Basic Information | |
---|---|
Family ID | F087594 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 41 residues |
Representative Sequence | ILGLLAIAVTVLVFGWSENREREISASEMARLERARLGLGRPA |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.83 % |
% of genes near scaffold ends (potentially truncated) | 95.45 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.273 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.364 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.727 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.273 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF00510 | COX3 | 58.18 |
PF03626 | COX4_pro | 16.36 |
PF01774 | UreD | 1.82 |
PF14525 | AraC_binding_2 | 0.91 |
PF00196 | GerE | 0.91 |
PF00091 | Tubulin | 0.91 |
PF02894 | GFO_IDH_MocA_C | 0.91 |
PF00115 | COX1 | 0.91 |
PF02518 | HATPase_c | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 58.18 |
COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 16.36 |
COG0829 | Urease accessory protein UreH | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.27 % |
Unclassified | root | N/A | 42.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004092|Ga0062389_102027501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 752 | Open in IMG/M |
3300004633|Ga0066395_10809836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
3300005176|Ga0066679_10151806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1451 | Open in IMG/M |
3300005332|Ga0066388_100791535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1542 | Open in IMG/M |
3300005713|Ga0066905_100351633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1178 | Open in IMG/M |
3300005764|Ga0066903_105380882 | Not Available | 676 | Open in IMG/M |
3300005844|Ga0068862_100006040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10084 | Open in IMG/M |
3300006032|Ga0066696_10586820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
3300006174|Ga0075014_100858723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
3300006800|Ga0066660_11167967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
3300010358|Ga0126370_10119092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1867 | Open in IMG/M |
3300010360|Ga0126372_11794125 | Not Available | 657 | Open in IMG/M |
3300010361|Ga0126378_13285623 | Not Available | 514 | Open in IMG/M |
3300010376|Ga0126381_103608570 | Not Available | 607 | Open in IMG/M |
3300010398|Ga0126383_10031624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4208 | Open in IMG/M |
3300011269|Ga0137392_10770923 | Not Available | 795 | Open in IMG/M |
3300011270|Ga0137391_10860262 | Not Available | 744 | Open in IMG/M |
3300012096|Ga0137389_10879233 | Not Available | 769 | Open in IMG/M |
3300012202|Ga0137363_10147082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1847 | Open in IMG/M |
3300012211|Ga0137377_11542808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300012212|Ga0150985_104808696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
3300012683|Ga0137398_10903865 | Not Available | 615 | Open in IMG/M |
3300012918|Ga0137396_11150510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
3300012929|Ga0137404_11762826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300012960|Ga0164301_10808591 | Not Available | 718 | Open in IMG/M |
3300012961|Ga0164302_11255109 | Not Available | 596 | Open in IMG/M |
3300012971|Ga0126369_11308288 | Not Available | 815 | Open in IMG/M |
