| Basic Information | |
|---|---|
| Family ID | F087589 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 51 residues |
| Representative Sequence | VKTTNSLRSRASHFFSSRYANRERPDYLVELVAFGIILIAVTLSLANAMTTH |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.24 % |
| % of genes near scaffold ends (potentially truncated) | 34.55 % |
| % of genes from short scaffolds (< 2000 bps) | 72.73 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.636 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (13.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.25% β-sheet: 0.00% Coil/Unstructured: 48.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF03548 | LolA | 29.09 |
| PF00196 | GerE | 2.73 |
| PF13302 | Acetyltransf_3 | 2.73 |
| PF00571 | CBS | 1.82 |
| PF00144 | Beta-lactamase | 1.82 |
| PF13668 | Ferritin_2 | 0.91 |
| PF13087 | AAA_12 | 0.91 |
| PF13418 | Kelch_4 | 0.91 |
| PF13181 | TPR_8 | 0.91 |
| PF02517 | Rce1-like | 0.91 |
| PF01179 | Cu_amine_oxid | 0.91 |
| PF13738 | Pyr_redox_3 | 0.91 |
| PF13450 | NAD_binding_8 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 29.09 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.82 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.82 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.91 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.64 % |
| Unclassified | root | N/A | 6.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10011255 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300000890|JGI11643J12802_10338513 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 848 | Open in IMG/M |
| 3300000955|JGI1027J12803_100859238 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 818 | Open in IMG/M |
| 3300002568|C688J35102_120195322 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 921 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10031748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 863 | Open in IMG/M |
| 3300003203|JGI25406J46586_10213917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 563 | Open in IMG/M |
| 3300004479|Ga0062595_100059499 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1807 | Open in IMG/M |
| 3300004643|Ga0062591_100851896 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 848 | Open in IMG/M |
| 3300005175|Ga0066673_10002656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6639 | Open in IMG/M |
| 3300005290|Ga0065712_10073014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4534 | Open in IMG/M |
| 3300005295|Ga0065707_10779405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 607 | Open in IMG/M |
| 3300005332|Ga0066388_100832899 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1510 | Open in IMG/M |
| 3300005332|Ga0066388_101123579 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1333 | Open in IMG/M |
| 3300005332|Ga0066388_103270099 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 828 | Open in IMG/M |
| 3300005332|Ga0066388_103316456 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 822 | Open in IMG/M |
| 3300005455|Ga0070663_100662436 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 884 | Open in IMG/M |
| 3300005535|Ga0070684_101309115 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 682 | Open in IMG/M |
| 3300005535|Ga0070684_101617683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 611 | Open in IMG/M |
| 3300005563|Ga0068855_101467844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 701 | Open in IMG/M |
