| Basic Information | |
|---|---|
| Family ID | F087595 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MDAKRNMAKGPQPREGKATQMEGPDLESVIERAQGHDAE |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.73 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.18 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (10.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.39% β-sheet: 0.00% Coil/Unstructured: 77.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 2.73 |
| PF11154 | DUF2934 | 1.82 |
| PF08002 | DUF1697 | 1.82 |
| PF02861 | Clp_N | 1.82 |
| PF11867 | DUF3387 | 1.82 |
| PF00144 | Beta-lactamase | 0.91 |
| PF04237 | YjbR | 0.91 |
| PF13414 | TPR_11 | 0.91 |
| PF00296 | Bac_luciferase | 0.91 |
| PF02517 | Rce1-like | 0.91 |
| PF13751 | DDE_Tnp_1_6 | 0.91 |
| PF14534 | DUF4440 | 0.91 |
| PF13508 | Acetyltransf_7 | 0.91 |
| PF14329 | DUF4386 | 0.91 |
| PF13242 | Hydrolase_like | 0.91 |
| PF00069 | Pkinase | 0.91 |
| PF00753 | Lactamase_B | 0.91 |
| PF01548 | DEDD_Tnp_IS110 | 0.91 |
| PF01865 | PhoU_div | 0.91 |
| PF02894 | GFO_IDH_MocA_C | 0.91 |
| PF02272 | DHHA1 | 0.91 |
| PF04203 | Sortase | 0.91 |
| PF05199 | GMC_oxred_C | 0.91 |
| PF13620 | CarboxypepD_reg | 0.91 |
| PF12327 | FtsZ_C | 0.91 |
| PF13180 | PDZ_2 | 0.91 |
| PF00586 | AIRS | 0.91 |
| PF00909 | Ammonium_transp | 0.91 |
| PF03781 | FGE-sulfatase | 0.91 |
| PF01019 | G_glu_transpept | 0.91 |
| PF00275 | EPSP_synthase | 0.91 |
| PF03551 | PadR | 0.91 |
| PF00293 | NUDIX | 0.91 |
| PF13519 | VWA_2 | 0.91 |
| PF13495 | Phage_int_SAM_4 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.64 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.73 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 1.82 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.91 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.91 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.91 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.91 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.91 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.91 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.91 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.91 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.91 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.91 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 0.91 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.91 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.73 % |
| Unclassified | root | N/A | 17.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig194146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300000955|JGI1027J12803_105078558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
| 3300001593|JGI12635J15846_10033519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4082 | Open in IMG/M |
| 3300001593|JGI12635J15846_10913797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101834516 | Not Available | 508 | Open in IMG/M |
| 3300003218|JGI26339J46600_10063381 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005167|Ga0066672_10038202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2681 | Open in IMG/M |
