| Basic Information | |
|---|---|
| Family ID | F087574 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSALPPKADIGTQSWNVRFVPKADILRCGKERRYSITSS |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 54.90 % |
| % of genes near scaffold ends (potentially truncated) | 87.27 % |
| % of genes from short scaffolds (< 2000 bps) | 84.55 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (42.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 17.27 |
| PF03401 | TctC | 4.55 |
| PF08238 | Sel1 | 2.73 |
| PF00561 | Abhydrolase_1 | 1.82 |
| PF12697 | Abhydrolase_6 | 1.82 |
| PF13531 | SBP_bac_11 | 1.82 |
| PF13417 | GST_N_3 | 1.82 |
| PF00211 | Guanylate_cyc | 1.82 |
| PF00072 | Response_reg | 1.82 |
| PF13414 | TPR_11 | 0.91 |
| PF13328 | HD_4 | 0.91 |
| PF08448 | PAS_4 | 0.91 |
| PF13460 | NAD_binding_10 | 0.91 |
| PF13416 | SBP_bac_8 | 0.91 |
| PF04828 | GFA | 0.91 |
| PF01965 | DJ-1_PfpI | 0.91 |
| PF10282 | Lactonase | 0.91 |
| PF02746 | MR_MLE_N | 0.91 |
| PF08240 | ADH_N | 0.91 |
| PF08734 | GYD | 0.91 |
| PF01047 | MarR | 0.91 |
| PF14087 | DUF4267 | 0.91 |
| PF03466 | LysR_substrate | 0.91 |
| PF13185 | GAF_2 | 0.91 |
| PF03354 | TerL_ATPase | 0.91 |
| PF03237 | Terminase_6N | 0.91 |
| PF01494 | FAD_binding_3 | 0.91 |
| PF00676 | E1_dh | 0.91 |
| PF00043 | GST_C | 0.91 |
| PF14659 | Phage_int_SAM_3 | 0.91 |
| PF00156 | Pribosyltran | 0.91 |
| PF00903 | Glyoxalase | 0.91 |
| PF14417 | MEDS | 0.91 |
| PF04120 | Iron_permease | 0.91 |
| PF13857 | Ank_5 | 0.91 |
| PF13847 | Methyltransf_31 | 0.91 |
| PF00149 | Metallophos | 0.91 |
| PF00196 | GerE | 0.91 |
| PF02627 | CMD | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 17.27 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.55 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.82 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.82 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.91 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.91 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.91 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.91 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.91 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.91 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.91 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.91 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.91 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.73 % |
| Unclassified | root | N/A | 37.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10166599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 894 | Open in IMG/M |
| 3300005764|Ga0066903_101121268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1452 | Open in IMG/M |
| 3300005764|Ga0066903_101888138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1144 | Open in IMG/M |
| 3300005764|Ga0066903_104234952 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005764|Ga0066903_107583383 | Not Available | 559 | Open in IMG/M |
| 3300006086|Ga0075019_10811542 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006175|Ga0070712_100349336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1210 | Open in IMG/M |