| 3300005618|Ga0068864_101711413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 634 | Open in IMG/M |
| 3300005713|Ga0066905_100982273 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 744 | Open in IMG/M |
| 3300005764|Ga0066903_100000688 | All Organisms → cellular organisms → Bacteria | 22250 | Open in IMG/M |
| 3300005764|Ga0066903_100331243 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2441 | Open in IMG/M |
| 3300005764|Ga0066903_100994027 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1533 | Open in IMG/M |
| 3300005764|Ga0066903_102798858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 946 | Open in IMG/M |
| 3300005764|Ga0066903_107654044 | Not Available | 556 | Open in IMG/M |
| 3300005937|Ga0081455_10451065 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 878 | Open in IMG/M |
| 3300005937|Ga0081455_10980849 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005983|Ga0081540_1013204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5385 | Open in IMG/M |
| 3300006175|Ga0070712_100052014 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
| 3300006854|Ga0075425_100955532 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300006854|Ga0075425_101541701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 750 | Open in IMG/M |
| 3300006871|Ga0075434_100283952 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1675 | Open in IMG/M |
| 3300006871|Ga0075434_101421354 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 703 | Open in IMG/M |
| 3300009094|Ga0111539_10670225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1208 | Open in IMG/M |
| 3300009094|Ga0111539_10677576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1200 | Open in IMG/M |
| 3300009101|Ga0105247_11399797 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 566 | Open in IMG/M |
| 3300009147|Ga0114129_11563412 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 809 | Open in IMG/M |
| 3300009792|Ga0126374_10007161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4108 | Open in IMG/M |
| 3300009792|Ga0126374_10630184 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 796 | Open in IMG/M |
| 3300010041|Ga0126312_10939700 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 631 | Open in IMG/M |
| 3300010043|Ga0126380_11894636 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 542 | Open in IMG/M |
| 3300010047|Ga0126382_10000712 | All Organisms → cellular organisms → Bacteria | 13038 | Open in IMG/M |
| 3300010047|Ga0126382_10547607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 941 | Open in IMG/M |
| 3300010047|Ga0126382_11406251 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 637 | Open in IMG/M |
| 3300010047|Ga0126382_11448148 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 629 | Open in IMG/M |
| 3300010048|Ga0126373_11202496 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 824 | Open in IMG/M |
| 3300010359|Ga0126376_10737418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 953 | Open in IMG/M |
| 3300010362|Ga0126377_10786452 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1009 | Open in IMG/M |
| 3300010362|Ga0126377_13235681 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 3300010366|Ga0126379_10019249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5071 | Open in IMG/M |
| 3300010376|Ga0126381_100334555 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2087 | Open in IMG/M |
| 3300010397|Ga0134124_10033933 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4239 | Open in IMG/M |