| 3300005177|Ga0066690_10351889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300005435|Ga0070714_100404079 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300005435|Ga0070714_101777429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005535|Ga0070684_101867835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300005541|Ga0070733_10176353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300005542|Ga0070732_10292470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300005554|Ga0066661_10908585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005554|Ga0066661_10910044 | Not Available | 514 | Open in IMG/M |
| 3300005555|Ga0066692_10936257 | Not Available | 530 | Open in IMG/M |
| 3300005557|Ga0066704_10307252 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300005568|Ga0066703_10754693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300005994|Ga0066789_10338428 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006059|Ga0075017_100612504 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300006102|Ga0075015_100042770 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
| 3300006102|Ga0075015_100614472 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300006174|Ga0075014_100828810 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006797|Ga0066659_10116974 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
| 3300006797|Ga0066659_11369804 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006804|Ga0079221_10625528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300006854|Ga0075425_100476591 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300009038|Ga0099829_11356954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300009525|Ga0116220_10504863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009760|Ga0116131_1071501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300009824|Ga0116219_10638905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300010304|Ga0134088_10031631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2389 | Open in IMG/M |
| 3300010323|Ga0134086_10462986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300010339|Ga0074046_10928713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 504 | Open in IMG/M |
| 3300010341|Ga0074045_10211319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300010359|Ga0126376_12939712 | Not Available | 526 | Open in IMG/M |
| 3300010379|Ga0136449_103875873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300012189|Ga0137388_10183345 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300012201|Ga0137365_11190968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300012206|Ga0137380_10281883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1492 | Open in IMG/M |
| 3300012208|Ga0137376_11292647 | Not Available | 620 | Open in IMG/M |
| 3300012354|Ga0137366_10878643 | Not Available | 632 | Open in IMG/M |
| 3300012356|Ga0137371_10373660 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300012359|Ga0137385_10088001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2756 | Open in IMG/M |
| 3300012582|Ga0137358_10186134 | Not Available | 1416 | Open in IMG/M |
| 3300012927|Ga0137416_10366266 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300012930|Ga0137407_10097306 | Not Available | 2514 | Open in IMG/M |