| 3300006804|Ga0079221_10272950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 975 | Open in IMG/M |
| 3300009792|Ga0126374_11641845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300010048|Ga0126373_10223894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1837 | Open in IMG/M |
| 3300010358|Ga0126370_10129936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1801 | Open in IMG/M |
| 3300010360|Ga0126372_10347838 | Not Available | 1328 | Open in IMG/M |
| 3300010360|Ga0126372_11799257 | Not Available | 656 | Open in IMG/M |
| 3300010366|Ga0126379_10796426 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300010376|Ga0126381_100550175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1635 | Open in IMG/M |
| 3300010398|Ga0126383_12381694 | Not Available | 615 | Open in IMG/M |
| 3300010398|Ga0126383_12791854 | Not Available | 570 | Open in IMG/M |
| 3300012948|Ga0126375_11829752 | Not Available | 531 | Open in IMG/M |
| 3300012971|Ga0126369_10144577 | Not Available | 2227 | Open in IMG/M |
| 3300016270|Ga0182036_10235627 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300016270|Ga0182036_11228543 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300016270|Ga0182036_11270570 | Not Available | 614 | Open in IMG/M |
| 3300016270|Ga0182036_11483418 | Not Available | 569 | Open in IMG/M |
| 3300016270|Ga0182036_11646489 | Not Available | 541 | Open in IMG/M |
| 3300016294|Ga0182041_10066548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2514 | Open in IMG/M |
| 3300016294|Ga0182041_11008730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300016319|Ga0182033_10878607 | Not Available | 793 | Open in IMG/M |
| 3300016341|Ga0182035_10091909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2199 | Open in IMG/M |
| 3300016357|Ga0182032_10083976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 2198 | Open in IMG/M |
| 3300016357|Ga0182032_10683647 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300016357|Ga0182032_10951535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300016357|Ga0182032_11407687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300016371|Ga0182034_11942933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300016387|Ga0182040_10412024 | Not Available | 1063 | Open in IMG/M |
| 3300016387|Ga0182040_11967071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300016404|Ga0182037_10945350 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300016404|Ga0182037_11336934 | Not Available | 632 | Open in IMG/M |
| 3300016404|Ga0182037_12011602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300016422|Ga0182039_10468429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300016445|Ga0182038_10267714 | Not Available | 1382 | Open in IMG/M |
| 3300016445|Ga0182038_11642682 | Not Available | 578 | Open in IMG/M |
| 3300016445|Ga0182038_12163724 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018060|Ga0187765_10378134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 869 | Open in IMG/M |