| 3300010397|Ga0134124_11125999 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 802 | Open in IMG/M |
| 3300010398|Ga0126383_10693048 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1097 | Open in IMG/M |
| 3300012212|Ga0150985_100300202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 699 | Open in IMG/M |
| 3300012354|Ga0137366_10269847 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1258 | Open in IMG/M |
| 3300012918|Ga0137396_10078170 | All Organisms → cellular organisms → Bacteria | 2325 | Open in IMG/M |
| 3300012958|Ga0164299_10220199 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300012960|Ga0164301_10344448 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300012961|Ga0164302_11862187 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300012975|Ga0134110_10340656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 654 | Open in IMG/M |
| 3300013105|Ga0157369_12514706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 521 | Open in IMG/M |
| 3300014157|Ga0134078_10658542 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 509 | Open in IMG/M |
| 3300014969|Ga0157376_10115135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2373 | Open in IMG/M |
| 3300015371|Ga0132258_10668247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 2613 | Open in IMG/M |
| 3300015372|Ga0132256_100006893 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 9786 | Open in IMG/M |
| 3300015372|Ga0132256_101663046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 748 | Open in IMG/M |
| 3300016270|Ga0182036_10016514 | All Organisms → cellular organisms → Bacteria | 4099 | Open in IMG/M |
| 3300016319|Ga0182033_10026163 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3652 | Open in IMG/M |
| 3300016319|Ga0182033_10660807 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 912 | Open in IMG/M |
| 3300016371|Ga0182034_10963596 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 736 | Open in IMG/M |
| 3300016445|Ga0182038_10419084 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300018061|Ga0184619_10043972 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1927 | Open in IMG/M |
| 3300018433|Ga0066667_10418066 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1088 | Open in IMG/M |
| 3300019883|Ga0193725_1010215 | All Organisms → cellular organisms → Bacteria | 2666 | Open in IMG/M |
| 3300021560|Ga0126371_10852159 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1056 | Open in IMG/M |
| 3300025914|Ga0207671_11279105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 572 | Open in IMG/M |
| 3300025930|Ga0207701_10004102 | All Organisms → cellular organisms → Bacteria | 14852 | Open in IMG/M |
| 3300025930|Ga0207701_10059747 | All Organisms → cellular organisms → Bacteria | 3484 | Open in IMG/M |
| 3300025930|Ga0207701_11212776 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300025944|Ga0207661_11746108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
| 3300026075|Ga0207708_10697539 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 867 | Open in IMG/M |
| 3300026118|Ga0207675_102269496 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 557 | Open in IMG/M |
| 3300026547|Ga0209156_10316792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 699 | Open in IMG/M |
| 3300026550|Ga0209474_10011166 | All Organisms → cellular organisms → Bacteria | 7248 | Open in IMG/M |
| 3300027453|Ga0207624_100155 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1907 | Open in IMG/M |
