| Basic Information | |
|---|---|
| Family ID | F087573 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VFTVEQRDALREHVLQLAEEDERVVAGAAVGSLAVDG |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.91 % |
| % of genes near scaffold ends (potentially truncated) | 97.27 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.455 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF03358 | FMN_red | 3.64 |
| PF00999 | Na_H_Exchanger | 3.64 |
| PF00072 | Response_reg | 2.73 |
| PF01872 | RibD_C | 2.73 |
| PF13602 | ADH_zinc_N_2 | 1.82 |
| PF00486 | Trans_reg_C | 1.82 |
| PF00211 | Guanylate_cyc | 1.82 |
| PF00208 | ELFV_dehydrog | 1.82 |
| PF00480 | ROK | 0.91 |
| PF00672 | HAMP | 0.91 |
| PF02735 | Ku | 0.91 |
| PF00701 | DHDPS | 0.91 |
| PF10137 | TIR-like | 0.91 |
| PF00464 | SHMT | 0.91 |
| PF01381 | HTH_3 | 0.91 |
| PF13460 | NAD_binding_10 | 0.91 |
| PF06305 | LapA_dom | 0.91 |
| PF13540 | RCC1_2 | 0.91 |
| PF13358 | DDE_3 | 0.91 |
| PF12681 | Glyoxalase_2 | 0.91 |
| PF13417 | GST_N_3 | 0.91 |
| PF01699 | Na_Ca_ex | 0.91 |
| PF07730 | HisKA_3 | 0.91 |
| PF07690 | MFS_1 | 0.91 |
| PF00724 | Oxidored_FMN | 0.91 |
| PF13399 | LytR_C | 0.91 |
| PF05103 | DivIVA | 0.91 |
| PF07040 | DUF1326 | 0.91 |
| PF02646 | RmuC | 0.91 |
| PF12228 | DUF3604 | 0.91 |
| PF01195 | Pept_tRNA_hydro | 0.91 |
| PF03795 | YCII | 0.91 |
| PF01979 | Amidohydro_1 | 0.91 |
| PF00583 | Acetyltransf_1 | 0.91 |
| PF08281 | Sigma70_r4_2 | 0.91 |
| PF04075 | F420H2_quin_red | 0.91 |
| PF05977 | MFS_3 | 0.91 |
| PF01042 | Ribonuc_L-PSP | 0.91 |
| PF01636 | APH | 0.91 |
| PF04140 | ICMT | 0.91 |
| PF12833 | HTH_18 | 0.91 |
| PF06831 | H2TH | 0.91 |
| PF02633 | Creatininase | 0.91 |
| PF09900 | DUF2127 | 0.91 |
| PF08818 | DUF1801 | 0.91 |
| PF04069 | OpuAC | 0.91 |
| PF09754 | PAC2 | 0.91 |
| PF00378 | ECH_1 | 0.91 |
| PF12706 | Lactamase_B_2 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 3.64 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 3.64 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 3.64 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 3.64 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 3.64 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.73 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.73 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 1.82 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.82 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.82 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 1.82 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.91 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.91 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.91 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.91 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.91 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.91 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.91 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.91 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.91 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.91 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.91 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.91 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.91 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.91 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.91 |
| COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.91 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.91 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.45 % |
| Unclassified | root | N/A | 14.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig1194461 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300003998|Ga0055472_10008364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1936 | Open in IMG/M |
| 3300004081|Ga0063454_101273645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300004157|Ga0062590_101227342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300005177|Ga0066690_10356890 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005178|Ga0066688_10239640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1159 | Open in IMG/M |
| 3300005181|Ga0066678_10753217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300005344|Ga0070661_100826367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300005436|Ga0070713_101153052 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005436|Ga0070713_101286193 | Not Available | 709 | Open in IMG/M |
| 3300005445|Ga0070708_102229072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300005467|Ga0070706_101987977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300005468|Ga0070707_101687139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300005526|Ga0073909_10042750 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300005566|Ga0066693_10236513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 720 | Open in IMG/M |
| 3300005577|Ga0068857_101587843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300005586|Ga0066691_10225975 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300005617|Ga0068859_101166287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
| 3300005719|Ga0068861_100544248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1057 | Open in IMG/M |
| 3300005937|Ga0081455_10812853 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006032|Ga0066696_10146036 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300006034|Ga0066656_10812813 | Not Available | 599 | Open in IMG/M |
| 3300006175|Ga0070712_100352613 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300006797|Ga0066659_11077506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 671 | Open in IMG/M |
| 3300006903|Ga0075426_11524535 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006904|Ga0075424_101948460 | Not Available | 620 | Open in IMG/M |
| 3300006914|Ga0075436_100112799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1898 | Open in IMG/M |
| 3300006918|Ga0079216_11068318 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006954|Ga0079219_10982462 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300007076|Ga0075435_101369419 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300007255|Ga0099791_10229453 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300009012|Ga0066710_102943019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300009090|Ga0099827_11642047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
| 3300009148|Ga0105243_10211755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1707 | Open in IMG/M |
| 3300009162|Ga0075423_10494010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1287 | Open in IMG/M |
| 3300009789|Ga0126307_10996635 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300009840|Ga0126313_10949830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300009873|Ga0131077_10160627 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
