| Basic Information | |
|---|---|
| Family ID | F087612 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GGAAEIKIEVEEAALPDSSLLVQANFEGRTATRKFVLRKAE |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.73 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.636 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.70% β-sheet: 23.19% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02597 | ThiS | 56.36 |
| PF13411 | MerR_1 | 15.45 |
| PF00925 | GTP_cyclohydro2 | 3.64 |
| PF00926 | DHBP_synthase | 1.82 |
| PF13418 | Kelch_4 | 0.91 |
| PF05935 | Arylsulfotrans | 0.91 |
| PF04014 | MazE_antitoxin | 0.91 |
| PF02371 | Transposase_20 | 0.91 |
| PF13854 | Kelch_5 | 0.91 |
| PF07676 | PD40 | 0.91 |
| PF13189 | Cytidylate_kin2 | 0.91 |
| PF14329 | DUF4386 | 0.91 |
| PF00144 | Beta-lactamase | 0.91 |
| PF09411 | PagL | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 56.36 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 56.36 |
| COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 3.64 |
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 1.82 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.91 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.64 % |
| Unclassified | root | N/A | 6.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105480600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1726 | Open in IMG/M |
| 3300001471|JGI12712J15308_10197470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 528 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100160855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2123 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10050574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1578 | Open in IMG/M |
| 3300004080|Ga0062385_11223374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300004091|Ga0062387_101695162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300004092|Ga0062389_102705011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300005176|Ga0066679_10336342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 986 | Open in IMG/M |
| 3300005436|Ga0070713_100968704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 820 | Open in IMG/M |
| 3300005538|Ga0070731_10774104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300005541|Ga0070733_10136216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1587 | Open in IMG/M |
| 3300005591|Ga0070761_10121538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1516 | Open in IMG/M |
| 3300005610|Ga0070763_10037807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2242 | Open in IMG/M |
| 3300005610|Ga0070763_10788587 | Not Available | 561 | Open in IMG/M |
| 3300005712|Ga0070764_10424272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 789 | Open in IMG/M |
| 3300006028|Ga0070717_10348758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1323 | Open in IMG/M |
| 3300006046|Ga0066652_100211327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1675 | Open in IMG/M |
| 3300006046|Ga0066652_101478733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300006050|Ga0075028_100455963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300006052|Ga0075029_100788638 | Not Available | 646 | Open in IMG/M |
| 3300006059|Ga0075017_100041325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3071 | Open in IMG/M |
| 3300006059|Ga0075017_101074513 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300006059|Ga0075017_101282135 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006174|Ga0075014_100040402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1949 | Open in IMG/M |