| 3300021181|Ga0210388_10467000 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300021560|Ga0126371_10708111 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300021560|Ga0126371_11193696 | Not Available | 898 | Open in IMG/M |
| 3300021560|Ga0126371_13487285 | Not Available | 531 | Open in IMG/M |
| 3300025916|Ga0207663_11077092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300027680|Ga0207826_1067193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → unclassified Bauldia → Bauldia sp. | 988 | Open in IMG/M |
| 3300027703|Ga0207862_1135546 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031231|Ga0170824_106352106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
| 3300031446|Ga0170820_17501138 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300031545|Ga0318541_10504267 | Not Available | 677 | Open in IMG/M |
| 3300031573|Ga0310915_10755380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300031573|Ga0310915_11146760 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031681|Ga0318572_10166343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1279 | Open in IMG/M |
| 3300031681|Ga0318572_10889688 | Not Available | 529 | Open in IMG/M |
| 3300031719|Ga0306917_10014863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4615 | Open in IMG/M |
| 3300031719|Ga0306917_10363010 | Not Available | 1127 | Open in IMG/M |
| 3300031719|Ga0306917_10415731 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300031723|Ga0318493_10388451 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031764|Ga0318535_10254801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031765|Ga0318554_10017668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3678 | Open in IMG/M |
| 3300031771|Ga0318546_10830792 | Not Available | 650 | Open in IMG/M |
| 3300031793|Ga0318548_10411502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300031796|Ga0318576_10243208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 849 | Open in IMG/M |
| 3300031798|Ga0318523_10658075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 515 | Open in IMG/M |
| 3300031833|Ga0310917_10039955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2828 | Open in IMG/M |
| 3300031833|Ga0310917_11039469 | Not Available | 548 | Open in IMG/M |
| 3300031835|Ga0318517_10451589 | Not Available | 580 | Open in IMG/M |
| 3300031859|Ga0318527_10076111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1352 | Open in IMG/M |
| 3300031879|Ga0306919_10589246 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031890|Ga0306925_10800291 | Not Available | 978 | Open in IMG/M |
| 3300031897|Ga0318520_10591933 | Not Available | 689 | Open in IMG/M |
| 3300031910|Ga0306923_10478454 | Not Available | 1410 | Open in IMG/M |
| 3300031910|Ga0306923_10536358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1320 | Open in IMG/M |
| 3300031910|Ga0306923_11541308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300031910|Ga0306923_12308419 | Not Available | 536 | Open in IMG/M |
| 3300031912|Ga0306921_10166876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2578 | Open in IMG/M |