| 3300013296|Ga0157374_11542767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300013308|Ga0157375_13044110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300014166|Ga0134079_10067199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
| 3300014493|Ga0182016_10016519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6796 | Open in IMG/M |
| 3300014502|Ga0182021_13534100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300016357|Ga0182032_10451366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1049 | Open in IMG/M |
| 3300016404|Ga0182037_11934602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300016422|Ga0182039_10512101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1038 | Open in IMG/M |
| 3300017659|Ga0134083_10315098 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300017948|Ga0187847_10716855 | Not Available | 563 | Open in IMG/M |
| 3300018004|Ga0187865_1226629 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300018008|Ga0187888_1176205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300018042|Ga0187871_10080063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1906 | Open in IMG/M |
| 3300018043|Ga0187887_10838478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300018057|Ga0187858_10569524 | Not Available | 686 | Open in IMG/M |
| 3300018085|Ga0187772_10459068 | Not Available | 894 | Open in IMG/M |
| 3300018482|Ga0066669_12327902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300020580|Ga0210403_11293046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300021088|Ga0210404_10039628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2162 | Open in IMG/M |
| 3300021168|Ga0210406_10438060 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300021405|Ga0210387_10741246 | Not Available | 870 | Open in IMG/M |
| 3300021474|Ga0210390_10926429 | Not Available | 715 | Open in IMG/M |
| 3300021475|Ga0210392_10339923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
| 3300021478|Ga0210402_10217724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1758 | Open in IMG/M |
| 3300021479|Ga0210410_10864180 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300021559|Ga0210409_10424881 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300021559|Ga0210409_10561461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300025463|Ga0208193_1106276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300025576|Ga0208820_1059147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300026529|Ga0209806_1324448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300026538|Ga0209056_10556982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300027039|Ga0207855_1008102 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300027565|Ga0209219_1022723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella pectinivorans | 1540 | Open in IMG/M |
| 3300027635|Ga0209625_1118799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300027681|Ga0208991_1189224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300027855|Ga0209693_10540234 | Not Available | 555 | Open in IMG/M |
| 3300027884|Ga0209275_10293499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300027884|Ga0209275_10696323 | Not Available | 585 | Open in IMG/M |