| 3300006174|Ga0075014_100166718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300006174|Ga0075014_100919020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300006903|Ga0075426_11493518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300006954|Ga0079219_11097439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300009521|Ga0116222_1092119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300009522|Ga0116218_1342082 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300009524|Ga0116225_1065897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1714 | Open in IMG/M |
| 3300009624|Ga0116105_1081091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300009636|Ga0116112_1225529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300009638|Ga0116113_1014604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1695 | Open in IMG/M |
| 3300009665|Ga0116135_1364544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300009759|Ga0116101_1051279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 888 | Open in IMG/M |
| 3300009764|Ga0116134_1341103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300010043|Ga0126380_10484775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300010880|Ga0126350_10174830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300012202|Ga0137363_11593717 | Not Available | 545 | Open in IMG/M |
| 3300012683|Ga0137398_10893982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300012987|Ga0164307_10330372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300013104|Ga0157370_10976559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300014168|Ga0181534_10152920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1184 | Open in IMG/M |
| 3300014969|Ga0157376_10099475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2538 | Open in IMG/M |
| 3300014969|Ga0157376_10223409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1746 | Open in IMG/M |
| 3300017822|Ga0187802_10232337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300017943|Ga0187819_10829082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300018002|Ga0187868_1301031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300018017|Ga0187872_10071131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1800 | Open in IMG/M |
| 3300018044|Ga0187890_10168291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1250 | Open in IMG/M |
| 3300018057|Ga0187858_10763233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300020579|Ga0210407_10646866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 822 | Open in IMG/M |
| 3300020581|Ga0210399_10299500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1342 | Open in IMG/M |
| 3300020582|Ga0210395_10113750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2006 | Open in IMG/M |
| 3300021088|Ga0210404_10870580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300021181|Ga0210388_11114545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300021402|Ga0210385_10102979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1994 | Open in IMG/M |
| 3300021404|Ga0210389_10169952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1695 | Open in IMG/M |
| 3300021405|Ga0210387_11758310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300021407|Ga0210383_10241739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1548 | Open in IMG/M |
| 3300021478|Ga0210402_11205761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300021479|Ga0210410_10694520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300021560|Ga0126371_11254704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 876 | Open in IMG/M |