| 3300030969|Ga0075394_11561986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 576 | Open in IMG/M |
| 3300031231|Ga0170824_121094004 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1044 | Open in IMG/M |
| 3300031231|Ga0170824_125588315 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 757 | Open in IMG/M |
| 3300031573|Ga0310915_11056651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
| 3300031719|Ga0306917_10050901 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2787 | Open in IMG/M |
| 3300031744|Ga0306918_10282624 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1274 | Open in IMG/M |
| 3300031890|Ga0306925_10353871 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1577 | Open in IMG/M |
| 3300031910|Ga0306923_10149098 | All Organisms → cellular organisms → Bacteria | 2669 | Open in IMG/M |
| 3300031938|Ga0308175_101957121 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 657 | Open in IMG/M |
| 3300031941|Ga0310912_10046462 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 3035 | Open in IMG/M |
| 3300031941|Ga0310912_11051536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
| 3300031947|Ga0310909_10943662 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 707 | Open in IMG/M |
| 3300031954|Ga0306926_10491673 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300032066|Ga0318514_10764371 | Not Available | 514 | Open in IMG/M |
| 3300032205|Ga0307472_102282043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300032261|Ga0306920_101174710 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1110 | Open in IMG/M |
| 3300033289|Ga0310914_10241530 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1621 | Open in IMG/M |
| 3300033412|Ga0310810_11372387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027453 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-D (SPAdes) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100112552 | 3300000597 | Forest Soil | MKDNTNMKAANPLRICASLFLSNRYANTERPVYLVELVAFGIIVIAVILSLV* |
| JGI11643J12802_103385132 | 3300000890 | Soil | MKGNANMKAANSLRIGASLLFGSRHANRERPDYLVELIAFAIIVIAVILSLG* |
| JGI1027J12803_1008592383 | 3300000955 | Soil | MKTTNSLRSRASHFFSDRYACRERPDNLVELIAFGIILIAVTLSLANAVTTTLR* |
| C688J35102_1201953223 | 3300002568 | Soil | MKTTNSLRIRASRFFNNRDAGGERPDYLVELIAFGIILIAVTLSLGHAITTTLR* |
| JGIcombinedJ43975_100317481 | 3300002899 | Soil | VKNTNSLRIRAFRFFSNRSAYKERPDYLVELVAFGIIVIAVMLSLG* |
| JGI25406J46586_102139171 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MKATNSLRVRASRFFSSQYAGGERADYLIELIAFGIIVIAVALSLG* |
| Ga0062595_1000594992 | 3300004479 | Soil | MKITNPIRFGASSLFNNRYGPGERPDYLVELVAFGVIVIAVALSLG* |
| Ga0062591_1008518962 | 3300004643 | Soil | MKTTNRLWIRASRFFSNRWAYRERPDYLVELVAFGIILIAVTLSLGNTVATTFR* |
| Ga0066673_100026567 | 3300005175 | Soil | MKTTNSLRIRAFRFFNNRDAGGERPDYLVELIAFGIILIAVTLSLGHAITTTLR* |
| Ga0065712_100730146 | 3300005290 | Miscanthus Rhizosphere | MKATNPLRICASRFFNNRYANRERPDYLVELVAFGIIMIAVTLSLG* |
| Ga0065707_107794051 | 3300005295 | Switchgrass Rhizosphere | MKTINSLRSRASHFFSDRYACRERPDSLVELIAFGIILIAVTLSLGNAITTTLR* |
| Ga0066388_1008328992 | 3300005332 | Tropical Forest Soil | MKTTNSLRSRASHFFRNRYAYTERPDYLVELIAFGIIVIAVTLSLA* |
| Ga0066388_1011235794 | 3300005332 | Tropical Forest Soil | NVNVKTTNSLRSSASRFFRNRSAYRERPDYLVELVALGIILIAVTLSLANATATH* |
| Ga0066388_1032700992 | 3300005332 | Tropical Forest Soil | MKPTISMRIRASRFFTERYSYRERPNYLVELVAFGIIAIKAISSLADAMATLR* |
| Ga0066388_1033164561 | 3300005332 | Tropical Forest Soil | RSRASHFFSDRYAGRERPDDLIALVAFGIIVIALTLSLG* |
