTAKRPVTAKRKFGSMTRRAGRIRATVSAESR |
| Ga0207665_100843225 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AYDVRWPDEERLTAKRPATATRKLGSMTRRAGRVRGAVSAESR |
| Ga0209179_11078071 | 3300027512 | Vadose Zone Soil | KLGWAYDVRWPDEERLSAKRPATATRKLGSMTRRVSQVRNAVSAESR |
| Ga0209274_104962162 | 3300027853 | Soil | AYDVRWPDEERLSAKRPATATRKLGSMTRRRLAGVVPSGQIRGAVPAEPQ |
| Ga0209579_105942242 | 3300027869 | Surface Soil | LGWAYDVRWPDEERLSAKRPATATRKLGSMTKRALSRDGVAGSRPGRVRGAVSAEPQ |
| Ga0209488_105537032 | 3300027903 | Vadose Zone Soil | WAYDVRWPDEERLSAKRPATATRKLGSMTRRVSQVRNAVSAESR |
| Ga0302225_103575682 | 3300028780 | Palsa | LEKLGWAYDVRWPDEDRLAAKRPATATRKLGSMTTRRAGQVRGAVAAEPQ |
| Ga0302232_100129151 | 3300028789 | Palsa | LEKLGWAYDVRWPDEDRLAAKRPATATRKLGSMTIRRAGQVRGAVAAEPQ |
| Ga0302232_106728891 | 3300028789 | Palsa | LEKLGWAYDVRWPDEERLAAKRPATAKKKLGSMTIRRAGQVRGVVPAEPQ |
| Ga0307286_102203832 | 3300028876 | Soil | YDVRWPDEERLTAKRPATATKKLGSMTRRSSEVRGAATAESR |
| Ga0302235_103598061 | 3300028877 | Palsa | EKLGWAYDVRWPDEDRLSTKRPATATRKLGSMTRRTSRIRGAAAAKTP |
| Ga0311352_107651062 | 3300029944 | Palsa | AYDVRWPDEDRLAAKRPATATRKLGSMTIRRAGQVRGAVAAEPQ |
| Ga0311371_113117501 | 3300029951 | Palsa | WPDEERLAAKRPATAKKKLGSMTIRRAGQVRGVVPAEPQ |
| Ga0311338_110557122 | 3300030007 | Palsa | AYDVRWPDEDRLAAKRPATATRKLGSMTIRRTGQVRGAVAAEPQ |
| Ga0311370_121316091 | 3300030503 | Palsa | DVRWPDEDRLSAKRPATATRKLGSMTRRTSRIRGAVPAKTQ |
| Ga0210257_103151253 | 3300030549 | Soil | YDVRWPDEDRLAAKRPATATRKLGSMTRRRLAPGGVISPEQYSGAVSAEPQ |
| Ga0210268_10469772 | 3300030629 | Soil | ALEKLGWAYDVRWPDEDRLSAKRPATATRKLGSMTRRAARVGSAVSAEPQ |
| Ga0210250_107752332 | 3300030632 | Soil | WALEKLGWAYDVRWPDEDRLAAKRPATATRKLGSMTRRATRGRGAVSAEPQ |
| Ga0316363_103996281 | 3300030659 | Peatlands Soil | WPDEERLSAKRPATATRKLGSMTRRADPVRGAVSAESR |
| Ga0302311_103761533 | 3300030739 | Palsa | KLGWAYDVRWPDEDRLAAKRPATATKKLGSMTIRRAGQVRGAVPAEPQ |
| Ga0265459_109107411 | 3300030741 | Soil | YDVRWPDEDRLSAKRPATATRKLGSMTRRAARVGSAVSAEPQ |
| Ga0308202_11252702 | 3300030902 | Soil | KLGWAYDVRWPDEDRLAAKRPATAKRKFGSMTRRAGRIRATVSAESR |
| Ga0170834_1088045961 | 3300031057 | Forest Soil | EKLGWAYDVRWPDEDRLAAKRPATAKRKLGSMTRRAGQVRGAVSAESR |
| Ga0302324_1013542491 | 3300031236 | Palsa | VRWPDEARLSAKRPATATRKLGSMTQRTGRARGVVSAEPQ |
| Ga0318516_104223632 | 3300031543 | Soil | EKLGWAYDVRWPDEERLTAKRPATATRKLGSMTRRAERVRGAASA |
| Ga0318571_102388841 | 3300031549 | Soil | GWAYDVRWPDEERLTAKRPATATRKLGSMTRRAERVRGAASA |
| Ga0307474_112082041 | 3300031718 | Hardwood Forest Soil | GWAYDVRWPDEERLTAKRPATATRKLGSMTRRAGRVRGAVSAESR |
| Ga0318493_106172441 | 3300031723 | Soil | AYDVRWPDEERLTAKRPATATRKLGSMTRRTPQVRGAVPAEPR |
| Ga0307475_102947131 | 3300031754 | Hardwood Forest Soil | DEDRLSAKRPATATRKLGSMTRRAARVGGAVSAEPR |
| Ga0318535_100185105 | 3300031764 | Soil | GWAYDVRWPDEDRLTAKRPADATRKLGSMTRRALARPGQNRPVPGAASAEPQ |
| Ga0318554_106817732 | 3300031765 | Soil | EKLGWAYDVRWPDEERLTAKRPATATRKLGSMTRRAGRVRGAASA |
| Ga0318508_11687181 | 3300031780 | Soil | ALEKLGWAYDVRWPDEERLSAKRPATATRKLGSMTRRATHALGAASA |
| Ga0318557_103050891 | 3300031795 | Soil | DEGRLEAKRPSTATRKLGSMTMRKSDSATRRADRARGAVSAESP |
| Ga0318575_103124431 | 3300032055 | Soil | DEDRLTAKRPANATRKLGSMTRRALARPGQNHRVPGAASAEPQ |
| Ga0318514_103145131 | 3300032066 | Soil | DVRWPDEERLAAKRPATATRKLGSMTRRRLAGAPASGVLPGQNRRVRGAVPAEPR |
| Ga0308173_123516151 | 3300032074 | Soil | KLGWAYDVRWPDEERLTAKRPATATKKLGSMTRRATGVRGAVKAEPR |
| Ga0318577_102776142 | 3300032091 | Soil | AYDVRWPDEDRLTAKRPATATRKLGSMTRRARVHGTVPAKPQ |
| Ga0318540_103049881 | 3300032094 | Soil | LRPDEDRLTAKRPATATRKLGSMTRRTGQARGAASA |
| Ga0316040_1045931 | 3300032121 | Soil | WPDEDRLTAKRPATATRKLGSMTRRAPRVRGAVSAEPQ |
| Ga0307470_111936451 | 3300032174 | Hardwood Forest Soil | WPDENRLAAKRPATAKRKFGSMTRRAGRVRGVVSAESR |
| Ga0307471_1017732161 | 3300032180 | Hardwood Forest Soil | DENRLAAKRPATAKKKFGSMTRRAGRVRGVVSAESR |
| Ga0348332_115755272 | 3300032515 | Plant Litter | IWALEKLGWAYDVRWPEETRLSAKRPATATRKLGSMTRRADRVRGAMTAESR |
| Ga0335077_104417083 | 3300033158 | Soil | LEKLGWAYDVRWPDEERLTAKRPATATRKLGSMTRRAVAPARPNRPVPGAATAEPQ |
| Ga0335077_105316632 | 3300033158 | Soil | ALEKLGWAYDVRWPDEGRLAAKRPATATRKLGSMTVRNSGPATRGRQNGRVRGAVSAEPR |
| ⦗Top⦘ |