| 3300031941|Ga0310912_10124809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1921 | Open in IMG/M |
| 3300031941|Ga0310912_10317153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1208 | Open in IMG/M |
| 3300031941|Ga0310912_10823953 | Not Available | 716 | Open in IMG/M |
| 3300031942|Ga0310916_10613361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
| 3300031942|Ga0310916_10780298 | Not Available | 806 | Open in IMG/M |
| 3300031945|Ga0310913_10298025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1137 | Open in IMG/M |
| 3300031947|Ga0310909_10548203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300031954|Ga0306926_10546396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1419 | Open in IMG/M |
| 3300032001|Ga0306922_10445949 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300032001|Ga0306922_11461081 | Not Available | 685 | Open in IMG/M |
| 3300032001|Ga0306922_12244090 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032035|Ga0310911_10084898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1713 | Open in IMG/M |
| 3300032076|Ga0306924_10502108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1381 | Open in IMG/M |
| 3300032261|Ga0306920_100086271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4627 | Open in IMG/M |
| 3300032261|Ga0306920_102811145 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300032261|Ga0306920_103935391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300032261|Ga0306920_104186331 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300032261|Ga0306920_104351159 | Not Available | 508 | Open in IMG/M |
| 3300033289|Ga0310914_10290490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Paracoccus → Paracoccus salipaludis | 1473 | Open in IMG/M |
| 3300033289|Ga0310914_10606953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 986 | Open in IMG/M |
| 3300033289|Ga0310914_11077566 | Not Available | 704 | Open in IMG/M |
| 3300033289|Ga0310914_11324924 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300033290|Ga0318519_11018831 | Not Available | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 42.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_101665991 | 3300001867 | Forest Soil | MFALPPKADIAECDRDVRFVPKADERQCGKQRAYSITSSAATSMVFGTSSA |
| Ga0066903_1011212683 | 3300005764 | Tropical Forest Soil | MSALPPKADIGTQSRDVRFVPKADILHCSIERRYSI |
| Ga0066903_1018881381 | 3300005764 | Tropical Forest Soil | MMSALPPKADIGTQSRNVRFVPKADILRCSEERRYSITSSAR |
| Ga0066903_1042349522 | 3300005764 | Tropical Forest Soil | MSALPPKADIAEQHWDVRFVPKADILRCGRDRPYSIT |
| Ga0066903_1066326903 | 3300005764 | Tropical Forest Soil | MSALPPKADIGTQPRDVRFVPKADIVRCGEIRRYSITSSARA |
| Ga0066903_1075833832 | 3300005764 | Tropical Forest Soil | MSALPPKADIAECERHVRFVPKADILRCGEERRYSITSSAAQVWAH* |
| Ga0075019_108115422 | 3300006086 | Watersheds | RPEISMSALPPKADMVHRGSNVRFVPKADILRCDRNYRY* |
| Ga0070712_1003493362 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALPPKADIAARRLNVRFVPKADILRCSKEHRYSITS |
| Ga0079221_102729503 | 3300006804 | Agricultural Soil | MFALPPKADIAECDRDVRFVPKADERQCGKQRAYSITSSAATS |