3300012971|Ga0126369_11591155 | Not Available | 743 | Open in IMG/M |
3300012987|Ga0164307_11584815 | Not Available | 554 | Open in IMG/M |
3300013306|Ga0163162_12580830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
3300016270|Ga0182036_10844861 | Not Available | 748 | Open in IMG/M |
3300016294|Ga0182041_12077894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
3300016294|Ga0182041_12287532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300016319|Ga0182033_10306192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1313 | Open in IMG/M |
3300016319|Ga0182033_11038792 | Not Available | 730 | Open in IMG/M |
3300016341|Ga0182035_10681951 | Not Available | 894 | Open in IMG/M |
3300016357|Ga0182032_10846046 | Not Available | 775 | Open in IMG/M |
3300016371|Ga0182034_10208072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1518 | Open in IMG/M |
3300016422|Ga0182039_10664883 | Not Available | 916 | Open in IMG/M |
3300016445|Ga0182038_10052337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2734 | Open in IMG/M |
3300016445|Ga0182038_10099501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2109 | Open in IMG/M |
3300016445|Ga0182038_10636895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 923 | Open in IMG/M |
3300017959|Ga0187779_10914289 | Not Available | 605 | Open in IMG/M |
3300017974|Ga0187777_10525424 | Not Available | 829 | Open in IMG/M |
3300018468|Ga0066662_10839362 | Not Available | 896 | Open in IMG/M |
3300020034|Ga0193753_10399100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
3300021401|Ga0210393_10103718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2266 | Open in IMG/M |
3300021401|Ga0210393_10468947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
3300021406|Ga0210386_11055576 | Not Available | 691 | Open in IMG/M |
3300021433|Ga0210391_11468916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300025910|Ga0207684_10635077 | Not Available | 910 | Open in IMG/M |
3300025929|Ga0207664_11533344 | Not Available | 588 | Open in IMG/M |
3300026527|Ga0209059_1172182 | Not Available | 761 | Open in IMG/M |
3300027512|Ga0209179_1021227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1266 | Open in IMG/M |
3300027846|Ga0209180_10267105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 983 | Open in IMG/M |
3300027874|Ga0209465_10097222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
3300028747|Ga0302219_10282555 | Not Available | 645 | Open in IMG/M |
3300028906|Ga0308309_10229461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1543 | Open in IMG/M |
3300030524|Ga0311357_11011026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
3300031525|Ga0302326_12077540 | Not Available | 731 | Open in IMG/M |
3300031543|Ga0318516_10095578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1674 | Open in IMG/M |
3300031546|Ga0318538_10014446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3377 | Open in IMG/M |
3300031564|Ga0318573_10548401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
3300031573|Ga0310915_10191661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
3300031681|Ga0318572_10105733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1593 | Open in IMG/M |
3300031713|Ga0318496_10174979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1176 | Open in IMG/M |
3300031719|Ga0306917_10807991 | Not Available | 735 | Open in IMG/M |
3300031723|Ga0318493_10144028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1229 | Open in IMG/M |