| 3300027908|Ga0209006_11431094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300028740|Ga0302294_10003742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3961 | Open in IMG/M |
| 3300029944|Ga0311352_10392026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1139 | Open in IMG/M |
| 3300029999|Ga0311339_11752610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300030058|Ga0302179_10241531 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300030503|Ga0311370_10236361 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
| 3300030737|Ga0302310_10311211 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300030862|Ga0265753_1072314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300031232|Ga0302323_100993663 | Not Available | 931 | Open in IMG/M |
| 3300031521|Ga0311364_10058339 | All Organisms → cellular organisms → Bacteria | 4118 | Open in IMG/M |
| 3300031708|Ga0310686_105776190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300031708|Ga0310686_108681103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300031718|Ga0307474_11284937 | Not Available | 578 | Open in IMG/M |
| 3300031720|Ga0307469_12015816 | Not Available | 560 | Open in IMG/M |
| 3300031754|Ga0307475_11335693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300031754|Ga0307475_11474763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300031768|Ga0318509_10196745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1121 | Open in IMG/M |
| 3300031962|Ga0307479_12136972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300032076|Ga0306924_10132396 | All Organisms → cellular organisms → Bacteria | 2844 | Open in IMG/M |
| 3300032160|Ga0311301_10403439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2092 | Open in IMG/M |
| 3300032160|Ga0311301_10857808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
| 3300032174|Ga0307470_11021034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300032180|Ga0307471_103778508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300032205|Ga0307472_102046753 | Not Available | 574 | Open in IMG/M |
| 3300032261|Ga0306920_103061686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.36% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.73% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.82% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.91% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_00185180 | 2140918007 | Soil | MDAKRNMAKGPQPREGKATQMEGPDLESVIERAQGHDAE |
| JGI1027J12803_1050785583 | 3300000955 | Soil | MDGNRNNAKGSQPREGKATQMEGQDLESVIERARGH |
| JGI12635J15846_100335196 | 3300001593 | Forest Soil | MDAKRNMAKEPQPREGETRHMEGLDLESVIERAQDHDAEALGEIYHR |
| JGI12635J15846_109137972 | 3300001593 | Forest Soil | MNAKRNMAKEPQPREGETTQMEGLGLESVIQRARGHDVEALGEIYR |
| JGIcombinedJ26739_1018345162 | 3300002245 | Forest Soil | MDAKMNMAKGPEPREGETRRMEGMDLSSVIECARGHDGEALGEI |
| JGI26339J46600_100633811 | 3300003218 | Bog Forest Soil | MDAKRNDAKGSQPREGKATQMEGPDLESVIERAQGHDAEALG |
| Ga0066672_100382023 | 3300005167 | Soil | MDAESNRAKGPEPREDKQMEGLDLESVIERARGHDAEALGEIYRRY |
| Ga0066690_103518892 | 3300005177 | Soil | MDAESNRVKGPQPHEDKQMEGLDLESVIERARGHDAEALGEIYRR |
| Ga0070714_1004040791 | 3300005435 | Agricultural Soil | MDAKRNTSRELQPHRGESTEMEGLDLESVIERARGHDAEALGEIYRR |