| Ga0126374_116418452 | 3300009792 | Tropical Forest Soil | MSALPPKADIETPSRHVRFVPKADILRCSEERRYSIAHRQS |
| Ga0126373_102238941 | 3300010048 | Tropical Forest Soil | KADIGEACRDVRFVPKADILRCGKESITSSAQES* |
| Ga0126370_101299363 | 3300010358 | Tropical Forest Soil | MSALPPKADIGTPSRNVRFVPKADILRCGRTCHYSITSSARAISDGG |
| Ga0126372_103478381 | 3300010360 | Tropical Forest Soil | MSALPPKADIGTRSLNVRFVPKADILRCGIERRYSITSSA |
| Ga0126372_117992572 | 3300010360 | Tropical Forest Soil | MSALPPKADIVERDGHVRFVPQADILHCGRDRRYSMT |
| Ga0126379_107964263 | 3300010366 | Tropical Forest Soil | MSALHPKADIHRRERHVRFVPKADILRCGKERRYSITSSAQES* |
| Ga0126381_1005501753 | 3300010376 | Tropical Forest Soil | MFLGRALMSALPPKADIAERDCHVRFVPKADILRCSKERRYSI |
| Ga0126383_123816942 | 3300010398 | Tropical Forest Soil | MSALPPKADIAEHCRDVCFVPKADILRCSEDRPYSI |
| Ga0126383_127918541 | 3300010398 | Tropical Forest Soil | MSALPPIADIRAEEIDVRFVPKADILRCGKNRRYSITSSARAS |
| Ga0126375_118297522 | 3300012948 | Tropical Forest Soil | MSALPSKADITAAQTNVRFVPKADILRCSKEHRYSMTTSAAT |
| Ga0126369_101445773 | 3300012971 | Tropical Forest Soil | MSALPPKADIGAQSWNVRFVPKADILRCSKERRYSI |
| Ga0182036_102356271 | 3300016270 | Soil | MSAIPPKADIDRACWDVRFVPKADILRCGIERRYSI |
| Ga0182036_112285431 | 3300016270 | Soil | MNVCFWHKTDIPVALSNVRFGSKADILRCGKERRYSITSSA |
| Ga0182036_112705702 | 3300016270 | Soil | MSALPPKADIGTQPRDVRFVPKADILHCGKEVEVWAGR |
| Ga0182036_114834181 | 3300016270 | Soil | PKADIGRADCDVRFVPKADIPRCGKERRYSIALPAAQA |
| Ga0182036_116464891 | 3300016270 | Soil | MSALPPKADIGTQPRNVRFVPKADILRCGKERRYSMTL |
| Ga0182041_100665481 | 3300016294 | Soil | MSALPPKADIAERDRHVRFVPKADILHCGRDRRYS |
| Ga0182041_110087301 | 3300016294 | Soil | MMSALPPKADIRRRYSEVRFVPKADILRCSEERRCSI |
| Ga0182033_108786072 | 3300016319 | Soil | SALPPKADIAERDRHVRFAPKADILRCGTDRFGPVGDI |
| Ga0182033_111778242 | 3300016319 | Soil | MSALPPKADIAESDWHVRFVPKADILRRIEERPSSI |
| Ga0182035_100919091 | 3300016341 | Soil | MSALPPEADIRSECRDVRFVPKADILRCGKERRYSIT |
| Ga0182035_102253731 | 3300016341 | Soil | MSALPPKADIAESDWHVRFVPKADILRRIEERRSSIASP |
| Ga0182032_100839763 | 3300016357 | Soil | LMGVRPMSAILPKADIGSACRDVCFVPKADILRCGRERRYSITSSAVN |
| Ga0182032_106836471 | 3300016357 | Soil | MSALPPKADIEIQPRNVRFVPKADILRCGRDLRYSVTSSAMAS |
| Ga0182032_109515351 | 3300016357 | Soil | MSALPPKADIGTQARNVRFVPKADILRCGRDWRYSIT |
| Ga0182032_114076871 | 3300016357 | Soil | MSALPPKADISCSLGDVRFVPKADILRCGKERRYSITSSA |
| Ga0182034_119429331 | 3300016371 | Soil | MSALPPKADITERDRHVRFVPKADILQCSEERRYSITSSAVARRRRHCQ |
| Ga0182040_104120241 | 3300016387 | Soil | MSALPPKADIAESDCHVRFVPKADILRSNQQPRSITPSALR |
| Ga0182040_119670711 | 3300016387 | Soil | MSALPPKADIAQRSGNVRFVPKADILRCGKERRYSITSSA |
| Ga0182037_109453501 | 3300016404 | Soil | MSALPPKADIGTHPRNVRFVPKADILRCGKERRYSITS |
| Ga0182037_113369342 | 3300016404 | Soil | MSALPLIADMCSAQANVRFVPKADILQCGKERRYSITSSANRK |
| Ga0182037_120116021 | 3300016404 | Soil | MSAFPPKADIGTHSRDVCFVPKADILHCSIERRYSITSS |
| Ga0182039_104684292 | 3300016422 | Soil | MSALPPKADIGTQPRNVRFVPKADILHCGGDWRYSMTSLVE |
| Ga0182038_102677141 | 3300016445 | Soil | MSALPPKADITAALTNVRFVPKADILHCGRDCYSITSSARV |