3300031744|Ga0306918_11405329 | Not Available | 535 | Open in IMG/M |
3300031754|Ga0307475_10391952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1116 | Open in IMG/M |
3300031763|Ga0318537_10150608 | Not Available | 866 | Open in IMG/M |
3300031764|Ga0318535_10437770 | Not Available | 582 | Open in IMG/M |
3300031765|Ga0318554_10064860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2018 | Open in IMG/M |
3300031768|Ga0318509_10391148 | Not Available | 778 | Open in IMG/M |
3300031770|Ga0318521_10373972 | Not Available | 847 | Open in IMG/M |
3300031770|Ga0318521_10556034 | Not Available | 692 | Open in IMG/M |
3300031795|Ga0318557_10039159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1955 | Open in IMG/M |
3300031795|Ga0318557_10130115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1130 | Open in IMG/M |
3300031805|Ga0318497_10212295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1070 | Open in IMG/M |
3300031819|Ga0318568_10522519 | Not Available | 740 | Open in IMG/M |
3300031821|Ga0318567_10151065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1284 | Open in IMG/M |
3300031833|Ga0310917_10061972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2325 | Open in IMG/M |
3300031833|Ga0310917_10527329 | Not Available | 803 | Open in IMG/M |
3300031859|Ga0318527_10514418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300031890|Ga0306925_11933668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300031896|Ga0318551_10209915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1079 | Open in IMG/M |
3300031910|Ga0306923_11412570 | Not Available | 732 | Open in IMG/M |
3300031912|Ga0306921_10568671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1313 | Open in IMG/M |
3300031946|Ga0310910_10982399 | Not Available | 660 | Open in IMG/M |
3300031946|Ga0310910_11449910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
3300031947|Ga0310909_10354061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1232 | Open in IMG/M |
3300031947|Ga0310909_10409952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1138 | Open in IMG/M |
3300031954|Ga0306926_10403846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1686 | Open in IMG/M |
3300032001|Ga0306922_11004951 | Not Available | 860 | Open in IMG/M |
3300032001|Ga0306922_12151013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300032035|Ga0310911_10255549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
3300032035|Ga0310911_10452935 | Not Available | 743 | Open in IMG/M |
3300032035|Ga0310911_10933507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300032039|Ga0318559_10213035 | Not Available | 890 | Open in IMG/M |
3300032051|Ga0318532_10067229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1245 | Open in IMG/M |
3300032051|Ga0318532_10372133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300032060|Ga0318505_10479810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
3300032076|Ga0306924_11396866 | Not Available | 747 | Open in IMG/M |
3300032094|Ga0318540_10300701 | Not Available | 774 | Open in IMG/M |
3300032261|Ga0306920_100127914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3779 | Open in IMG/M |
3300032895|Ga0335074_11284447 | Not Available | 607 | Open in IMG/M |
3300033134|Ga0335073_10693384 | Not Available | 1115 | Open in IMG/M |
3300033289|Ga0310914_10149986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2056 | Open in IMG/M |