| 3300022557|Ga0212123_10828568 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300022732|Ga0224569_113170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300023030|Ga0224561_1020161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300025459|Ga0208689_1098399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300025906|Ga0207699_11241531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300026514|Ga0257168_1014943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1542 | Open in IMG/M |
| 3300026921|Ga0207860_1020477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 803 | Open in IMG/M |
| 3300027376|Ga0209004_1079073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300027567|Ga0209115_1053052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 924 | Open in IMG/M |
| 3300027568|Ga0208042_1095124 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300027590|Ga0209116_1072970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300027609|Ga0209221_1019027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1812 | Open in IMG/M |
| 3300027676|Ga0209333_1174960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300027824|Ga0209040_10251723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 885 | Open in IMG/M |
| 3300027869|Ga0209579_10183220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1120 | Open in IMG/M |
| 3300027879|Ga0209169_10236093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 958 | Open in IMG/M |
| 3300027879|Ga0209169_10471916 | Not Available | 659 | Open in IMG/M |
| 3300027884|Ga0209275_10363680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 812 | Open in IMG/M |
| 3300027889|Ga0209380_10108310 | Not Available | 1609 | Open in IMG/M |
| 3300027898|Ga0209067_10074931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1739 | Open in IMG/M |
| 3300028016|Ga0265354_1006553 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300028036|Ga0265355_1026643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300028759|Ga0302224_10253876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 702 | Open in IMG/M |
| 3300028800|Ga0265338_11058963 | Not Available | 547 | Open in IMG/M |
| 3300029883|Ga0311327_10663834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 620 | Open in IMG/M |
| 3300029943|Ga0311340_10192496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2066 | Open in IMG/M |
| 3300030054|Ga0302182_10143959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300030057|Ga0302176_10206578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300030057|Ga0302176_10483615 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300030524|Ga0311357_10089637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3089 | Open in IMG/M |
| 3300030524|Ga0311357_10393286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1310 | Open in IMG/M |
| 3300030815|Ga0265746_1002333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1849 | Open in IMG/M |
| 3300031231|Ga0170824_103076363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300031474|Ga0170818_105144205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300031474|Ga0170818_106059575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300031708|Ga0310686_103919422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300031720|Ga0307469_12066653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300031754|Ga0307475_10882686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300031823|Ga0307478_10215510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1549 | Open in IMG/M |
| 3300031823|Ga0307478_10864039 | Not Available | 757 | Open in IMG/M |