| Ga0182038_116426821 | 3300016445 | Soil | MSALPPKADIGTHPRDVRFVPKADIPSLYSITSSAVAWSDGGTLRLRAL |
| Ga0182038_121637241 | 3300016445 | Soil | MSALPPKADIRRHECDVRFVPKADILRCSIERRYSITSSAVARTVCG |
| Ga0187765_103781342 | 3300018060 | Tropical Peatland | MSAFAPKADMERHDRDVRYVPKADIFRCGKERRYSITSSARASTAADI |
| Ga0210388_104670003 | 3300021181 | Soil | MSALHSIADIAESDRDVRFVPKADILRCNKERHYSITSSAMVRLF |
| Ga0126371_107081111 | 3300021560 | Tropical Forest Soil | MSALPPKADIETSSCDVRFVPKADILRRGKERRYSITSSAVA |
| Ga0126371_111936961 | 3300021560 | Tropical Forest Soil | MSALHPKADIHRRERHVRFVPKADILRCGKERRYSITSSAQES |
| Ga0126371_134872851 | 3300021560 | Tropical Forest Soil | VSSLASMSALPPKADIGTQSWNVRFVPKADIPRCGKERRYSITSSA |
| Ga0207663_110770922 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALPLKADIVSRICHVRFVPKPDQVRRNKEYRYSITSSAVA |
| Ga0207826_10671933 | 3300027680 | Tropical Forest Soil | MLGNVVRLMSALPPKADMVQRCRDVRFVPKADILRCGKER |
| Ga0207862_11355462 | 3300027703 | Tropical Forest Soil | MSALPPKADIAERRCHVRFVPKADILRCGRDCYSITSSAVESSF |
| Ga0170824_1063521061 | 3300031231 | Forest Soil | MSALPPKADIRPRDQGVCFGPKADILRCGKERRYS |
| Ga0170820_175011382 | 3300031446 | Forest Soil | MSALSPKADIAEHAYDVRFVPKADILHCGKERRYSITSSARSS |
| Ga0318541_105042672 | 3300031545 | Soil | MSALPPKADIGTQPRNVRFVPKADILRCGGWRYSMTSSAVASS |
| Ga0310915_107553802 | 3300031573 | Soil | MSALPPKADITERDRHVRFVPKADILQCSEERRYSITSSAVARRRRHCQV |
| Ga0310915_111467601 | 3300031573 | Soil | MSALPPKADIETQSRNVRFVPKADILRCSEERRYSITS |
| Ga0310915_111903521 | 3300031573 | Soil | MSALPPKADIAESDWHVRFVPKADILRRIEERQSSIASPTAQ |
| Ga0318572_101663431 | 3300031681 | Soil | MSALPPKADIGTQSGNVCFVPKADILRCGKERRYSITSSARPDNGSG |
| Ga0318572_108896881 | 3300031681 | Soil | MSALPPKADIGLAGRDVRFVPKADILRCSKKCRYSITSSARASSM |
| Ga0306917_100148632 | 3300031719 | Soil | MSAIHPKADMEEYSSNVRFVPKADILRCGRDRRYSIIS |
| Ga0306917_103630101 | 3300031719 | Soil | MSALPPKADIRRHECDVRFVPKADILHCGKERRLFD |
| Ga0306917_104157311 | 3300031719 | Soil | MSALPPKADIGTHPRNVRFVPKADILRCGKERRYSITSPASSDCGTVSP |
| Ga0318493_103884512 | 3300031723 | Soil | MSALPPKADIAERECHVRFVPKADILRCGRDWRYSITSSAATSIDCG |
| Ga0318535_102548011 | 3300031764 | Soil | ILVMSALPPKADIDQDGCNVRFVPEADILRRNKERRYSITSSAR |
| Ga0318554_100176685 | 3300031765 | Soil | MSALPPKADIGTQSWNVRFVPKADILRRSNFRRYSITSSA |
| Ga0318546_108307921 | 3300031771 | Soil | MSAFPKADIGRADCDVRFVPKADIPRCGKERRYSIALPAAQA |
| Ga0318548_104115021 | 3300031793 | Soil | MSALPPKADIGTHPRNVRFVPKADILRCGKERRYSITSPASSDCGTV |
| Ga0318576_102432081 | 3300031796 | Soil | MSALPPKADIGTQSHDVRYVPKANILRCGRDWRYSITSSPR |
| Ga0318523_106580751 | 3300031798 | Soil | SEHVQSMSALLPKADIAERHRHVRFVPKADILRCGKKRRYSIALRAVQAWVHRPMLS |
| Ga0310917_100399551 | 3300031833 | Soil | MSALPPKADIGTQSRNVRFVPKADILRCSEERRYSITSSASNCMELGT |
| Ga0310917_110394691 | 3300031833 | Soil | MSALPPKADIGTQPRDVCFVPKADILRCGKERRYS |
| Ga0318517_104515891 | 3300031835 | Soil | MSALPPKADIAESDWHVRFVPKADILHCGRDCYSIT |
| Ga0318527_100761113 | 3300031859 | Soil | MSALPPKADIDHDGRDVRFVPKADILRCSKKRPYSITSSARASN |