| 3300010036|Ga0126305_10475180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300010036|Ga0126305_10647067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300010045|Ga0126311_10438965 | Not Available | 1011 | Open in IMG/M |
| 3300010325|Ga0134064_10378785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
| 3300010337|Ga0134062_10766706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300012206|Ga0137380_10069084 | All Organisms → cellular organisms → Bacteria | 3231 | Open in IMG/M |
| 3300012208|Ga0137376_11462277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300012209|Ga0137379_10341638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1407 | Open in IMG/M |
| 3300012354|Ga0137366_10575092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 809 | Open in IMG/M |
| 3300012359|Ga0137385_11229267 | Not Available | 611 | Open in IMG/M |
| 3300012359|Ga0137385_11650202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300012497|Ga0157319_1008903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300012684|Ga0136614_10313882 | Not Available | 1160 | Open in IMG/M |
| 3300012925|Ga0137419_10118030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1867 | Open in IMG/M |
| 3300012957|Ga0164303_11125190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| 3300012975|Ga0134110_10187715 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012986|Ga0164304_11453322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
| 3300012989|Ga0164305_10433475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
| 3300014150|Ga0134081_10323266 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300015158|Ga0167622_1014643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1823 | Open in IMG/M |
| 3300015357|Ga0134072_10308946 | Not Available | 592 | Open in IMG/M |
| 3300015372|Ga0132256_102914510 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017787|Ga0183260_10465705 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300018028|Ga0184608_10354208 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300018061|Ga0184619_10288596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 753 | Open in IMG/M |
| 3300018067|Ga0184611_1040761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1522 | Open in IMG/M |
| 3300018433|Ga0066667_10081873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2083 | Open in IMG/M |
| 3300018466|Ga0190268_10953136 | Not Available | 676 | Open in IMG/M |
| 3300019361|Ga0173482_10641979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300019377|Ga0190264_10623191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 776 | Open in IMG/M |
| 3300019873|Ga0193700_1017188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1190 | Open in IMG/M |
| 3300019999|Ga0193718_1064962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 784 | Open in IMG/M |
| 3300021078|Ga0210381_10374168 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300022883|Ga0247786_1156235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300022893|Ga0247787_1076987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300025901|Ga0207688_10874697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300025905|Ga0207685_10029454 | Not Available | 1944 | Open in IMG/M |
| 3300025915|Ga0207693_10895991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300025972|Ga0207668_11881201 | Not Available | 540 | Open in IMG/M |
