| Basic Information | |
|---|---|
| Family ID | F087599 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKDAPGTRDYDWWLLAILAAICALGVIEIYSATHGS |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.36 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 61.11% β-sheet: 0.00% Coil/Unstructured: 38.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00905 | Transpeptidase | 76.36 |
| PF03717 | PBP_dimer | 13.64 |
| PF03328 | HpcH_HpaI | 0.91 |
| PF13421 | Band_7_1 | 0.91 |
| PF07452 | CHRD | 0.91 |
| PF01208 | URO-D | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 13.64 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.91 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.91 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.91 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|F0B48LX02GD05V | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300001154|JGI12636J13339_1002817 | All Organisms → cellular organisms → Bacteria | 2906 | Open in IMG/M |
| 3300001356|JGI12269J14319_10236235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 690 | Open in IMG/M |
| 3300002558|JGI25385J37094_10155028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 614 | Open in IMG/M |
| 3300004479|Ga0062595_101810458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300005187|Ga0066675_10174590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1493 | Open in IMG/M |
| 3300005436|Ga0070713_101191600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300005552|Ga0066701_10906616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300005561|Ga0066699_11063981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300005586|Ga0066691_10381697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300005591|Ga0070761_10100632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1665 | Open in IMG/M |
| 3300006174|Ga0075014_100554685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 651 | Open in IMG/M |
| 3300006796|Ga0066665_10919354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 676 | Open in IMG/M |
| 3300006797|Ga0066659_10653908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 856 | Open in IMG/M |
| 3300006797|Ga0066659_11886920 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006804|Ga0079221_11546382 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300007076|Ga0075435_100136828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2053 | Open in IMG/M |
| 3300007258|Ga0099793_10196963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300007258|Ga0099793_10334909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300007258|Ga0099793_10612224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300009038|Ga0099829_11624226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300009088|Ga0099830_10917215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300009089|Ga0099828_10072962 | All Organisms → cellular organisms → Bacteria | 2911 | Open in IMG/M |
| 3300009090|Ga0099827_10170579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1793 | Open in IMG/M |
| 3300009101|Ga0105247_10403227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300010048|Ga0126373_13055856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300010336|Ga0134071_10260298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300010341|Ga0074045_10079812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2292 | Open in IMG/M |
| 3300010362|Ga0126377_12969500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300010366|Ga0126379_12096541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300010376|Ga0126381_102902695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300011120|Ga0150983_14301672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300011271|Ga0137393_10564311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300011271|Ga0137393_10769480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300011271|Ga0137393_11680449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012189|Ga0137388_10768108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300012199|Ga0137383_10036029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3499 | Open in IMG/M |