| Ga0306919_105892461 | 3300031879 | Soil | MSALPPKADIGTQSRNVRFVPKADILRRSKERRYS |
| Ga0306925_108002911 | 3300031890 | Soil | MSALPPKADITAAQTNVRFVPKADILHRGKERRYSITSPAVMISDCGID |
| Ga0318520_105919332 | 3300031897 | Soil | MSALPPKADMDQHRCDVCFVPKADILRCGKERRYSITSS |
| Ga0306923_104784542 | 3300031910 | Soil | MSALPPKADITAAQTNVRFVPKADILHRGKERRYSITSPAVMISDCGI |
| Ga0306923_105363582 | 3300031910 | Soil | MSALPPKADIGTQSWNVRFVPKADILRCGKERRYSI |
| Ga0306923_115413081 | 3300031910 | Soil | MSALPPKADIGTQSRNVRFVPKADILRCNKGRRYSIISSARIM |
| Ga0306923_123084191 | 3300031910 | Soil | MSALPPKADIGTQSLNVCVPKADILRCSKERRYSG |
| Ga0306921_101668764 | 3300031912 | Soil | MSALPPKADMDQHRCDVCFVPKADILRCGKERRYSITSSAIESSF |
| Ga0310912_101248091 | 3300031941 | Soil | MSALPPKAEIGTQPRNVHFVPKADILRCGKERRYSI |
| Ga0310912_103171531 | 3300031941 | Soil | MSAFPKADIGRADCDVRFVPKADIPRCGKERRYSIA |
| Ga0310912_108239532 | 3300031941 | Soil | MSALPPKADITAAQTNVRFVPKADILHRGKERRYSITSPA |
| Ga0310916_106133611 | 3300031942 | Soil | MSALPPKADIGTQSRDVRFVPKADILRRGKECRYSITSSASA |
| Ga0310916_107802982 | 3300031942 | Soil | MSALPPKADTADAMRNARFVPKAHILHCGRDCHYSITSSAIE |
| Ga0310913_102980251 | 3300031945 | Soil | MSALPPKADIGTQPRDVRFVPKADILQRSKKHRYSITLSARSRIAVGS |
| Ga0310909_105482032 | 3300031947 | Soil | MNQSGCDVHFVPKADILRCGKERRYSITSSAVESSFGGTV |
| Ga0306926_105463961 | 3300031954 | Soil | MSALPPKADIGTQSWNVRFVPKADILRRSNFRRYSITSSAR |
| Ga0306926_121608641 | 3300031954 | Soil | MSALPPKADIGTQSWNVRFVPKADIVRCGEIPRHSITSFGDSEE |
| Ga0306922_104459492 | 3300032001 | Soil | MSALPPKADIRYGNRHVRFVPKADILRCGKERRYSITSSAATS |
| Ga0306922_114610811 | 3300032001 | Soil | MSALPSKADIETQSRNVRFVPKADILRCGDWRYSMTSS |
| Ga0306922_122440902 | 3300032001 | Soil | MSALPPKADIGTQPRDVRFVPKADIPRCSEERRYSITSPAV |
| Ga0310911_100848983 | 3300032035 | Soil | MSALPPKADMDQHRCDVCFVPKADILRCGKERRYSITSSAIESSFGG |
| Ga0318549_102087401 | 3300032041 | Soil | MSALPPKADIAEGHWHVRFVPKADIIQLGKRAYSITSPAG |
| Ga0318545_102237652 | 3300032042 | Soil | MSALPPKADIGTQSWNVRFVPKADIVRCGEIRRYSITSSA |
| Ga0306924_105021081 | 3300032076 | Soil | MSALPPKADITAVQTNVRFVPKADILHCGRDCYSIT |
| Ga0306920_1000862712 | 3300032261 | Soil | MSALPPKADIGTQPRNVRFVPKADILHCGKERRYSITSSAAC |
| Ga0306920_1006471813 | 3300032261 | Soil | MSALPPKADIETQSRDVRFVPKADIPRCGKERRYSITSSASNCIEVGT |
| Ga0306920_1028111451 | 3300032261 | Soil | MSALPPKADIVECDRHVRYVPKADILHCGRDCYSITSSARTSTCIGI |
| Ga0306920_1039353912 | 3300032261 | Soil | MSALPPKADMDQSSRDVRFVPKADILRCSKERRYSITPSAMGS |
| Ga0306920_1041863311 | 3300032261 | Soil | MSALPPKADIGTQPRDVRFVPKADILHCGKERRYSITSSA |
| Ga0306920_1043511591 | 3300032261 | Soil | MSALPPKADIGTQPRDVRFVPKADILRCGRDWRYSITSSALV |
| Ga0310914_102904905 | 3300033289 | Soil | MSALPPKADIGTQSWNVRFVPKADILRRSNFRRYSITS |
| Ga0310914_106069533 | 3300033289 | Soil | MSALPPKADIGTQSWNVRFVPKADILRCGKERRYSITSS |
| Ga0310914_110775663 | 3300033289 | Soil | MSALPPKADIGTQPRNVRFVPKADILHCGKERRYSIT |
| Ga0310914_113249241 | 3300033289 | Soil | MSALPPKADMVRRGRDVRFVPKADILHCSKERRYSITSSAATW |
| Ga0318519_110188311 | 3300033290 | Soil | MSAIPPKADIGTQPRNVRFVPKADILRCGKERRYSMTLSAR |
| ⦗Top⦘ |