| Ga0070714_1017774291 | 3300005435 | Agricultural Soil | MNAGRNWAKGPQPRGGEQMEGLDLESVIERARAHDAEALAE |
| Ga0070684_1018678352 | 3300005535 | Corn Rhizosphere | MNAGRNWAKGPQPRGGEQMEGLDLESVIERARAHDAEALAEIYRRYFR |
| Ga0070733_101763531 | 3300005541 | Surface Soil | MDAKRNMAKEPQPGEGGTRQTEGLDLESVIERARGH |
| Ga0070732_102924701 | 3300005542 | Surface Soil | MNAKRNMAKEPQPRESGTRQLEGLGLESVIERAQSRDAEA |
| Ga0066661_109085851 | 3300005554 | Soil | MDAEKNKPTGPRPREGTAKQMEGLDLESVIERAQGHHAEALEEIYRR |
| Ga0066661_109100442 | 3300005554 | Soil | MDAEVKKAQGTRPREGTAKEMDGLDLESVIERARGHDAE |
| Ga0066692_109362571 | 3300005555 | Soil | MDSRVEPAKGPQPREGKAKQMEGLDLESVIERARGHDV |
| Ga0066704_103072521 | 3300005557 | Soil | MDAKRNMAKGPQPREGETRQREGLDLESVIERARGQDAEALEEIYRR |
| Ga0066703_107546932 | 3300005568 | Soil | MDARRNKAKGPQPREVKDKQMEGRDLESVIERAQGHDTQALGEIHRRY |
| Ga0066789_103384281 | 3300005994 | Soil | MDAKRNNAKASRPGEGKTTQMDGPDLESVIERAQGHDAEALGEIYRLY |
| Ga0075017_1006125043 | 3300006059 | Watersheds | MDAKRNMAKGPQPREGEIRQIEGLDLDSVIERARGQDAE |
| Ga0075015_1000427703 | 3300006102 | Watersheds | MDAKRNMARERQPGEGETRQIEGLDLESVIQRARG |
| Ga0075015_1006144722 | 3300006102 | Watersheds | MDAKRNMAKEPQPSEGETRQIEGLDLESVIQRARG |
| Ga0075014_1008288102 | 3300006174 | Watersheds | MDAKRNMAKEAQPREGETRQMEGLGLESVIERAQGHDAEALGEIYR |
| Ga0066659_101169744 | 3300006797 | Soil | MDSRVEQAKGPQPREGKAKQMEGLDLESVIERARG |
| Ga0066659_113698041 | 3300006797 | Soil | MDAERNKAKGPRPREGTAKQMEGLDLESVIARARGRDAEALAEIY |
| Ga0079221_106255282 | 3300006804 | Agricultural Soil | MDFKRKNAKGSQPREGKATQMEGPDLASVIERAQGHDAEALGELYRLYV |
| Ga0075425_1004765911 | 3300006854 | Populus Rhizosphere | MNAGRNWAKGPQPRGGEQMEGLDLESVIERARAHDAEAL |
| Ga0099829_113569542 | 3300009038 | Vadose Zone Soil | MDAKRNNAKGSQPQEDKATQMEGQDLKSVIESARGHDAEALGEIYRR |
| Ga0116220_105048631 | 3300009525 | Peatlands Soil | MDAKRNMAKEPQPREGGTRQMEGMDLESVIECARG |
| Ga0116131_10715011 | 3300009760 | Peatland | MDAKRNMAKGPQPREGGTRQMEGLDLESVIERARGHDAEALGEICRR |
| Ga0116219_106389051 | 3300009824 | Peatlands Soil | MDAERNNAKGSQPREGKATQMEGPDLESVIERAQGHDAEAL |
| Ga0134088_100316313 | 3300010304 | Grasslands Soil | MDAESNRAKGPEPREDKQMEGPDLESVIERARGHDAEALGEIYHR |
| Ga0134086_104629862 | 3300010323 | Grasslands Soil | MDAKRNMAKEPQPREGETRQLEGLGLERVIERAQGHDADALG |
| Ga0074046_109287132 | 3300010339 | Bog Forest Soil | MDAKRNNAKGSQPREGKATQMEGPDLESVIGRAQGHDAEALGVIY |
| Ga0074045_102113191 | 3300010341 | Bog Forest Soil | MDARRNNAKGSQPREGKATQMEGPDLESVIGRAQGHDAEALG |
| Ga0126376_129397121 | 3300010359 | Tropical Forest Soil | MDAERNRAKGLQSSEGTATRMEAPDLESVIQRAQSHDAEALAEI |
| Ga0136449_1038758731 | 3300010379 | Peatlands Soil | MDAKRNNAKGSQPREGKATQMEGPDLESVIERAQGHDAEALGEIYRL |
| Ga0137388_101833453 | 3300012189 | Vadose Zone Soil | MDAKRNKAKGPQREVKAKQMEGRDLEGVIERAQGHDAEALG |
| Ga0137365_111909681 | 3300012201 | Vadose Zone Soil | MDAGRNKRKGPQPREGKAKQMEGLDLGSVIERARGHDAL |
| Ga0137380_102818831 | 3300012206 | Vadose Zone Soil | MDAESNRTKGPEPREDKQMEGLDLESVIERARGHDVEAL |
| Ga0137376_112926471 | 3300012208 | Vadose Zone Soil | MDAGRNKRKGPQPREGKAKQMEGLDLESVIERARGHDVEA |
| Ga0137366_108786431 | 3300012354 | Vadose Zone Soil | MNAERNKAKGMRRREAKAKHTEALDLDSVIERARGHDAEAL |