| 3300026035|Ga0207703_10632664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1014 | Open in IMG/M |
| 3300026095|Ga0207676_12379349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300026116|Ga0207674_11565924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 628 | Open in IMG/M |
| 3300026314|Ga0209268_1170079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
| 3300026536|Ga0209058_1245056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300026538|Ga0209056_10464421 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300026552|Ga0209577_10769081 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027842|Ga0209580_10572346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Amorphaceae → Acuticoccus → Acuticoccus sediminis | 561 | Open in IMG/M |
| 3300028587|Ga0247828_10412038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300028710|Ga0307322_10115325 | Not Available | 698 | Open in IMG/M |
| 3300028715|Ga0307313_10129923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300028716|Ga0307311_10132385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300028719|Ga0307301_10050927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300028719|Ga0307301_10118878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300028722|Ga0307319_10271159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 560 | Open in IMG/M |
| 3300028754|Ga0307297_10136634 | Not Available | 829 | Open in IMG/M |
| 3300028755|Ga0307316_10135985 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300028778|Ga0307288_10224387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300028790|Ga0307283_10101672 | Not Available | 752 | Open in IMG/M |
| 3300028793|Ga0307299_10019155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2450 | Open in IMG/M |
| 3300028810|Ga0307294_10105800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 896 | Open in IMG/M |
| 3300028819|Ga0307296_10787495 | Not Available | 518 | Open in IMG/M |
| 3300028828|Ga0307312_10062945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2240 | Open in IMG/M |
| 3300028828|Ga0307312_10217678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300028885|Ga0307304_10234242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300031954|Ga0306926_10701834 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300032017|Ga0310899_10420909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 644 | Open in IMG/M |
| 3300033181|Ga0272431_10305630 | Not Available | 785 | Open in IMG/M |
| 3300033417|Ga0214471_11413498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300033550|Ga0247829_10870005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 750 | Open in IMG/M |
| 3300033551|Ga0247830_10924949 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300034148|Ga0364927_0184616 | Not Available | 610 | Open in IMG/M |
| 3300034820|Ga0373959_0167739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.82% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.27% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.73% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.91% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300033181 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_06426570 | 2124908045 | Soil | VFTVEQRDALREGLLTRAQEDDRVVAAAVVGSLAVDAGDRYSD |
| Ga0055472_100083643 | 3300003998 | Natural And Restored Wetlands | LRGYDRLRMFTIEQRDALFDRMGTLAKEDERVVAGAVVGSLAV |
| Ga0063454_1012736452 | 3300004081 | Soil | VFTVEQRDALRARMLQLADEDERVVAGAAVGSLAVGSGDR |