3300033289|Ga0310914_11060513 | Not Available | 711 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.09% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.73% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.82% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062389_1020275011 | 3300004092 | Bog Forest Soil | LGLVAAVITSVVFGWSENREQDIPAAEIALMERARLDAGRTA* |
Ga0066395_108098362 | 3300004633 | Tropical Forest Soil | ILGLLAIAVTVLVFGWSENREREISASEMARLERARLGLGRPA* |
Ga0066679_101518061 | 3300005176 | Soil | GLLAAAITVLVFGWSENREHEIPAAEIARMERARLGLGRVA* |
Ga0066388_1007915353 | 3300005332 | Tropical Forest Soil | VILGLLAIAITILVFGWSENREREIPASEMARIEQVRLGLRRPA* |
Ga0066905_1003516331 | 3300005713 | Tropical Forest Soil | IWWIVIVGLLAAATTILVFGWSDDREREISATEVARMERTQVGLGGAR* |
Ga0066903_1053808821 | 3300005764 | Tropical Forest Soil | ILVTVLVFGWSENRQHEISTNEIARMERVRFGFGQPA* |
Ga0068862_1000060401 | 3300005844 | Switchgrass Rhizosphere | AAATMLAFGWSDDREHEIPAAELARAERTRMGLGGAA* |
Ga0066696_105868202 | 3300006032 | Soil | GVLVFGWSENREREIPAAEIARMERARLGLGRPA* |
Ga0075014_1008587232 | 3300006174 | Watersheds | VILGFLAAAVTLLSAGWSDEREHEIPATEIAKLERARSGLRQPA* |
Ga0066660_111679671 | 3300006800 | Soil | WWIVILGLLAAAITVLVFGWSENREREIPVPEIARTERARLGVGGIA* |
Ga0126370_101190923 | 3300010358 | Tropical Forest Soil | VILGLLAIAITILVFGWSEDREREIPASEMARIEQVRLGLRRPA* |
Ga0126372_117941252 | 3300010360 | Tropical Forest Soil | TVLVFGWSENREHEISANEMAQLERARLGLGRPA* |
Ga0126378_132856231 | 3300010361 | Tropical Forest Soil | LVVLGLLAILVAVLVFGWSENRQREIPADEMARIERARLGVGRPA* |
Ga0126381_1036085702 | 3300010376 | Tropical Forest Soil | LAVLGLLAILVTVLVFGWSENRQREISANEMARMERARLGLGWPA* |
Ga0126383_100316241 | 3300010398 | Tropical Forest Soil | ILGLLAILGMVMVFGWSEDREHEISAAEMARMERARLARGRPA* |
Ga0137392_107709232 | 3300011269 | Vadose Zone Soil | AAITVLVFGWSENREREISVAEIARTERARLGLGRTA* |
Ga0137391_108602621 | 3300011270 | Vadose Zone Soil | LGLLAAAITVLVAGWRDDREHEISATELAQMERARLGLGRPA* |
Ga0137389_108792331 | 3300012096 | Vadose Zone Soil | LLAAAITVLVFGWSENREREIPVAEIARTERARLGLGRIA* |
Ga0137363_101470824 | 3300012202 | Vadose Zone Soil | VVTVLVFGWSENREREIPVAEIARTERARLGLGRIA* |
Ga0137377_115428081 | 3300012211 | Vadose Zone Soil | IWWIVILGLLAAAVTVLLSGWSDTREHEISATELARMEQARLGLGRPA* |
Ga0150985_1048086963 | 3300012212 | Avena Fatua Rhizosphere | AILGLLAILVTVLVFGWSENREREIPANEIARMERARLGLGRPA* |
Ga0137398_109038652 | 3300012683 | Vadose Zone Soil | WIVILGLLAAVVTVMVFGWSENREREISVAEIARTERTRLGPGRVA* |
Ga0137396_111505101 | 3300012918 | Vadose Zone Soil | TFLVFGWSENREREISATELARLERARLGLGRPV* |
Ga0137404_117628261 | 3300012929 | Vadose Zone Soil | ALGLAGAAITLLAFGWNEERETAIPASEIARMERARSGLRGVA* |
Ga0164301_108085912 | 3300012960 | Soil | GLLGAAATMLAFGWSDDREHEIPAAELARAERTRMGLGGAA* |
Ga0164302_112551092 | 3300012961 | Soil | LSLLAILVTFMVFGWSENREREIPANEIARMERARPGLGRPA* |
Ga0126369_113082882 | 3300012971 | Tropical Forest Soil | LLAIAITILVFGWSENREREIPASEMARMERARLGLGRPA* |
Ga0126369_115911551 | 3300012971 | Tropical Forest Soil | LGLLAILIIVLVFGWSENRQHEITAREMAQLERARVGLGRSA* |
Ga0164307_115848151 | 3300012987 | Soil | AIVGLLAAAATMLAFGWSDDREHEIPAAELARAERTRARLGGAA* |
Ga0163162_125808301 | 3300013306 | Switchgrass Rhizosphere | IAILGLLAILITVLVFGWSENREREIPANEMARMERARLRPGRSA* |
Ga0182036_108448611 | 3300016270 | Soil | LLAIAVGILVFGWSENREREISASEIARLERARLGLGRPA |
Ga0182041_120778941 | 3300016294 | Soil | LAAAVTVLVFGWSENREHEISANEMARIEQARLGLGRPA |