| 3300012202|Ga0137363_10543854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300012202|Ga0137363_11782661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012203|Ga0137399_10533613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300012203|Ga0137399_11512354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012205|Ga0137362_10320882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
| 3300012351|Ga0137386_10194714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
| 3300012359|Ga0137385_10839420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300012685|Ga0137397_10993762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300012917|Ga0137395_10498502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300012917|Ga0137395_11279378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012918|Ga0137396_10492337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 909 | Open in IMG/M |
| 3300012918|Ga0137396_10752123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300012918|Ga0137396_11173061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012927|Ga0137416_10408584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300012971|Ga0126369_11480166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300012972|Ga0134077_10371623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300012975|Ga0134110_10073286 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300014154|Ga0134075_10122084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300014166|Ga0134079_10611608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300015245|Ga0137409_11446733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300015374|Ga0132255_103289911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300016319|Ga0182033_10881191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300016319|Ga0182033_11523771 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300016404|Ga0182037_10416734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300016422|Ga0182039_10210464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
| 3300017961|Ga0187778_10318273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300018433|Ga0066667_11084447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300020170|Ga0179594_10008541 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
| 3300020579|Ga0210407_11342646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300020581|Ga0210399_10169099 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300020581|Ga0210399_10306091 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300021046|Ga0215015_10141920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300021168|Ga0210406_10499430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300021168|Ga0210406_10834048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300021180|Ga0210396_10030121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5018 | Open in IMG/M |
| 3300021401|Ga0210393_10147641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1888 | Open in IMG/M |
| 3300021406|Ga0210386_11287218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300021433|Ga0210391_10294512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300021559|Ga0210409_11206559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300021559|Ga0210409_11623123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300022563|Ga0212128_10427866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300024179|Ga0247695_1039761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300024330|Ga0137417_1446189 | All Organisms → cellular organisms → Bacteria | 4958 | Open in IMG/M |
| 3300024331|Ga0247668_1128450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300025474|Ga0208479_1055977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300025910|Ga0207684_10076905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2837 | Open in IMG/M |