| Ga0062590_1012273422 | 3300004157 | Soil | VFTVEQRDALRERMLGLAEEDERVVAAAAVGSLAVDAGDRY |
| Ga0066690_103568901 | 3300005177 | Soil | VFTVKQRDALRERVLRLAEEDDRVAAGAAVGSLAVDGGDRFS |
| Ga0066688_102396402 | 3300005178 | Soil | VFTVEQRDALRERVRRLAEEDERVVAGALVGSLAVDAADRFSDVD |
| Ga0066678_107532172 | 3300005181 | Soil | VFTVEQRNALRARMLQLAEADERVVAGAAVGSLAVGSGDRFSD |
| Ga0070661_1008263672 | 3300005344 | Corn Rhizosphere | MDNRRVFTVEQRDAVRQRVLRLAAMDARTVAAAVVGSLAAG |
| Ga0070713_1011530522 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAVEERDALRARMLEYAEDDDRVVAAAAVGSLATGSGDRF |
| Ga0070713_1012861931 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VFTVEDRNVLRERLLRLADRDERVVAGAAVGSLAVGTGDR |
| Ga0070708_1022290721 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VFTVEQRDALRERLLRLGEEDERVVAGAAVGSLAVDGGDR |
| Ga0070706_1019879772 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VFTVEQRNALRARMLRLAEEDERVVAGAAVGSLAVGTGDRFSDL |
| Ga0070707_1016871391 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VFTVEQRDALRGRMLQLAEEDERVVAGAAVGSLAVGTGDRFSDL |
| Ga0073909_100427504 | 3300005526 | Surface Soil | MFTVELRDALLERVLGLGREDGRVVAGAVVGSLAIDG |
| Ga0066693_102365131 | 3300005566 | Soil | VFTVAQRDALRERLRRLAEEDERVVAGAVVGSLAV |
| Ga0068857_1015878431 | 3300005577 | Corn Rhizosphere | MDNRRVFTVEQRDAVRQRVLRLAAMDARTVAAAVVGSLAA |
| Ga0066691_102259751 | 3300005586 | Soil | VFTAEQRDALRERVLTLAEQDRRVVAGAAVGSLALGGGDRFSD |
| Ga0068859_1011662871 | 3300005617 | Switchgrass Rhizosphere | MFTVEQRDALRERVRKLGEEDAHVVAGAVVGSLAVEGGGDRYSD |
| Ga0068861_1005442482 | 3300005719 | Switchgrass Rhizosphere | VFTVEQRDALRARMVRLAEEDERVVAGAAVGSLAVGT |
| Ga0081455_108128531 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VFTVEQRDALRDRVLRLAEADERVVAGAAVGSLAL |
| Ga0066696_101460364 | 3300006032 | Soil | VFTVEQRDALRDRLLRLAEEDERIVAGAAVGSLAVDGG |
| Ga0066656_108128132 | 3300006034 | Soil | VFTIEQRDVLRARMLQLAEADERVVAGAGVGSLAVGSG |
| Ga0070712_1003526131 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTVERRDALYEHVLRLAKADERVVAGAVVGSLAVDEADRF |
| Ga0066659_110775061 | 3300006797 | Soil | VFTVEQRDALRDHLLRLADEDERVVAGAAVGSLAV |
| Ga0075426_115245351 | 3300006903 | Populus Rhizosphere | VFTLEQRDALCERLLRLAEEDDRVVAGAVVGSLAVGEG |
| Ga0075424_1019484601 | 3300006904 | Populus Rhizosphere | VFTVEQREELHERVLRLGRQDSRVVAGALVGSLAVDAGDRYSDLD |
| Ga0075436_1001127993 | 3300006914 | Populus Rhizosphere | VFTVEQRDALRERVLALAEADGRIVAGAAVGSLALGGGDRFS |
| Ga0079216_110683181 | 3300006918 | Agricultural Soil | VFTVEQRDALRRRVLRLAEADERVVAGAVVGSLAVDGAE |
| Ga0079219_109824621 | 3300006954 | Agricultural Soil | VFTIEQRDELRERVLAVAKEDPRIVAGAAVGSLAL |
| Ga0075435_1013694192 | 3300007076 | Populus Rhizosphere | MFTVEQRDALRDRVLRLGDEDERVVAGAAVGSLAV |
| Ga0099791_102294531 | 3300007255 | Vadose Zone Soil | VDTIPLVFTVEDRRRVREGLLAKARNDRRVVAGAEVGSTAVGGGDRWS |
| Ga0066710_1029430192 | 3300009012 | Grasslands Soil | VFTVEQRDALRERVLALAEDDGRIVAGAAVGSLALGGGDRF |
| Ga0099827_116420471 | 3300009090 | Vadose Zone Soil | MFTVEQRDALSEHLLRLAKTDEHLVAGAAVGSLAVDGGDRFSD |
| Ga0105243_102117554 | 3300009148 | Miscanthus Rhizosphere | VFTIDERDALRTRMLQLAEEDERVVAAAAVGSLAVGTGDRFS |
| Ga0075423_104940103 | 3300009162 | Populus Rhizosphere | VFTVEQRDALRERLLTLAQEDERAVAEAAVGSLAVDRG |
| Ga0126307_109966351 | 3300009789 | Serpentine Soil | VPKVFTVEQRDALHERALRLAEDDDRVVAGAAVGSLAVDDGD |
| Ga0126313_109498301 | 3300009840 | Serpentine Soil | VFTVEQRDALREHLLRLAEEDEHVVAGAAVGSLAVD |