Ga0182041_122875322 | 3300016294 | Soil | ITVLVFGWSESRQHEISANEMAQLERVRLGLGRPA |
Ga0182033_103061924 | 3300016319 | Soil | IGLLAIAVGILVFGWSENREREISAGEIGRMEQARLGLGRPA |
Ga0182033_110387922 | 3300016319 | Soil | LGLLAIAVTVLVFGWSENREHEISANEMAQLERARLGLGRPA |
Ga0182035_106819513 | 3300016341 | Soil | AVTVLVFGWSENREHEISANEMARIEQARLGLGRPA |
Ga0182032_108460461 | 3300016357 | Soil | VAVLVFGWSKNREREIPVTEMARMERARLGLGRPA |
Ga0182034_102080724 | 3300016371 | Soil | VGLLAILLIVLVFGWSENRQHEITAGEMAQLERARLGLGRSA |
Ga0182039_106648833 | 3300016422 | Soil | LVLVGLLAIAVTIMVFGWSEDREREIPAREIAQLERARLAWGRPA |
Ga0182038_100523371 | 3300016445 | Soil | VTMLVFGWSENREREIPAAEIARVERARLGFGRPA |
Ga0182038_100995011 | 3300016445 | Soil | IWWIVIIGLLAIAVGILVFGWSENREREISAGEIARLERARLALGSPA |
Ga0182038_106368951 | 3300016445 | Soil | AILIIVLVFGWSENRQHEITAGEMAQLERARLGLGRPA |
Ga0187779_109142892 | 3300017959 | Tropical Peatland | VVILGLLAAAVTIMAFGWSENREREITVSEIAGVEQARMGVRGRA |
Ga0187777_105254241 | 3300017974 | Tropical Peatland | VGILVFGWSENRERAISASEIARLERARLALGRPA |
Ga0066662_108393622 | 3300018468 | Grasslands Soil | LLAAAVTVLVSGWSDEREHEIPAAQIAQMERARLGLGRPA |
Ga0193753_103991001 | 3300020034 | Soil | AVILGLLAMLVTVLVFGWSENREREVSSGEIARIEQARLGLRSAA |
Ga0213872_102610741 | 3300021361 | Rhizosphere | GFLAAAIIVLIAGWGDEREHEIPAADIARLERARLRA |
Ga0210393_101037184 | 3300021401 | Soil | LAILGLLAVAVTMLVFGWSENREREIPAAEIARAERARLGFGRPA |
Ga0210393_104689471 | 3300021401 | Soil | IAVTVMVFGWSENREREISANEMARMERARLGLGRPA |
Ga0210386_110555762 | 3300021406 | Soil | ILALLAIAVTVMVFGWSENREREIPANEMARMERVRLGLGRPA |
Ga0210391_114689162 | 3300021433 | Soil | AVTVMVFGWSENREREIPANEMARMERVRLGLGRPA |
Ga0207684_106350773 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGLLGAAATMLAFGWSDDREHEIPAAELARAERTRMGLGGAA |
Ga0207664_115333441 | 3300025929 | Agricultural Soil | IAVIVLVFGWSENREREIPAAEIARMERTRLGFGRPA |
Ga0209059_11721821 | 3300026527 | Soil | VGVLVFGWSENREREIPANEIARMERARLGFGRPA |
Ga0209179_10212271 | 3300027512 | Vadose Zone Soil | GLLAVAVTFLVFGWSENREREISATELARLERARLGLGRPV |
Ga0209180_102671051 | 3300027846 | Vadose Zone Soil | LAAAITVLVFGWSENREREISVAEIARTERARLGLGRTA |
Ga0209465_100972224 | 3300027874 | Tropical Forest Soil | IIGLLAIAVGILVFGWSENREREISANEIARLERTRLALGRPA |
Ga0302219_102825552 | 3300028747 | Palsa | AAVIVAMVFGWSEKREEEIPAAEIARLERARLALGPTA |
Ga0308309_102294611 | 3300028906 | Soil | ILGLLAAAVTMLVFGWSENREREIPANEIARMERARLGLGRPA |
Ga0311357_110110261 | 3300030524 | Palsa | IWWMAILGLLAAVIVAMVFGWSEKREEEIPAAEIARLERARLALGPTA |
Ga0302326_120775402 | 3300031525 | Palsa | VGLLAILVTFLVFGWSENREREIPAGEMARIERARSGLGSAA |
Ga0318516_100955784 | 3300031543 | Soil | IWWIVILGLLAAAVTVLVFGWSENRQHEISANEMARIEQARLGLGRPA |
Ga0318538_100144465 | 3300031546 | Soil | LAILLIVLVFGWSENRQHEITAGEMAQLERARLGLGRPA |
Ga0318573_105484012 | 3300031564 | Soil | LGLLAVAVTMLVFGWSENREREIPAAEIARVERARLGFGRPA |
Ga0310915_101916614 | 3300031573 | Soil | VIIGLLAIAVGILVFGWSENREREISASEIARLERARLGLGRPA |
Ga0318572_101057334 | 3300031681 | Soil | LGLLAAAVTVLVFGWSENRQHEISANEMAQLERARLGLGRPA |
Ga0318496_101749791 | 3300031713 | Soil | AIAVGILVFGWSENREREISAGEIERMEQARLGLGRPA |
Ga0306917_108079912 | 3300031719 | Soil | GLLAIAVGILVFGWSENREREISAGEIARLERARLALGSPA |
Ga0318493_101440283 | 3300031723 | Soil | LLAAAVTVLVFGWSENRQHEISANEMARIEQARLGLGRPA |
Ga0306918_114053291 | 3300031744 | Soil | AVAVTVLVFGWSENREQEISANEMELLERARLGLGRPA |
Ga0307475_103919523 | 3300031754 | Hardwood Forest Soil | LGLLAAAVTMLVFGWSENREREIPANEIARMERARLGLGRPA |