| 3300031837|Ga0302315_10364233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300031871|Ga0316036_106509 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300033158|Ga0335077_10967780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300033405|Ga0326727_11240684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300034130|Ga0370494_187410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300034195|Ga0370501_0002637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4426 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 8.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.64% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.91% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.91% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031871 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1054806001 | 3300000364 | Soil | EVKIDVEEAALPEASLLVQANFEGRTATRKFVLRKTE* |
| JGI12712J15308_101974701 | 3300001471 | Forest Soil | EIKIAVEAAALQDSSLLVQANFEGRTTTRKFALRKAE* |
| JGIcombinedJ26739_1001608551 | 3300002245 | Forest Soil | AVTDAAGNAAISVEVDESVLPDSSVMVQANHEGRTVTRKFALRKAE* |
| JGIcombinedJ51221_100505744 | 3300003505 | Forest Soil | GGAAEIKIEVEEAALPDSSLLVQANFEGRTATRKFVLRKAE* |
| Ga0062385_112233742 | 3300004080 | Bog Forest Soil | DSAGGASISFDVEESDLPDSSVMVQANHEGRTVTRKFALRKAE* |
| Ga0062387_1016951622 | 3300004091 | Bog Forest Soil | GGAAEIKIEVEESALPDASLLVQANFEGRTATRKFVLRKAD* |
| Ga0062389_1027050111 | 3300004092 | Bog Forest Soil | AGAAGISIEVDESALPDSSVLVQATHEGRTATRKFALRKTE* |
| Ga0066679_103363423 | 3300005176 | Soil | TDAGGAAEIKVEVDEADLPDSSVLVQANYEGRTATRKFLLRRGE* |
| Ga0070713_1009687041 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DSGGAAEIQIEVAEAELPDLSLLVQANFEGRTATRKFVLRKAE* |
| Ga0070731_107741041 | 3300005538 | Surface Soil | AVADAGGAAEIKIEVEEASLPDSSLLVQANFEGRTTTRKFVLRKAE* |
| Ga0070733_101362161 | 3300005541 | Surface Soil | EIKIEAAEAELPDSSLLVQANFSGQTATRKFALRKAE* |
| Ga0070761_101215381 | 3300005591 | Soil | AISIEVDESALPDSSVMVQANHEGRTVTRKFALRKAE* |
| Ga0070763_100378075 | 3300005610 | Soil | KIEVEEAELPDASLLVQANFEGRTATRKFALKKAE* |
| Ga0070763_107885871 | 3300005610 | Soil | TQAVTDSAGAAQISVEVEESALVEASVMVQANHEGRTVTRKFALRKAE* |
| Ga0070764_104242723 | 3300005712 | Soil | AEIKIEAAEAELPDSSLLVQANFSGQTATRKFALRKAE* |
| Ga0070717_103487584 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DIELDETALPDSSLLVQANYEGRTATRKFALRKAE* |
| Ga0066652_1002113272 | 3300006046 | Soil | KIEADESLLPDSSVLVQAHYEGRTATRKFQLRKLEQ* |
| Ga0066652_1014787332 | 3300006046 | Soil | KIEAEETDLPDSSLLVQANFEGRTATRKFALRKAE* |
| Ga0075028_1004559631 | 3300006050 | Watersheds | ADAGGSAEVKIEVEETALPDSSLLVQASFEGRTATRKFVLRKAE* |
| Ga0075029_1007886381 | 3300006052 | Watersheds | AVADSGGGAEIKIEVAEADLPDSTLLVQINQEGRTATRKFVLRKAE* |
| Ga0075017_1000413251 | 3300006059 | Watersheds | KIEVEESALPDSSLLVQANFEGRTATRKFVLRKAE* |
| Ga0075017_1010745131 | 3300006059 | Watersheds | YTQTSTDPGGAAEINFEIDDSSLPDASILVQASFEGRTATRKFLLRQVVS* |
| Ga0075017_1012821353 | 3300006059 | Watersheds | NALMSVQVEEASLRDSSVLVQANVSGRTATRKFEIRSAP* |
| Ga0075014_1000404026 | 3300006174 | Watersheds | TQAVADSGGSAEIKIEVEEAALPDSSLLVQANFEGRTATRKFVLRKAE* |
| Ga0075014_1001667181 | 3300006174 | Watersheds | GGSAEINIEVEESALPDSSLLVQANFEGRTTTRKFMLRKGE* |
| Ga0075014_1009190201 | 3300006174 | Watersheds | ADSGGAAEIKIEVEESALPDSSLLVQANFEGRTATRKFVLRKAE* |
| Ga0075426_114935182 | 3300006903 | Populus Rhizosphere | IEVEEAALPDSSLLVQANFEGRTATRKFMLRKTQ* |
| Ga0079219_110974391 | 3300006954 | Agricultural Soil | DSGGSAEIKIEVEESAMPDSSLLVQANYEGRTATRKFALRKAE* |
| Ga0116222_10921191 | 3300009521 | Peatlands Soil | AEIKIEVQESTLPDSSLMVQASYEGRTATRKFLLRKGE* |
| Ga0116218_13420821 | 3300009522 | Peatlands Soil | SGGAAEIKIEVEEASLPDSSLLVQANYGGRTATRKFTLRRAE* |
| Ga0116225_10658971 | 3300009524 | Peatlands Soil | IKIEVEETALPDASLLVQANFEGRTATRKFLLRKAD* |
| Ga0116105_10810913 | 3300009624 | Peatland | IEVEESALPDSSVMVQANHEGRTVTRKFALRKAE* |