| Ga0131077_101606271 | 3300009873 | Wastewater | MFTVEQRDALRDHVMELGERDERVVAGAVVGSLAV |
| Ga0126305_104751802 | 3300010036 | Serpentine Soil | VFTVEQRNALRERLLQLAEEDDRVVAAAAVGSLAVGAGDSSPTWI* |
| Ga0126305_106470671 | 3300010036 | Serpentine Soil | VFTVEKREAVRERVLRLAEEDERSIAGAAVGSLAVDGGDRF |
| Ga0126311_104389651 | 3300010045 | Serpentine Soil | VFAVEQRDALRERVLGLAEDDPRVVAGAAVGSLAVD |
| Ga0134064_103787852 | 3300010325 | Grasslands Soil | MTFVVEERDRIRERVLELAAGDPRVVAAAEVGSLAQGGGD |
| Ga0134062_107667062 | 3300010337 | Grasslands Soil | VFTVEQRDALRERVLHSAERDERIVAGALVGSLAVDGGDR |
| Ga0137380_100690846 | 3300012206 | Vadose Zone Soil | VFTVEQRDALREYVLKFAEKDERVVAGAVVGSLAVDGDRFSD |
| Ga0137376_114622772 | 3300012208 | Vadose Zone Soil | VFTVEQRDALREFVLQLAEADERVVAGAIVGSLAIDAGDRFSDVDLDSGT* |
| Ga0137379_103416382 | 3300012209 | Vadose Zone Soil | VFTVEQRDALRERVLRLAQEDERVVAGALVGSLAADAGDRFSD |
| Ga0137366_105750921 | 3300012354 | Vadose Zone Soil | VFTVAQRDALRERLLGLAEEDERVVAGALVGSLAVD |
| Ga0137385_112292671 | 3300012359 | Vadose Zone Soil | VFTVEQRDALRELVLTLAEKDRRAVAGAAVGSLAVCGGARFS |
| Ga0137385_116502022 | 3300012359 | Vadose Zone Soil | VFTVEQRDALRERVLRLGEDDESVVAGAVVGSLAVDGGD |
| Ga0157319_10089031 | 3300012497 | Arabidopsis Rhizosphere | VFTVEQRDAVRAWMLELAEADKRVVAGAAVGSLVVG |
| Ga0136614_103138821 | 3300012684 | Polar Desert Sand | VFSVEERDALRERVLRLAEDDARVVAGAAVGSLALDG |
| Ga0137419_101180301 | 3300012925 | Vadose Zone Soil | VFTVEQRDALRDRLLRLAQKDERIVAGAAVGSLAHGE |
| Ga0164303_111251902 | 3300012957 | Soil | VFTVEQRDALRDRLLRLAREDERVLAGAAVGSLAFDK |
| Ga0134110_101877152 | 3300012975 | Grasslands Soil | VFTVEQRNALRARMLQLAEADARVVAGAAVGSLAVG |
| Ga0164304_114533221 | 3300012986 | Soil | VFTVEQRDSLRERVLRLAEEDERVVAGAVVGSLAL |
| Ga0164305_104334751 | 3300012989 | Soil | MFTVEQREALLERVLELGREDERVIAGAVVGSLAVDGGD |
| Ga0134081_103232662 | 3300014150 | Grasslands Soil | VFTVDQRDALRARMLQLAQEDERVVAGAAVGSLAVG |
| Ga0167622_10146432 | 3300015158 | Glacier Forefield Soil | VFTVEQRDALRERLLRLAAEDGRVVSGAAGGSLALD |
| Ga0134072_103089462 | 3300015357 | Grasslands Soil | VFTVEQREALRERVLALADDDQRVVAGAVVGSLAF |
| Ga0132256_1029145101 | 3300015372 | Arabidopsis Rhizosphere | MFTVAQRDALRAHVLQLAEEDGRVVAGAAVGSLAAGTGDRFS |
| Ga0183260_104657051 | 3300017787 | Polar Desert Sand | MVLMFTVEQRDALCEHVLRLAEEDERVVAGAVVGSLAF |
| Ga0184608_103542081 | 3300018028 | Groundwater Sediment | MFTVEQRDTLRERVPRLAEQDGRVVAGAAVGSLAVDAGDR |
| Ga0184619_102885961 | 3300018061 | Groundwater Sediment | VFTVEQRDALREQLLRLAEEDERVIAGAAVGSLAVDGG |
| Ga0184611_10407613 | 3300018067 | Groundwater Sediment | VFTVEQRDALRERVLRLARDDERVVAGAAVGSLAVGGGDRFS |
| Ga0066667_100818731 | 3300018433 | Grasslands Soil | VFTVEQRDALREHVLQLAEEDERVVAGAAVGSLAVDG |
| Ga0190268_109531361 | 3300018466 | Soil | VFTVEQRDALREHLLRLAEEDERVVAGAAVGSLAVNG |
| Ga0173482_106419791 | 3300019361 | Soil | MFTQVERDAVRERVLRLGRDDRRVVAGALVGSLAVGSGDAY |
| Ga0190264_106231912 | 3300019377 | Soil | VFTVEQRDALREHLLRLAEEDERVVAGAAVGSPESS |
| Ga0193700_10171883 | 3300019873 | Soil | VFTVEQRDALREHVLQLAEEDERVVAGAAVGSLAVD |
| Ga0193718_10649623 | 3300019999 | Soil | VFTVEQRDALRNRLLRLAEADERVVAGAAVGSLAFDQG |
| Ga0210381_103741682 | 3300021078 | Groundwater Sediment | VFTVEQRDALRARMLQLAEEDERVVAGAAVGSLAVGTGDRFSD |
| Ga0247786_11562351 | 3300022883 | Soil | MFTVEQRDALRERVRRLGEGDERVVAGAAVGSLAVEGGGD |
| Ga0247787_10769871 | 3300022893 | Soil | MRLVFTVEQRDALRERVLELAEEDERVVAGAVVGSLAVDSG |