| Ga0137371_103736601 | 3300012356 | Vadose Zone Soil | MDAERNKRKGPQPREGKAKQMEGLDLESVIERARGH |
| Ga0137385_100880011 | 3300012359 | Vadose Zone Soil | MDAERNKRKGPQPREGKAKQMEGLDLESVIERARGHDVEALGEI |
| Ga0137358_101861341 | 3300012582 | Vadose Zone Soil | MDTKRNNAKGPQPREGETMQMEGLDLEGVIERARGHDAEA |
| Ga0137416_103662661 | 3300012927 | Vadose Zone Soil | MDAKKNSPKGRQLREVKTKQMEGQDLESVIERAQGHDAEALGEIHRRY |
| Ga0137407_100973064 | 3300012930 | Vadose Zone Soil | MDAKRNNAKGLRPREDKATQMEGQDLKSVIECARGDDAEALGE |
| Ga0157374_115427671 | 3300013296 | Miscanthus Rhizosphere | MDAKRNTSRELQPHKGESTEMEGLGLESVIERARGHDAEALG |
| Ga0157375_130441101 | 3300013308 | Miscanthus Rhizosphere | MDATRNRAKEPEPREGKIRQMEGLDLESVIERARGHDAEALGEIYR |
| Ga0134079_100671991 | 3300014166 | Grasslands Soil | MDAESNRAKGPEPREDKQMEGPDLESVIERARGHDAEALGEIYHRY |
| Ga0182016_100165199 | 3300014493 | Bog | MDAKRSNAKGLQPREGKATQMEGPDLESVIARAQGHDA |
| Ga0182021_135341001 | 3300014502 | Fen | MDAKRNNTKGSQSREGKATQMEGPDLESVIERAQGH |
| Ga0182032_104513661 | 3300016357 | Soil | MDAKRNNAKGSQPREGKATQMEGADLERVIGRAQGHDAEALGEIYRL |
| Ga0182037_119346021 | 3300016404 | Soil | MDAKRNNAKGLQPHDGNATQMEGLDLESVIERAQGHDVEALGEIY |
| Ga0182039_105121011 | 3300016422 | Soil | MDAKRNNAKGSQPREGKATQMEGADLERVIGRAQGHD |
| Ga0134083_103150981 | 3300017659 | Grasslands Soil | MDAERNKRKGPQPREGKAKQMEGLDLESVIERARGHDVEALG |
| Ga0187847_107168551 | 3300017948 | Peatland | MDAKRNMAKAPEPREGGTRQMEGMDLERVIECARGHDADA |
| Ga0187865_12266292 | 3300018004 | Peatland | MDAKKNMAKEAQPREAETRQMEGLGLENVIERARGH |
| Ga0187888_11762051 | 3300018008 | Peatland | MDAKKNMAKEAQPREAETRQMEGLGLENVNERARGHEDEA |
| Ga0187871_100800631 | 3300018042 | Peatland | MDAKRNMAKALQPREGGPRQMEGLDLESVIERARGHD |
| Ga0187887_108384782 | 3300018043 | Peatland | MDAKGTRRKDRSPREGEATQMEGPDLESVIERAQGHDAEALGEIY |
| Ga0187858_105695241 | 3300018057 | Peatland | MDAKRNMAKERQPREGGTRQMEEMDLESVIECARGHDGEALGELYRRY |
| Ga0187772_104590681 | 3300018085 | Tropical Peatland | MDTKRNNAKGSQPREGQGMPMEGQDLESVIARARGHD |
| Ga0066669_123279021 | 3300018482 | Grasslands Soil | MDAKRTNAKGSQPREGKATQMEGTDLERAIESAQRHD |
| Ga0210403_112930462 | 3300020580 | Soil | MNAKRNMAKGPQPREGGASQMEGLDLEGILERARGHDAEALAEIYRRHVR |
| Ga0210404_100396283 | 3300021088 | Soil | MDAKRNMAKGPQLREGEAKQMEALALETIVERARGQDSEA |
| Ga0210406_104380603 | 3300021168 | Soil | MDAKKKMAKEPQPRVGGTGQMEGMDLESVIESARGHNGE |
| Ga0210387_107412462 | 3300021405 | Soil | MDIKRDSAKGSQPREDNAMQMEGPDLESVIERAQGHE |
| Ga0210390_109264292 | 3300021474 | Soil | MDAKRNMAKELQPREGGTRQMEGMDLESVIECARGHNGEAL |
| Ga0210392_103399231 | 3300021475 | Soil | MDAKRNMAKGPQPREGGSGQMVGLDLESVIERARGHEAEAL |
| Ga0210402_102177241 | 3300021478 | Soil | MDAKRNMAKEPQPREGGTRQIEELDLERVIERARGHDAEALG |
| Ga0210410_108641801 | 3300021479 | Soil | MDAKRNMAKEPQPREGGTRQMDGLGLEGVIERAQSQDAEALGEIY |
| Ga0210409_104248811 | 3300021559 | Soil | MDAKRNMAKEPQPSEGETRQMEGLGLESVIERAQGHDAEALGEIYRRY |
| Ga0210409_105614612 | 3300021559 | Soil | MDAKRNMAKEPQPREGGTSQMEGLDLESVIERARGHAAEAMG |
| Ga0208193_11062761 | 3300025463 | Peatland | MDAKRNMAKEPQPRVGGTGQLEGPDLESVIERARGHDAEAQAE |
| Ga0208820_10591471 | 3300025576 | Peatland | MDAKRNMAKEPQPREGETRQMEGLGLENVIERAQGHDEDALGELY |