| Ga0116112_12255292 | 3300009636 | Peatland | AVADSGGSAEIKIEVEEAALPDASLLVQANFEGRTATRKFVLRRAE* |
| Ga0116113_10146045 | 3300009638 | Peatland | DSGGAAEVKIEVEEAELPDASLLVQANFEGRTATRKFALRKAE* |
| Ga0116135_13645442 | 3300009665 | Peatland | AGSAEISVEVEESALPDSSIMVQANHQGRTVTRKFALRKAD* |
| Ga0116101_10512791 | 3300009759 | Peatland | EVKIEVEEAELPDASLLVQANFEGRTATRKFALRKAE* |
| Ga0116134_13411032 | 3300009764 | Peatland | AGSAEISVEVDESALPDSSVMVQANHEGRTVTRKFVLRKSE* |
| Ga0126380_104847751 | 3300010043 | Tropical Forest Soil | AEIKIEVEEAQLPDSSLLVQANFEGRTATRKFVLRKTE* |
| Ga0126350_101748301 | 3300010880 | Boreal Forest Soil | ISIELEESALPDSSVLVQATHEGRTVTRKFALRKT* |
| Ga0137363_115937171 | 3300012202 | Vadose Zone Soil | QAVTDSAGAAAISVEVEESALPDSSVMVQANHEGRTVTRKFALRKAE* |
| Ga0137398_108939821 | 3300012683 | Vadose Zone Soil | ISVEVDESALPDSSVMVQANHEGRTVTRKFALRKTE* |
| Ga0164307_103303721 | 3300012987 | Soil | ESGLPDASLLVQANFEGRTTTRKFVLRKADQPQV* |
| Ga0157370_109765592 | 3300013104 | Corn Rhizosphere | SGGAAEIKIEVEESGLPDASLLVQANFEGRTTTRKFVLRKADQPQV* |
| Ga0181534_101529201 | 3300014168 | Bog | AAEIKIEAEEADLPDSTLLVQVNCEGRTATRKFVLRKAE* |
| Ga0157376_100994755 | 3300014969 | Miscanthus Rhizosphere | GAAEIKIEAEENDLPDSSLLVQANFEGRTATRKFALRKAD* |
| Ga0157376_102234095 | 3300014969 | Miscanthus Rhizosphere | IEADESALPDSSVLVQASYSGRTATRKFNLRKVEA* |
| Ga0187802_102323371 | 3300017822 | Freshwater Sediment | TQAVTDSSGSASISVEVDESALPDSSVMVQANHEGRTVTRKFVLRKAD |
| Ga0187819_108290822 | 3300017943 | Freshwater Sediment | ADSGGAAEIKIEVAEADLPDSTLLVQINQEGRTATRKFVLRKAE |
| Ga0187868_13010313 | 3300018002 | Peatland | ADSGGSAEIKIEVEEAALPDASLLVQANFEGRTATRKFVLRRAE |
| Ga0187872_100711311 | 3300018017 | Peatland | AEIKIEVEEAALPDSSLLVQANYQGRTATRKFALRKAE |
| Ga0187890_101682911 | 3300018044 | Peatland | SAEISVEVDESALPDSSVMVQANHEGRTVTRKFVLRKSE |
| Ga0187858_107632332 | 3300018057 | Peatland | VADSGGSAEIKIEVEEAALPDASLLVQANFEGRTATRKFVLRRAE |
| Ga0210407_106468663 | 3300020579 | Soil | DSAGGAQISIEVEESALTEASVMVQANHQGRTVTRKFALRKAE |
| Ga0210399_102995004 | 3300020581 | Soil | TNSEGAAEIKIAVEAAALQDSSLLVQANFEGRTTTRKFALRKAE |
| Ga0210395_101137501 | 3300020582 | Soil | DSGGAAEIHIEVEESALPDASLMVQANHEGRTATRKFELRKAD |
| Ga0210404_108705801 | 3300021088 | Soil | DSAGSAQISIEVEESALTEASVMVQANHQGRTVTRKFALRKAE |
| Ga0210388_111145452 | 3300021181 | Soil | SFEVEESALPDSSIIIQANHQGRTVTRKFLLRKTE |
| Ga0210385_101029791 | 3300021402 | Soil | DSGGAAEIKIEVEESALPDSSLLVQANYDGRTATRKFILRKAD |
| Ga0210389_101699521 | 3300021404 | Soil | QFKSEVEEAQLPDSSLLVQANFEGRTATRKFELRQA |
| Ga0210387_117583102 | 3300021405 | Soil | VPDPGGAAEIKIEVEEAALPDASLMVQANHEGRTATRKFQLRKSG |
| Ga0210383_102417394 | 3300021407 | Soil | QALADSAGAAEIKIEAAEAELPDSSLLVQANFSGQTATRKFALRKAE |
| Ga0210402_112057612 | 3300021478 | Soil | DSGGAAEIKIEVEEAALPDASLLVQANFEGRTATRKFVLRKAD |
| Ga0210410_106945201 | 3300021479 | Soil | TDAGGGAEIKVEMDESALPDAAVLVQANYEGRTSTRKFVLRKAE |
| Ga0126371_112547043 | 3300021560 | Tropical Forest Soil | DSGGAAEIQIEAEEASLPDASLLVQANFEGRTATRKFVLRKAE |
| Ga0212123_108285682 | 3300022557 | Iron-Sulfur Acid Spring | AEIKLEVEEAALADSSLLVQANYQGRTATRKFALERAE |
| Ga0224569_1131703 | 3300022732 | Rhizosphere | AAEIKIEVEEAALPDASLMVQANHEGRTATRKFQLRKSE |
| Ga0224561_10201612 | 3300023030 | Soil | GSAQINVEVEESALEEASVMVQANHEGRTVTRKFALRKAE |
| Ga0208689_10983991 | 3300025459 | Peatland | AVADSGGSAEIKIEVEEAALPDASLLVQANFEGRTATRKFVLRRAE |
| Ga0207699_112415311 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | IKIEVEEAALPDSSLLVQANFEGRTATRKFILRKAE |
| Ga0257168_10149435 | 3300026514 | Soil | TMTDAGGGAEIKIEADESLLPDSSVLVQANYEGRTATRKFQLRKLEQ |
| Ga0207860_10204773 | 3300026921 | Tropical Forest Soil | AEVKIEVAEAELPDSSLIVQANFEGRTTTRKFALRKAE |