| Ga0070663_1006624362 | 3300005455 | Corn Rhizosphere | VKGNVNVKATNPLRICASRFFSNRYANRERPDYLVELVAFGIIVIAVTLSLR* |
| Ga0070684_1013091152 | 3300005535 | Corn Rhizosphere | MKTTNRLWIRASRFFSNRWAYRERPDYLVELVAFGIILIAVTLSLGNTVAMTFR* |
| Ga0070684_1016176833 | 3300005535 | Corn Rhizosphere | MKTTNSLRVRAFRFFSDRYNYREGPDNLIELVAFGIIVITAALSLANAMTTTLK* |
| Ga0068855_1014678441 | 3300005563 | Corn Rhizosphere | VKGNVNVKATNPLRICASRFFSNRYANRERPDYLVELVAFGIIVIAVT |
| Ga0068857_1014809502 | 3300005577 | Corn Rhizosphere | MKTTNSLRVRASQYFRNRSSCGDRPDYLIELVAFGIIVIAVT |
| Ga0068864_1017114131 | 3300005618 | Switchgrass Rhizosphere | NRHLISERNDANMKTKNSLRVRASHFFRNRSACEDRPDYLIELVAFGIIVIAVALSLG* |
| Ga0066905_1009822733 | 3300005713 | Tropical Forest Soil | MKTTNSLRSRASHFFSDRSAGRERPDSLVELVAFGIILIAVALSLGNAITTTLR* |
| Ga0066903_10000068821 | 3300005764 | Tropical Forest Soil | MKTTNSLRVRAFRFFSERYAYRERPDYLVELVAFGIVVIIASLSLADAMATALK* |
| Ga0066903_1003312434 | 3300005764 | Tropical Forest Soil | MKITNSLRSRASHFFSDRYACRERPDSLIELVAFGIILIAVTLSLANAMTTH* |
| Ga0066903_1009940273 | 3300005764 | Tropical Forest Soil | MKITNSLRSRASHFFSDRYACRERPDSLVELIAFGIILIAVALSLGNAITTTLR* |
| Ga0066903_1027988582 | 3300005764 | Tropical Forest Soil | VKTTNSLRSRASRFFSNRYAYGERPDYLVELVAFGIILIAVALSLGNAITTTLR* |
| Ga0066903_1076540442 | 3300005764 | Tropical Forest Soil | MKTINLFRLRASRFFSGRSAERERPDYLIELVAFGIILITLTLLANAMATPLK* |
| Ga0081455_104510651 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTTNSLRGRASRFFSNRYAYREREYLVELVAFGIIAITATLSLANAMASTLK* |
| Ga0081455_109808492 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKTTNPLRIRTSRFFSDRYTYRERPDYLIELVAFGIIVITAALSLANGLATTLK* |
| Ga0081540_10132044 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MKSTTPMRIRAFRFFTDRFAYRERSDYLIELVAFGIIVIAVTLSLASAMATTLK* |
| Ga0070712_1000520143 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTTNSLRARASRFFSARYAERPDNLIELVAFGIIVITLTLLANAMAMPLK* |
| Ga0075425_1009555322 | 3300006854 | Populus Rhizosphere | MKTTNSLRSRASHFFSDRYACRERPDNLVELIAFGIILIAVALSLGNPITTTLR* |
| Ga0075425_1015417013 | 3300006854 | Populus Rhizosphere | DSLRIRASHFFRNRSAREERPDSLVELVAFGIIVIAVMLSLG* |
| Ga0075434_1002839522 | 3300006871 | Populus Rhizosphere | MKTTNSLRSRASHFFSDRYACRERPDSLVELIAFGIILIAVALSLGNPITTTLR* |
| Ga0075434_1014213541 | 3300006871 | Populus Rhizosphere | MKTTNSLRVRASQYFRNRSSCGDRPDYLIELVAFGIILIAVTLSLANAMTRIEMNTIGAI |
| Ga0111539_106702254 | 3300009094 | Populus Rhizosphere | MKTTNSLRSRASHLFSDRYACRERPDSLVELIAFGIILIAVALSLGNPITTTLR* |
| Ga0111539_106775762 | 3300009094 | Populus Rhizosphere | MKTTNSLRIRASRFFNNRDAGGERPDYLVELVAFGIILIAVTLSLATR* |
| Ga0105247_113997971 | 3300009101 | Switchgrass Rhizosphere | MKATNPLRICASRFFSNRYANRERPDYLVELVAFGIIVIAVT |
| Ga0114129_115634122 | 3300009147 | Populus Rhizosphere | MKTTNSLRIRASRLFSSHYARGERPDYLIELIAFGIILIAVTLSLANAMTAH* |
| Ga0126374_100071617 | 3300009792 | Tropical Forest Soil | MKTINSLRLRASRFFSGRSAERERPDYLIELVAFGIILITLTLLANAMATPLK* |
| Ga0126374_106301842 | 3300009792 | Tropical Forest Soil | MKTTNSLRSRASHFFSDRYADRERPVYLIELVAFGIILIAVTLSLANATATH* |
| Ga0126312_109397001 | 3300010041 | Serpentine Soil | MNLKITNSLRNRACRFFSNRYACGERPDYLIELVAFGIIVIAVTLSLGNAMATH* |
| Ga0126380_118946361 | 3300010043 | Tropical Forest Soil | NSLRSSASRFFRNRSAYTERPDSLVELVAFGIILIAVTLSLANAMTTH* |
| Ga0126382_1000071211 | 3300010047 | Tropical Forest Soil | MKTTNSLRVRAARFFSGRYPYRERPEYLIELVAFGIILITLTLLANAMATPLQ* |
| Ga0126382_105476072 | 3300010047 | Tropical Forest Soil | MKTTNSLRSRASHFFSDRYANRERPAHLVELVAFGIIVIAVTMSLP* |