| Ga0209806_13244481 | 3300026529 | Soil | MDARRNKAKGPQPREVKDKQMEGRDLESVIERAQGHDTQAL |
| Ga0209056_105569821 | 3300026538 | Soil | MDSRVEQAKGPQPREGKAKQMEGLDLESVIERARGHDVEALGKCIAAMSGAY |
| Ga0207855_10081021 | 3300027039 | Tropical Forest Soil | MDAERNNAKRSQSSEGTATRMEAADLENVIQRAQGHD |
| Ga0209219_10227233 | 3300027565 | Forest Soil | MDAKRNMAKEPQPREGETRQMEGLDLESVIERAQGHDAEALAEIYH |
| Ga0209625_11187992 | 3300027635 | Forest Soil | MDAKRNMAKEPQPREGETSQMQGLGLESVIQRARGHDVEALGEIYR |
| Ga0208991_11892241 | 3300027681 | Forest Soil | MDAESNKAKGPRPREGTAKHMEGPDLEIVIERAQGHDAEALGEIFA |
| Ga0209693_105402341 | 3300027855 | Soil | MDAKKDSAKGSQPREDNAMQMEGPDLESVIERAQSHDAE |
| Ga0209275_102934991 | 3300027884 | Soil | MAKGPRPREGETRQMEGLGLENVIERAQGHDAEGLGE |
| Ga0209275_106963231 | 3300027884 | Soil | MDAKKDSAKGSQPREDNAMQMEGPDLESVIERAQG |
| Ga0209006_114310941 | 3300027908 | Forest Soil | MDAKRNMAKEPQPREGGTRHMEGLGLENVIERARGHDDEALEEIYHR |
| Ga0302294_100037421 | 3300028740 | Fen | MDADRNIAKDSQSGEGKATQMEGPDLESLIQRAQGH |
| Ga0311352_103920261 | 3300029944 | Palsa | MDTERNNAKTPQGREGKAAQMEGQDLESVIERARGHDAEAL |
| Ga0311339_117526101 | 3300029999 | Palsa | MDAEKNNVKGSQPGDGKAPQMKGPDLKSVIERAQGHD |
| Ga0302179_102415312 | 3300030058 | Palsa | MDTERNNAKTSQSREGKATQMEGEDLESVIERARGHDAEALG |
| Ga0311370_102363611 | 3300030503 | Palsa | MDTKRNHAKRSQGREGKVTPMEGQDLDSVIERARGHDAEA |
| Ga0302310_103112111 | 3300030737 | Palsa | MDTERNNAKTPQGREGKAAQMEGQDLESVIERARGHD |
| Ga0265753_10723142 | 3300030862 | Soil | MDAKRNMAKEPRPREGESRQMEGLGLESVIQRAKIHDAEALG |
| Ga0302323_1009936631 | 3300031232 | Fen | MDADRNIAKDSQPSEGKATQMEEPDLESVIQRAQGHDAEALG |
| Ga0311364_100583391 | 3300031521 | Fen | MDATRNNAKGSQPREGKATQTEGPDLENVIQRAQGHDAE |
| Ga0310686_1057761901 | 3300031708 | Soil | MDAKRNMAKGPQPREGEATQMEGLGLESVIERARGNDADALGEI |
| Ga0310686_1086811031 | 3300031708 | Soil | MDAKRNMAKEPQPREGETRQMEGMDLESVIECARGHNGEALGEIYRRY |
| Ga0307474_112849372 | 3300031718 | Hardwood Forest Soil | MDAKRNMAKGPQLREGETRQMEGLDLESVIERARGQDAEAL |
| Ga0307469_120158161 | 3300031720 | Hardwood Forest Soil | MDAKRNMAKGPQLREGETRQMEELDLERVVERARGQD |
| Ga0307475_113356931 | 3300031754 | Hardwood Forest Soil | LVDAKRNMAKGPQLREGETRQMEELDLESRARGQDMCWQR |
| Ga0307475_114747631 | 3300031754 | Hardwood Forest Soil | MNAKRNMAKEPQPREGGTRQMEGLGLENVIERAQGHDAEALREIYS |
| Ga0318509_101967451 | 3300031768 | Soil | MDAKRNNAKGSQPREGKATQMEGQDLESVIERAQGQDAEALGEIYR |
| Ga0307479_121369721 | 3300031962 | Hardwood Forest Soil | MDAKRNMAKEPQPRTGETRQMEGLGLESVIERAQGHDDQALGE |
| Ga0306924_101323964 | 3300032076 | Soil | MDAKRNNAKGLQPHDGNATQMEGMDLESVIERAQGHDVEALGEIYRR |
| Ga0311301_104034393 | 3300032160 | Peatlands Soil | MDAKRNMAKEPQPREGETRQTEGLGLENVIERARGHDGEALEEI |
| Ga0311301_108578081 | 3300032160 | Peatlands Soil | MDAKRNNAKGSQPREGKATQMEGPDLESVIERAQGHDAEALGEIYR |
| Ga0307470_110210342 | 3300032174 | Hardwood Forest Soil | MNAKRNMAKEPQPREGATRQMEGLGLEKVIERAQGHDAEA |
| Ga0307471_1037785081 | 3300032180 | Hardwood Forest Soil | MDAKRNVKGSQPREGKATQMEGADLESVIARAQGHD |
| Ga0307472_1020467532 | 3300032205 | Hardwood Forest Soil | MDAKRNKAMGSQPREGDTRPMEGLDLESVIERARG |
| Ga0306920_1030616861 | 3300032261 | Soil | MDAKRNMANGPQPREGRTRQMEGLDLESVIERARGHD |
| ⦗Top⦘ |