| Ga0209004_10790731 | 3300027376 | Forest Soil | QAVTDAAGTAQISVEVDESALPDSSVMVQANHEGRTVTRKFALRKAE |
| Ga0209115_10530523 | 3300027567 | Forest Soil | EISIEVDESALPDSSVIVQANHDGRTVTRKFVLRKSE |
| Ga0208042_10951241 | 3300027568 | Peatlands Soil | FYTQAVTDSAGGASISFEVEEYDLPDSSVMVQANHEGRTVTRKFALRKAE |
| Ga0209116_10729703 | 3300027590 | Forest Soil | TDSGGNAQISIEVEETALADASVMVQANHEGRTVTRKFALRKAE |
| Ga0209221_10190271 | 3300027609 | Forest Soil | SAEICVEVDESALPDASVMVQANHEGRTVTRKFALRKAD |
| Ga0209333_11749601 | 3300027676 | Forest Soil | AEIKIEAEEADLPDSSLLVQANYCGHTATRKFALRKAE |
| Ga0209040_102517231 | 3300027824 | Bog Forest Soil | ADSGGSAEINIEVEESALPDSSLLVQANFEGRTATRKFMLRKGE |
| Ga0209579_101832201 | 3300027869 | Surface Soil | GAAEIKIEVEEAALPDSSLLVQANFEGRTATKKFVLRKAE |
| Ga0209169_102360931 | 3300027879 | Soil | NAQISIEVEETVLADASVMVQANHQGRTVTRKFALRKAE |
| Ga0209169_104719161 | 3300027879 | Soil | GSTEISVEVEESALPDSSIMVQANHEGRTVTRKFALRKSD |
| Ga0209275_103636803 | 3300027884 | Soil | SAGGAQISIEVEESALTEASVMVQANHQGRTVTRKFALRKAE |
| Ga0209380_101083102 | 3300027889 | Soil | AISIEVDESALPDSSVMVQANHEGRTVTRKFALRKAE |
| Ga0209067_100749316 | 3300027898 | Watersheds | QAVADSGGSAEIKIEVEEAALPDSSLLVQANFEGRTATRKFVLRKAE |
| Ga0265354_10065531 | 3300028016 | Rhizosphere | SVEVEESTLADSSVMVQANHEGRTVTRKFALRKAE |
| Ga0265355_10266431 | 3300028036 | Rhizosphere | NAAISIEVDESSLPDSSVMVQANHEGRTVTRKFALRKSE |
| Ga0302224_102538761 | 3300028759 | Palsa | LTDATGIAQISLELDESSLPDSSVLVQAIHEGRTVTRKFLLRQAD |
| Ga0265338_110589632 | 3300028800 | Rhizosphere | AEIKIEVEEAELPDSTLLVQINQEGRTATRKFVLRKAD |
| Ga0311327_106638343 | 3300029883 | Bog | AIKVEVEESSLSDASVMVQANHEGRTVTRKFALRKAE |
| Ga0311340_101924961 | 3300029943 | Palsa | KISIEVEESSLSDSSVLVQANYEGRTVTRKFALREAE |
| Ga0302182_101439591 | 3300030054 | Palsa | DAAGAAKISIEVEESALPDSSVLVQATHEGRTVTRKFALRKAE |
| Ga0302176_102065781 | 3300030057 | Palsa | TQAVSDAAGAAKISIEVEESALPDSSVLVQATHEGRTVTRKFALRKAE |
| Ga0302176_104836152 | 3300030057 | Palsa | IKLEVEESILPDSSLMVQASYEGRTATRKFLLRKSE |
| Ga0311357_100896376 | 3300030524 | Palsa | AVADSGGAAEVKIEVEEAQLPDASLLVQANFEGRTATRKFALRKAE |
| Ga0311357_103932864 | 3300030524 | Palsa | AGSAQIQIAVEESALPDSSVMVQANHDGRTATRKFLLRKAE |
| Ga0265746_10023331 | 3300030815 | Soil | AVTDSGGAAEIKIEVEESALPDASLMVQANHEGRTATRKFQLRKAE |
| Ga0170824_1030763631 | 3300031231 | Forest Soil | AEIKIEVEEANLPDSSLLVQANYGGRTATRKFALRKAE |
| Ga0170818_1051442053 | 3300031474 | Forest Soil | QAVADSGGAAEIQIEVAEEELPDLSLLVQANFEGRTATRKFVLRKAE |
| Ga0170818_1060595752 | 3300031474 | Forest Soil | QAVADNGGAAEIKIEVAEAELPDLSLLVQANFEGRTATRKFVLRKAE |
| Ga0310686_1039194222 | 3300031708 | Soil | AAEIKIEVEENHLSDSSLLVQANFEGRTATRKFELRKTE |
| Ga0307469_120666531 | 3300031720 | Hardwood Forest Soil | DAAGNAEISVEVEESALPDSSVMVQANHEGRTVTRKFALRKA |
| Ga0307475_108826863 | 3300031754 | Hardwood Forest Soil | AGAAEISIELEESALPDSSVLVQATHEGRTVTRKFALRKAE |
| Ga0307478_102155101 | 3300031823 | Hardwood Forest Soil | STGSASISVEVDESALPDSSVMVQANHEGRTVTRKFVLRKAD |
| Ga0307478_108640391 | 3300031823 | Hardwood Forest Soil | TISIEVEESTLPDSSVMVQANHEGRTVTRKFALRKAE |
| Ga0302315_103642332 | 3300031837 | Palsa | DSAGSAEISIEVEESALPDSSVLVQANHEGRTATRKFALRKAE |
| Ga0316036_1065092 | 3300031871 | Soil | GAAGISIEVDESALPDSSVLVQATHEGRTATRKFALRKAE |
| Ga0335077_109677802 | 3300033158 | Soil | TQTVADSGGSAEIKIEVEEAALPDASLLVQANFEGRTATRKFVLRKAE |
| Ga0326727_112406841 | 3300033405 | Peat Soil | SAEIKIEVEEAALPDASLLVQANFEGRTATRKFVLRRAE |
| Ga0370494_187410_402_533 | 3300034130 | Untreated Peat Soil | DSGGGAEIKIDVEEADLPDASLLVQANFEGRTATRKFVLRKAE |
| Ga0370501_0002637_4287_4424 | 3300034195 | Untreated Peat Soil | VADSGGGAEIKIDVEEADLPDASLLVQANFEGRTATRKFVLRKAE |
| ⦗Top⦘ |