| Ga0126382_114062513 | 3300010047 | Tropical Forest Soil | NMKTTNPLRIRASRFFSDRYGCRERPDYLVELVAFGIILIAVALSLGNAVATTLK* |
| Ga0126382_114481481 | 3300010047 | Tropical Forest Soil | MKTTNSLRIRAARFFGGRYPYRERPEYLIELVAFGIILITLTLLANAMATPLQ* |
| Ga0126373_112024962 | 3300010048 | Tropical Forest Soil | MKTTNSLRSRASHFFSDRYADRERPDSLVELIAFGIIVI |
| Ga0126376_107374182 | 3300010359 | Tropical Forest Soil | MKPTTSMRIRTSGFRAHRYAHREQPDSLIELVAFGIIIITA |
| Ga0126377_107864522 | 3300010362 | Tropical Forest Soil | MKTTNSLRIRAARFFGGRYPYRERPEYLIELVAFGIILITLTLLANAMATPFQ* |
| Ga0126377_132356811 | 3300010362 | Tropical Forest Soil | TANFLRIRASRFFSNRHAGSEPPENLIELVAFGIIVIAVTLSLGHAIATTLR* |
| Ga0126379_100192495 | 3300010366 | Tropical Forest Soil | MKTTNPLRIRASRFFSDRYGCRERPDYLVELVAFGIILIAVALSLGNAVATTLK* |
| Ga0126381_1003345552 | 3300010376 | Tropical Forest Soil | MKDNTNMKAANPLRICASLFFSSRYANRERPVYLVELVAFGIIVIAVILSLR* |
| Ga0134124_100339334 | 3300010397 | Terrestrial Soil | MKTKNSLRVRASHFFRNRSACEDRPDYLIELVAFGIIVIAVALSLG* |
| Ga0134124_111259993 | 3300010397 | Terrestrial Soil | NMKATNQLRICASRFFNNRYASKERPDYLVELVAFGIIIIAVTLSLG* |
| Ga0126383_106930482 | 3300010398 | Tropical Forest Soil | MKTTNSLRVRAARFFGGRYPYRERPEYLIELVAFGIILITLTLLANAMATPLQ* |
| Ga0150985_1003002023 | 3300012212 | Avena Fatua Rhizosphere | HLISERSNVTMKTTNSLRIRASRFFNNRDAGGERPDYLVELIAFGIILIAVTLSLGHAITTTLR* |
| Ga0137366_102698472 | 3300012354 | Vadose Zone Soil | MKTTNPLRICASRFFSNRYANRERPDYLVELVAFGIILIAVTLSLANATVTH* |
| Ga0137396_100781703 | 3300012918 | Vadose Zone Soil | VKTTDSLRIRASHFFRNRSACKERPDSLVELVAFGIIIIAVALSLG* |
| Ga0164299_102201994 | 3300012958 | Soil | MKTTESLRIRASHFFRNRSACKERPDSLVELIAFGIILIAVTLSLGNAVATTLR* |
| Ga0164301_103444484 | 3300012960 | Soil | KTTNPLRIRASRFVSNRYANRERPDYLVELVAFGIILIAVTLSLGNAVATTLR* |
| Ga0164302_118621871 | 3300012961 | Soil | MKTTNPLRIRASRFVSNRYANRERPDYLVELVAFGIIIIAVILSLGNAVATTLR* |
| Ga0134110_103406562 | 3300012975 | Grasslands Soil | MKTTNSLRIRASHFFRNRSAYTERPDSLVELVAFGIILIAVTLSLA |
| Ga0157369_125147062 | 3300013105 | Corn Rhizosphere | MKTTNSLRSRASHFFSDRYACRERPDSLVELIAFGIILI |
| Ga0134078_106585422 | 3300014157 | Grasslands Soil | NMKTTNSLRIRASHFFRNRSAYTERPDSLVELVAFGIILIAVTLSLANAMATH* |
| Ga0157376_101151351 | 3300014969 | Miscanthus Rhizosphere | MKTKTSLRVRASHFFRNRSACEDRPDYLIELVAFGIIVIA |
| Ga0132258_106682474 | 3300015371 | Arabidopsis Rhizosphere | MKTTNSLRSRASHFFSDRYRCRERPDNLVELIAFGIILIAVALSLGNPITTTLR* |
| Ga0132256_1000068931 | 3300015372 | Arabidopsis Rhizosphere | MKATNPLRICASRFFSNRYANRERPNYLVELVAFGIIVIAVILSL |
| Ga0132256_1016630461 | 3300015372 | Arabidopsis Rhizosphere | NRHLISERSNVNVKTTNSLRSSASRFFRNRSAYTERPDSLVELVAFGIILIAVTLSLANAMATH* |
| Ga0182036_100165144 | 3300016270 | Soil | MEPTTSLRSRASRFFKKRYAYRERPDYLIELVAFGIIVITVILSLANAMTA |
| Ga0182033_100261635 | 3300016319 | Soil | MKTTNSLRSRASHFFSNRYACRERPDSLVELIAFGIVLIAVTVSLGNAITTTLR |
| Ga0182033_103710911 | 3300016319 | Soil | ASHFFSSRYANRERPDYLVELVVFGIILIAVTLSLANATAHALR |
| Ga0182033_106608071 | 3300016319 | Soil | MKTTNSLRSRASHFFSNRRAYTEQPDSLIELVAFGIILIAVTLSLANAMTTH |
| Ga0182034_109635963 | 3300016371 | Soil | MKITNSLRSRASHFFSNRYACRERPDSLVELIAFGIVLIAVTLSLGNAVTTTLR |
| Ga0182038_104190841 | 3300016445 | Soil | MEPTTSLRSRASRFFKKRYAYRERPDYLIELVAFGIIVITVILSLANAMT |
| Ga0184619_100439724 | 3300018061 | Groundwater Sediment | MKTTNSLRVRVSRFFSDRYTYREGPDNLIELVAFGIIVITAALSLANAMTT |
| Ga0066667_104180662 | 3300018433 | Grasslands Soil | MKTTNSLRIRASRFFNNRDAGGERPDYLVELIAFGIILIAVTLSLGHAITTTLR |