Ga0318537_101506083 | 3300031763 | Soil | WWIVILGLLAAAVTVLVFGWSENRQHEISANEMARIEQARLGLGRPA |
Ga0318535_104377701 | 3300031764 | Soil | VILGLLAAAVTVLAFGWSIDREREISAAEIAQMERARLGLRQPAE |
Ga0318554_100648601 | 3300031765 | Soil | IWWIVILGLLAAAVTVLVFGWSENRQHEISANEMAQLERARLGLGRPA |
Ga0318509_103911481 | 3300031768 | Soil | WWIVIIGLLAIAVGILVFGWSENREHEISAGEIAHLERARLGLGRPA |
Ga0318521_103739721 | 3300031770 | Soil | VAVTMLVFGWSENREREIPAAEIARVERARLGFGRPA |
Ga0318521_105560342 | 3300031770 | Soil | LGLLAAAVTVLVFGWSENREQEISANEMARIEEARLGLGRPA |
Ga0318557_100391591 | 3300031795 | Soil | WWIAILGLLAIAITILVFGWSEDREREIPASQIARMERARLGLGRPA |
Ga0318557_101301151 | 3300031795 | Soil | HIWWIVIIGLLVIAVGILVFGWSENREREISAGEIERMEQARLGLGRPA |
Ga0318497_102122951 | 3300031805 | Soil | IWWIVIIGLLAIAVGILVFGWSENREREISASEIARLERARLGLGRPA |
Ga0318568_105225192 | 3300031819 | Soil | AVGILAFGWSENREREVPASEIARRERARLGLGRPA |
Ga0318567_101510653 | 3300031821 | Soil | IAITILVFGWSEDREREIPASQIARMERARLGLGRPA |
Ga0310917_100619721 | 3300031833 | Soil | VGLLAILFIVLVFGWSENREHEITATEMARLERARLGLGRPA |
Ga0310917_105273291 | 3300031833 | Soil | LLAAAVTVLVFGWSENREQEISANEMARIEEARLGLGRPA |
Ga0318527_105144181 | 3300031859 | Soil | AVGILVFGWSENREREIPASEIARLERARLALGRPA |
Ga0306925_119336681 | 3300031890 | Soil | VIIGLLVIAVGILVFGWSENREREIPASEIARLERARLALGRPA |
Ga0318551_102099153 | 3300031896 | Soil | LLAAAVTVLVFGWSENRQHEISANEMAQLERARLGLGRPA |
Ga0306923_114125702 | 3300031910 | Soil | LLAILLIVLVFGWSENRQHEITAGEMAQLERARLGLGRPA |
Ga0306921_105686711 | 3300031912 | Soil | LAIAVGILVFGWSENREHEISAGELAHLERARLGLGRPA |
Ga0310910_109823992 | 3300031946 | Soil | IIGLLAIAVGILVFGWSENREREISASEIARLERARLGLGRPA |
Ga0310910_114499101 | 3300031946 | Soil | ITVLVFGWSENRQHEISANEMARIEQARLGLRRPA |
Ga0310909_103540611 | 3300031947 | Soil | ILALLAIAVTVLVFGWSENREREIRANEIARMERARLGLGRPA |
Ga0310909_104099521 | 3300031947 | Soil | WIVVLGLLAAAVTVLVFGWSENREHEISANEMARIEQARLGLGRPA |
Ga0306926_104038465 | 3300031954 | Soil | IWYIFWLAILGLLAILATAMVFGWSENREREISAGEMARMERARLGLGRPA |
Ga0306922_110049511 | 3300032001 | Soil | VILGLLAILLIVLVFGWSENRQHEITAGEMAQLERARLGLGRPA |
Ga0306922_121510132 | 3300032001 | Soil | LGLVAAAVTVLVFGWSENRQHEISANEMAQLERARLGLGWPA |
Ga0310911_102555491 | 3300032035 | Soil | LAVAVTILVFGWSENRQHEISANEMARIEQVRLGLGRPA |
Ga0310911_104529352 | 3300032035 | Soil | AILGLLAILVMVMVFGWSEDRQHEISAAEMARMERARLARGRPA |
Ga0310911_109335072 | 3300032035 | Soil | LGLLAILLIVLVFGWSENRQHEITAGEMAQLERARLGLGRPA |
Ga0318559_102130353 | 3300032039 | Soil | VTLGLLAAAVTVLVFGWSENRQHEISANEMARIEQARLGLGRPA |
Ga0318532_100672293 | 3300032051 | Soil | LLAAVVTVLVFGWSENREREIPASQIARMESARLGLGRPA |
Ga0318532_103721331 | 3300032051 | Soil | LAILGLLAVAVTMLVFGWSENREREIPAAEIARVERARLGFGRPA |
Ga0318505_104798101 | 3300032060 | Soil | LAAAVGILAFGWSENREREVPASEIARLERARLGLGRPA |
Ga0306924_113968661 | 3300032076 | Soil | VGILVFGWSENREREISAGEIARLERARLALGSPA |
Ga0318540_103007011 | 3300032094 | Soil | IWWIVIVGLLAILFIVLVFGWSENREHEITATEMARLERARLGLGRPA |
Ga0306920_1001279141 | 3300032261 | Soil | LVILGLLAILIIVLVFGWSENRQHEITAGEMAQLERARLGLGRPA |
Ga0335074_112844472 | 3300032895 | Soil | ILGLLGIAVTVLVFGWSEDREAEIPAAELARLERGRAA |
Ga0335073_106933841 | 3300033134 | Soil | VTVLVSGWSDEREHAISAEEIAQLEQARSGLGQPAE |
Ga0310914_101499864 | 3300033289 | Soil | WIVIIGLLAIAVGILVFGWSENREHEISAGEIAHLERARLGLGRPA |
Ga0310914_110605132 | 3300033289 | Soil | LGLLAILIIVLVFGWSENRQHEITAGEMAQLERARLGLGRPA |
⦗Top⦘ |