| 3300026300|Ga0209027_1290257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300026317|Ga0209154_1270492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300026354|Ga0257180_1064256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300026514|Ga0257168_1154774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300026528|Ga0209378_1250600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300026529|Ga0209806_1342185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300026540|Ga0209376_1206023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300026551|Ga0209648_10024980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5224 | Open in IMG/M |
| 3300027517|Ga0209113_1070686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 522 | Open in IMG/M |
| 3300027521|Ga0209524_1052509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300027671|Ga0209588_1265387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300027783|Ga0209448_10057296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300027846|Ga0209180_10616639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300027869|Ga0209579_10228496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300027882|Ga0209590_10174502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300028016|Ga0265354_1007065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300028381|Ga0268264_11886047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300029636|Ga0222749_10656205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300030013|Ga0302178_10439649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300031546|Ga0318538_10492128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300031718|Ga0307474_10532565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300031736|Ga0318501_10171851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300031753|Ga0307477_10527025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300031754|Ga0307475_10481310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
| 3300031820|Ga0307473_10225451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300031820|Ga0307473_11364218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300032060|Ga0318505_10028743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2247 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_04795350 | 2170459002 | Grass Soil | MKDALGTRDYDWWLLAIVAAICALGVIEIYSATHGS |
| JGI12636J13339_10028173 | 3300001154 | Forest Soil | MKDAPGTRDYDWWLLVILATICALGVIEIYSATHGSALA |
| JGI12269J14319_102362351 | 3300001356 | Peatlands Soil | MNDAPGTRDYDWWLLAILATICALGVIEIYSATHGSSLA |
| JGI25385J37094_101550282 | 3300002558 | Grasslands Soil | MKDAPGTRDYDWWLLAILATICALGVLEIYSATKGSSLAGM |
| Ga0062595_1018104582 | 3300004479 | Soil | MKDAQATRDYDWWLIAILMAICALGVLEIYSATHSSGGLAGMHYK |
| Ga0066675_101745901 | 3300005187 | Soil | MRDAPGTRDYDWWLLAILAAICALGVLEIYSATHASNLAGMHI |
| Ga0070713_1011916002 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDAPGTRDYDWWLIAILAAICALGVIEIYSATHASNLAGM |
| Ga0066701_109066161 | 3300005552 | Soil | MNDSIGIRDYDWWLVAIILAICAFGVVEIWSATHA |
| Ga0066699_110639811 | 3300005561 | Soil | MKDAPGTRDYDWWLLAILATICALGVIEIYSATHGSSLA |
| Ga0066691_103816971 | 3300005586 | Soil | MKDAPGTRDYDWLLLAILAAICALGVIEIYSATHGS |
| Ga0070761_101006321 | 3300005591 | Soil | MNDAPGTRDYDWWLLAILATICALGVIEIYSATHG |
| Ga0075014_1005546851 | 3300006174 | Watersheds | MLKDAAGSREYDYWLLAILAAICALGVVEVYSTTHGSALAG |
| Ga0066665_109193542 | 3300006796 | Soil | MKDAPGTRDYDWWLLAILAAICALGVIEIYSATHGS |
| Ga0066659_106539082 | 3300006797 | Soil | MKDAPGTRDYDWWLLAILATICALGVIEIYSATHG |
| Ga0066659_118869201 | 3300006797 | Soil | MKDAPGTRDYDWWLLAILATICALGVVEVYSTTHGSSLQG |
| Ga0079221_115463821 | 3300006804 | Agricultural Soil | MKDAPGTRDYDWWLLAILATICALGVIEIYSATHGSSLAG |
| Ga0075435_1001368282 | 3300007076 | Populus Rhizosphere | MKDAQATRDYDWWLIAILMAICALGVLEIYSATHASGGLAGM |
| Ga0099793_101969631 | 3300007258 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVVEIYSATHGSS |
| Ga0099793_103349091 | 3300007258 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVIEIYSATHGSALAG |
| Ga0099793_106122241 | 3300007258 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVLEIYSATHGSS |
| Ga0099829_116242261 | 3300009038 | Vadose Zone Soil | MKDAPGTRDYDWLLLAILAGICALGVLEIYSATHG |
| Ga0099830_109172151 | 3300009088 | Vadose Zone Soil | MKEAPGTRDYDWWLLAILATICLLGLIEIYSATKGSS |
| Ga0099828_100729621 | 3300009089 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVIEIYSATHG |
| Ga0099827_101705792 | 3300009090 | Vadose Zone Soil | MKESQGIREYDWWLLALVFTICALGVMEIYSATHS |
| Ga0105247_104032271 | 3300009101 | Switchgrass Rhizosphere | MKDAAQGRRDYDWWLIAILMAICALGVLEIYSATHAS |
| Ga0126373_130558561 | 3300010048 | Tropical Forest Soil | MKDAPGTRDYDWWLLAILTTICALGVIEIYSATHGSSLA |
| Ga0134071_102602982 | 3300010336 | Grasslands Soil | MKDAPGTRDYDWLLLAILAAICALGVIEIYSATHGSSLTGMHM |
| Ga0074045_100798121 | 3300010341 | Bog Forest Soil | MRDAPGTRDYDWWLVAILAAICALGVIEIYSATHGSALTGMH |
| Ga0126377_129695001 | 3300010362 | Tropical Forest Soil | MRDAPGTRDYDWWLLAIVAAICALGVLEIYSATHGS |
| Ga0126379_120965412 | 3300010366 | Tropical Forest Soil | MKDAPGTRDYDWWLIAILLAICTLGVLEIYSATYGS |
| Ga0126381_1029026952 | 3300010376 | Tropical Forest Soil | MNDATTTRDYDWWLLAIVAAICALGVLEIYSATHGS |
| Ga0150983_143016721 | 3300011120 | Forest Soil | MKDAPGTRDYDWWLLAILAAICTLGVLEIYSATHGSSL |
| Ga0137393_105643112 | 3300011271 | Vadose Zone Soil | MKDTAAGTRDYDWWLLAILATICALGVIEIYSATH |
| Ga0137393_107694802 | 3300011271 | Vadose Zone Soil | MKDAPGTRDYDWWLIAILAAICALGVVEIYSATHASN |
| Ga0137393_116804492 | 3300011271 | Vadose Zone Soil | MKESQGIREYDWWLLALVFTICALGVMEIYSATHSSSQF |
| Ga0137388_107681081 | 3300012189 | Vadose Zone Soil | MKDTAAGTRDYDWWLLAILATICALGVIEIYSATHGSS |
| Ga0137383_100360291 | 3300012199 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILATICALGVVEVYSTTHGSSLQGMH |
| Ga0137363_105438541 | 3300012202 | Vadose Zone Soil | MREAPGTRDYDWWLLAILATICALGVIEIYSATHGS |
| Ga0137363_117826611 | 3300012202 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILATICALGVIEIYSATHGSGL |
| Ga0137399_105336131 | 3300012203 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVVEIYSATHGSSLAG |
| Ga0137399_115123542 | 3300012203 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVVEIYSATHG |
| Ga0137362_103208821 | 3300012205 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVIEIYSATHGGSLA |
| Ga0137386_101947141 | 3300012351 | Vadose Zone Soil | MKNAPGTRDYDWWLLAILTTICALGVIEIYSATHG |
| Ga0137385_108394201 | 3300012359 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILTTICALGVLEIYSATHGSS |
| Ga0137397_109937622 | 3300012685 | Vadose Zone Soil | MKEAPGTRDYDWWLLAILATICLLGLIEIYSATKGSSLA |
| Ga0137395_104985021 | 3300012917 | Vadose Zone Soil | MSDSPGTRDYDWWLLAILAAICALGVIEIYSTTHGSTLAG |
| Ga0137395_112793782 | 3300012917 | Vadose Zone Soil | MKEAPGTRDYDWWLLAILATICALGVIEIYPATHGSGLDGMHK |
| Ga0137396_104923371 | 3300012918 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILATICALGVLEIYSATKGSSLAGMH |
| Ga0137396_107521231 | 3300012918 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVVEIYSATHGSSL |
| Ga0137396_111730611 | 3300012918 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILATICALGVLEIYSATKGS |
| Ga0137416_104085842 | 3300012927 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILATICALGVVEIYSATHGSGL |
| Ga0126369_114801662 | 3300012971 | Tropical Forest Soil | MKDAVQGSRDYDWWLIAILMAICALGVLEIYSATHASGGLEG |
| Ga0134077_103716232 | 3300012972 | Grasslands Soil | MKEAPGTRDYDWWLLAILAAICALGVVEIYSATHA |
| Ga0134110_100732861 | 3300012975 | Grasslands Soil | MKDAPGTRDYDWWLLAILATICALGVVEIYSATHGSG |
| Ga0134075_101220841 | 3300014154 | Grasslands Soil | MKDAPGTRDYDWLLLAILAGICALGVLEIYSATHGSSLTGM |
| Ga0134079_106116082 | 3300014166 | Grasslands Soil | MKEAPGTRDYDWWLLAILAAICALGVLEIYSATHAS |
| Ga0137409_114467331 | 3300015245 | Vadose Zone Soil | MKEAPGTRDYDWWLLAILATICLLGLIEIYSATKGSSLAGMH |
| Ga0132255_1032899111 | 3300015374 | Arabidopsis Rhizosphere | MKDAQATRDYDWWLIAILMAICALGVLEIYSATHASGALA |
| Ga0182033_108811912 | 3300016319 | Soil | MKEAPGARDYDLWLLAILAAICTIGVVEIYSATHGS |
| Ga0182033_115237711 | 3300016319 | Soil | MKEAPGARDYDWWLLAILAAICTIGVVEIYSATHGSALA |
| Ga0182037_104167342 | 3300016404 | Soil | MKDAPGSRDYDWWLIAILMAICALGVLEIYSATHASGGLAGMHYK |
| Ga0182039_102104641 | 3300016422 | Soil | MKEAPGARDYDWWLLAILAAICTIGVVEIYSATHGS |
| Ga0187778_103182731 | 3300017961 | Tropical Peatland | MKDATGARDYDWWLLAIMLAICTLGVIEIYSATHGSA |
| Ga0066667_110844471 | 3300018433 | Grasslands Soil | MKDAPGTRDYDWWLLAILATICALGVVEIYSATHG |
| Ga0179594_100085411 | 3300020170 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILATICALGVVEIYSATHGS |
| Ga0210407_113426462 | 3300020579 | Soil | MNDAPGTRDYDWWLLAILATICALGVIEIYSATHGSAL |
| Ga0210399_101690992 | 3300020581 | Soil | MKDAPGTRDYDWWLLAILATICALGVVEVYSTTHGS |
| Ga0210399_103060911 | 3300020581 | Soil | MNETTGTRDYDWWLLAIVAAICALGVVEIYSATHGSALV |
| Ga0215015_101419202 | 3300021046 | Soil | MKDTAAGTRDYDWWLLAILATICALGVIEIYSATHGSSLAG |
| Ga0210406_104994302 | 3300021168 | Soil | MKDAPGATTRDYDWWLIAILAAICTLGVIEIYSATHGSSL |
| Ga0210406_108340482 | 3300021168 | Soil | MKDAPGTRDYDWWLLAILAAICALGVLEIYSATHASNLAGMH |
| Ga0210396_100301211 | 3300021180 | Soil | MKDAPGTRDYDWWLLAILTAICALGVIEIYSATHGSSLA |
| Ga0210393_101476412 | 3300021401 | Soil | VKDAPGTRDYDWWLIAILAAICALGVIEIYSATHASNLA |
| Ga0210386_112872181 | 3300021406 | Soil | MKEAPGTRDYDWWLLAILATICALGVIEIYSATHGSSL |
| Ga0210391_102945121 | 3300021433 | Soil | MNDAPGTRDYDWWLLAILAAICALGVIEIYSATHGSSL |
| Ga0210409_112065591 | 3300021559 | Soil | MKDAPGATTRDYDWWLLAILAAICTLGVIEIYSATH |
| Ga0210409_116231232 | 3300021559 | Soil | MNDAPGTRDYDWWLLAILATICALGVIEIYSATHGSSL |
| Ga0212128_104278662 | 3300022563 | Thermal Springs | MKERSQTRDFDWWLLLIVLSICALGILEIYSATHS |
| Ga0247695_10397611 | 3300024179 | Soil | MNETTGTRDYDWWLLAIIAAICALGVVEIYSATHGSV |
| Ga0137417_14461897 | 3300024330 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILAAICALGVMEIYFRHAR |
| Ga0247668_11284502 | 3300024331 | Soil | MKDAQATRDYDWWLIAILMAICALGVLEIYSATHSSGGLAG |
| Ga0208479_10559772 | 3300025474 | Arctic Peat Soil | VGQKLIKDAPGARDYDWWLLAIIAAICALGVVEIYSATH |
| Ga0207684_100769053 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKEAPGTRDYDWWLLAILAAICALGVVEIYSATHASNLA |
| Ga0209027_12902571 | 3300026300 | Grasslands Soil | MKDAPGTRDYDWWLLAILATICALGVVEIYSATHGSGLEG |
| Ga0209154_12704921 | 3300026317 | Soil | MKDAPGTRDYDWWLLAILATICALGVIEIYSATHGSSLAGM |
| Ga0257180_10642562 | 3300026354 | Soil | MKDAPTRDYDWWLIAILAAICALGVVEIYSATHASNLAGMH |
| Ga0257168_11547741 | 3300026514 | Soil | MKDAPGTRDYDWWLIAILAAICALGVVEIYSATHASNL |
| Ga0209378_12506002 | 3300026528 | Soil | MKEAPGTRDYDWWLLAILAAICALGVVEIYSATHASNLTG |
| Ga0209806_13421851 | 3300026529 | Soil | MKDAPGTRDYDWWLLAILATICALGVLEIYSATKGSSL |
| Ga0209376_12060231 | 3300026540 | Soil | MKDAPGTRDYDWWLLAILATICALGVIEIYSATHGS |
| Ga0209648_100249806 | 3300026551 | Grasslands Soil | MKDTAAGTRDYDWWLLAILATICALGVIEIYSATHG |
| Ga0209113_10706862 | 3300027517 | Forest Soil | MKDAPGTRDYDWWLIAILLAICTLGVLEIYSATQGSTL |
| Ga0209524_10525092 | 3300027521 | Forest Soil | MKDAPGTRDYDWWLLAILAAICAVGVIEIYSATHGSSLAG |
| Ga0209588_12653872 | 3300027671 | Vadose Zone Soil | MKEAPGTRDYDWWLLAILATICALGVIEIYSATHGSSLAG |
| Ga0209448_100572961 | 3300027783 | Bog Forest Soil | MKDAPGTRDYDWWLLAILATICALGVLEIYSATHGSSRAGMQ |
| Ga0209180_106166391 | 3300027846 | Vadose Zone Soil | MKDAPGTRDYDWWLLAILATICALGVIEIYSATHGSGLA |
| Ga0209579_102284961 | 3300027869 | Surface Soil | MKDGTGTRDYDWWLIAILLAICTLGVLEIYSATQGSS |
| Ga0209590_101745021 | 3300027882 | Vadose Zone Soil | MKDGPGTRDYDWWLLAILAAICALGVIEIYSATHGSS |
| Ga0265354_10070651 | 3300028016 | Rhizosphere | MNDAPGTRDYDWWLLAILAAICALGVIEIYSATHGSSLA |
| Ga0268264_118860471 | 3300028381 | Switchgrass Rhizosphere | MKDAAQNTRDYDWWLIAILMAICALGALEIYSATHASGGLEGMHYKQI |
| Ga0222749_106562051 | 3300029636 | Soil | MKEAPGTRDYDWWLLAILATICALGVIEIYSATHGSS |
| Ga0302178_104396491 | 3300030013 | Palsa | VKDAPGTRDYDWWLLAILAAICALGVIEIYSATHGSA |
| Ga0318538_104921281 | 3300031546 | Soil | MKEAPGARDYDWWLLAILAAICTIGVVEIYSATHG |
| Ga0307474_105325652 | 3300031718 | Hardwood Forest Soil | MVKDAAGSREYDYWLLAILAAICALGVVEVYSTTHGSALAGMHMKQLR |
| Ga0318501_101718511 | 3300031736 | Soil | MKDAAQGSRDYDWWLIAILMAICALGVLEIYSATHASGGL |
| Ga0307477_105270251 | 3300031753 | Hardwood Forest Soil | MKDAPGTRDYDWWLIAILAAICALGVIEIYSATHASNLAGMH |
| Ga0307475_104813101 | 3300031754 | Hardwood Forest Soil | MKDAPGTRDYDWWLLAILATICAIGVVEIYSATHGSS |
| Ga0307473_102254512 | 3300031820 | Hardwood Forest Soil | MKDAPGTRDYDWMLLAILAAICALGVVEIYSATHGSALAG |
| Ga0307473_113642182 | 3300031820 | Hardwood Forest Soil | MKDAPGTRDYDWWLIAILASICALGVIEIYSATHASNLA |
| Ga0318505_100287431 | 3300032060 | Soil | MRDAPGTRDYDWWLLAILTTICALGVIEIYSATHG |
| ⦗Top⦘ |