| Ga0207688_108746972 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTIEQRDALRERVLGMGEQDERVIAGAVVGSLALD |
| Ga0207685_100294544 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VFSVEERDALRARMLAYAEDDDRVVAGAAVGSLAT |
| Ga0207693_108959912 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VQPMFTVERRDALYEHVLRLAKADERVVAGAVVGSLAVDEADRF |
| Ga0207668_118812011 | 3300025972 | Switchgrass Rhizosphere | MFTVEQRDALRDRVLRLADEDDRVVAGAAVGSLAVDE |
| Ga0207703_106326641 | 3300026035 | Switchgrass Rhizosphere | MFTVEQRDALCGRVVRLGEDDDRVLAGAVVGSLAVDGGD |
| Ga0207676_123793491 | 3300026095 | Switchgrass Rhizosphere | MFTVEQRDALRDRVLRLAQEDERIVAGAVVGSLAL |
| Ga0207674_115659242 | 3300026116 | Corn Rhizosphere | MFTVEQRDALRDRVLRLAQEDERIVAGAVVGSLAFDG |
| Ga0209268_11700792 | 3300026314 | Soil | VFTVEQRDALRESVLTLAEKDGRVVAGAAVGSLAV |
| Ga0209058_12450561 | 3300026536 | Soil | VFTTDQRDALRAHMLELAEEDERVVAGAAVGSLAVGSGDRF |
| Ga0209056_104644212 | 3300026538 | Soil | VFTVEQRNALRARMLQLAEADERVVAGAAVGSLAVGSGDRFS |
| Ga0209577_107690812 | 3300026552 | Soil | VFTVQQRDALREHVLQLAEDDERVVAGAAVGSLAVDGGD |
| Ga0209580_105723462 | 3300027842 | Surface Soil | MFTIEQRDRIRDRILAMAHEDPRIVAGAVIGSAAH |
| Ga0247828_104120382 | 3300028587 | Soil | VFPVEQRDALRARMLQLAEDDERVVAGAAVGSLAVGT |
| Ga0307322_101153252 | 3300028710 | Soil | VFTVEQRDALRARMLEVAEEDELVVAGAAVGSLAVGS |
| Ga0307313_101299232 | 3300028715 | Soil | VFTVKQRDALRARMLRLAEDDERVVAGAAVGSLAVGTGDRFSDLDL |
| Ga0307311_101323852 | 3300028716 | Soil | VFTVEQRDALRARMLELAEEDERVVAGAAVGSLAVGTGDRFSD |
| Ga0307301_100509271 | 3300028719 | Soil | VFTVEQRDALHEHVLQLAEEDERVVAGAAVGSLALEGGDRFSD |
| Ga0307301_101188783 | 3300028719 | Soil | VFTVEQRDALREHVLQLAEEDERVVAGAAVSSLAVEGLGDRFSDL |
| Ga0307319_102711592 | 3300028722 | Soil | VFTVEQRDALREHVLRLAKEDERVVAGAAVGSLAVDGG |
| Ga0307297_101366341 | 3300028754 | Soil | VFTVEQRDALRARMLEVAEEDELVVAGAAVGSLAVGSGDRFS |
| Ga0307316_101359852 | 3300028755 | Soil | MFTVEQRDALREHVLRLAKEDERVVAGAAVGSLAVDGGDRFS |
| Ga0307288_102243873 | 3300028778 | Soil | VFTVEQRHALREHVLQLAEEDERVVAGAAVGSLAVDGGGDRFSDL |
| Ga0307283_101016721 | 3300028790 | Soil | VFTVEQRDALRARMLEVAEEDELVVAGAAVGSLAVG |
| Ga0307299_100191551 | 3300028793 | Soil | MFTVEQRDALRERVLGLAEEDERVVAGALVGSLAVDR |
| Ga0307294_101058002 | 3300028810 | Soil | VFSVEQRDALLERVLGLGREDERVIAGASVGSLAVDGGDRFS |
| Ga0307296_107874951 | 3300028819 | Soil | VFTVEQRDALRARMLEVAEEDELVVAGADVGSLAVGSGD |
| Ga0307312_100629452 | 3300028828 | Soil | VFTVEQRDLLRERVLRLGEEDERVVAGAVVGSLAV |
| Ga0307312_102176781 | 3300028828 | Soil | VFTVEQRDALRERVLGLAQEDERVVAGAAVGSLAVDAGDRFSD |
| Ga0307304_102342421 | 3300028885 | Soil | MFTVEQRDALREHVIRLAEEDERVVAGALVGSLAVDGGD |
| Ga0306926_107018341 | 3300031954 | Soil | VFTVEQRAALRDRLLWLAAEDERVVAGAAVGSLAVDA |
| Ga0310899_104209092 | 3300032017 | Soil | VFTVEQRDALRDRVQRLADADDRVVAGAAVGSLALGG |
| Ga0272431_103056302 | 3300033181 | Rock | VFTVDRRDGLRDRVLRLGQDDDRVIGGAAVGSLAVDEGDSLSDL |
| Ga0214471_114134981 | 3300033417 | Soil | VFTVEQRDALRERVLRLAKEDERTVAGAAVGSLAV |
| Ga0247829_108700052 | 3300033550 | Soil | VFPVEQRDALRARMLQLAEDDERVVAGAAVGSLAVGTGDRFSD |
| Ga0247830_109249492 | 3300033551 | Soil | VFTVEQRDALRERMLGLAEEDERVVAAAAVGSLAIDAGDR |
| Ga0364927_0184616_482_610 | 3300034148 | Sediment | VFTVAQRDALRERLLRLAEDDERVVAGVAVGSLVADGGDRFSD |
| Ga0373959_0167739_3_119 | 3300034820 | Rhizosphere Soil | MFTVEQRDDLRERVLRLGEDDDRVVAGAVVGSLAIDGGD |
| ⦗Top⦘ |