| Ga0193725_10102151 | 3300019883 | Soil | VKTTNSLRIRASHFFRNRYACTERPDYLVELVAFGIIAIAVTLSLGNAMAITLR |
| Ga0126371_108521591 | 3300021560 | Tropical Forest Soil | MKTTNSLRSRASHFFSSGYANKERPVHLIELVALGIILIAVTLSLANATATH |
| Ga0207697_101343251 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTTNSLRIGASRFFRKRSAYRERPDYLVELVAFG |
| Ga0207671_112791051 | 3300025914 | Corn Rhizosphere | TNPLRICASRFFSNRYANRERPDYLVELVAFGIIVIAVTLSLR |
| Ga0207701_100041024 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTTNSLRSRASHFFSDRYACRERPDSLVELIAFGIILIAVTLSLGNAITTTLR |
| Ga0207701_100597477 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTTNPLWIRASRFFSNRWAYRERPDYLVELVAFGIILIAVTLSLGNTVAMTFR |
| Ga0207701_112127761 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGNVNMKTTNPLRICASRFFSNRHPNRERPDYLIELVAFGIILIAVALSLGSAAA |
| Ga0207665_106001541 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATNPLRICASRFFNNRYANRERPDYLVELVAFGIIM |
| Ga0207661_117461081 | 3300025944 | Corn Rhizosphere | TVNMKTTNSLRVRAFRFFSDRYNYREGPDNLIELVAFGIIVITAALSLANAMTTTLK |
| Ga0207708_106975391 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VKGNVNMKATNPLRIGASRFFSNRYANRERPEYLVELVALGIIVIAVNL |
| Ga0207675_1022694963 | 3300026118 | Switchgrass Rhizosphere | GNVNMKATNPLRICASRFFSNRYANRERPDYLVELVAFGIIVIAVTLSLR |
| Ga0209156_103167923 | 3300026547 | Soil | MKTTNSLRIRASRFFNNRDAGGERPDYLVELIAFGIILIAVTLSLGHAITTTL |
| Ga0209474_100111669 | 3300026550 | Soil | MKTTNSLRIRASRFFNNRDAGGERPDYLVELIAFGIILIAVTLSLGHAITTALR |
| Ga0207624_1001552 | 3300027453 | Soil | MNMETTNPLLVRVSRFFSDRYTYREGPDNLIELVAFGIIVITTALSLANAMTTTLK |
| Ga0075394_115619861 | 3300030969 | Soil | RHLISERSNVNMKTTNWLRSRASHFFSDRHAYRERPDSLVELVAFGIILIAVTLSLANATATH |
| Ga0170824_1210940042 | 3300031231 | Forest Soil | MKITNSLRSRASHFFSDRRAYTERPDSLVELVAFGIILIAVTLSLANATATH |
| Ga0170824_1255883151 | 3300031231 | Forest Soil | MKTTNWLRSRASHFFSDRHAYRERPDSLVELVAFGIILIAVTLSLANAMTTH |
| Ga0310915_110566511 | 3300031573 | Soil | MKTTNSLRSRASHFFSNRSANRERPDYLVELVAFGIILIAVTLSL |
| Ga0306917_100509014 | 3300031719 | Soil | VKTTNSLRSRASHFFSSRYANRERPDYLVELVAFGIILIAVTLSLANAMTTH |
| Ga0306918_102826241 | 3300031744 | Soil | MKPTTSPRSRASRFFKERYAYRERPDYLTELVAFGIIVITVILSLA |
| Ga0318543_105630581 | 3300031777 | Soil | MEPTTSLRSRASRFFKERYAYRERPDYLIELVAFGNNRNHRSC |
| Ga0306925_103538713 | 3300031890 | Soil | MKTTNSLRSRVSRFFSNGYTSRERPDSLVELVAFGIILIAVALSLATR |
| Ga0306923_101490981 | 3300031910 | Soil | MKTTNSLRSRASHFFSDRYACRERPDSLVELIAFGIILIAVTVSLGNAITTTLR |
| Ga0308175_1019571211 | 3300031938 | Soil | MKTTNSLRSRASHFFSDRYACRERPDNLVELIAFGIILIAVTLSLGHAITTTLR |
| Ga0310912_100464625 | 3300031941 | Soil | MKPTTSPRSRASRFFKERYAYRERPDYLTELVAFGIIVITVILSLANAMTATLK |
| Ga0310912_110515361 | 3300031941 | Soil | MKTTNSLRSRASHFFSDRYACRERPDSLVELIAFGIVLIAVTVSLGNAITTTLR |
| Ga0310909_109436622 | 3300031947 | Soil | MKSSSHCERSNVNVKTTKSLRSRASHFFSSRYANRERPDYLVELVAFGIILIAVTLSLANATAHALR |
| Ga0306926_104916734 | 3300031954 | Soil | MKTTNSLRSRVSRFFSNGYTSRERPDSLVELVAFGIILIAVTLSLANAMTTH |
| Ga0318514_107643711 | 3300032066 | Soil | MKTTNSLRSRASHFFRNRSAYTERPDSLIELVAFGIILIAVT |
| Ga0307472_1022820432 | 3300032205 | Hardwood Forest Soil | VKNTNSLRIRASRFFSNRYAYKERPDYLVELVAFGIIVIAVALSLGNAMEITLR |
| Ga0306920_1011747101 | 3300032261 | Soil | LRSRASHFFSSRYANRERPAHLVELVAFGIILIAVTLSLANATAHALR |
| Ga0310914_102415302 | 3300033289 | Soil | MKTTNSLRSRASHFFSNRYACRERPDSLVELIAFGIILIAVTVSLGNAITTTLR |
| Ga0310810_113723871 | 3300033412 | Soil | TTNSLRSRASHFFSDRSACTERPDYLVELVAFGIILIAVTLSLANAMTTH |
| ⦗Top⦘ |