NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087533

Metagenome / Metatranscriptome Family F087533

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087533
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 45 residues
Representative Sequence MIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRG
Number of Associated Samples 83
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.91 %
% of genes near scaffold ends (potentially truncated) 95.45 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.091 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.000 % of family members)
Environment Ontology (ENVO) Unclassified
(50.909 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(60.909 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 79.55%    β-sheet: 0.00%    Coil/Unstructured: 20.45%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF08327AHSA1 8.18
PF13924Lipocalin_5 6.36
PF04392ABC_sub_bind 4.55
PF11684DUF3280 2.73
PF01255Prenyltransf 2.73
PF03401TctC 1.82
PF00654Voltage_CLC 1.82
PF07883Cupin_2 1.82
PF01650Peptidase_C13 1.82
PF04780DUF629 0.91
PF03354TerL_ATPase 0.91
PF03976PPK2 0.91
PF02922CBM_48 0.91
PF01135PCMT 0.91
PF13561adh_short_C2 0.91
PF00126HTH_1 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 4.55
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 2.73
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 1.82
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.82
COG5206Glycosylphosphatidylinositol transamidase (GPIT), subunit GPI8Posttranslational modification, protein turnover, chaperones [O] 1.82
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.91
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.91
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.91
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.91
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.91
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.09 %
UnclassifiedrootN/A30.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459007|GJ61VE201C3T6SAll Organisms → cellular organisms → Bacteria508Open in IMG/M
2170459016|G1P06HT02GRHMIAll Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1046476All Organisms → cellular organisms → Bacteria → Proteobacteria780Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1003230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2301Open in IMG/M
3300000956|JGI10216J12902_102831072Not Available554Open in IMG/M
3300001867|JGI12627J18819_10150498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium948Open in IMG/M
3300002914|JGI25617J43924_10084384Not Available1149Open in IMG/M
3300004643|Ga0062591_100268174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1317Open in IMG/M
3300005363|Ga0008090_10184818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1099Open in IMG/M
3300005363|Ga0008090_15899311Not Available540Open in IMG/M
3300005468|Ga0070707_100795419All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_47_16909Open in IMG/M
3300005554|Ga0066661_10340678Not Available919Open in IMG/M
3300005713|Ga0066905_100540547Not Available976Open in IMG/M
3300005713|Ga0066905_101235066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales669Open in IMG/M
3300005764|Ga0066903_100121527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3632Open in IMG/M
3300005764|Ga0066903_100274521Not Available2634Open in IMG/M
3300005764|Ga0066903_100972934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1547Open in IMG/M
3300005764|Ga0066903_104030213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria787Open in IMG/M
3300005764|Ga0066903_104621244All Organisms → cellular organisms → Bacteria → Proteobacteria733Open in IMG/M
3300005764|Ga0066903_107210248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300005764|Ga0066903_107702216Not Available554Open in IMG/M
3300006028|Ga0070717_10193606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1777Open in IMG/M
3300006175|Ga0070712_101608194Not Available568Open in IMG/M
3300009012|Ga0066710_101956623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria873Open in IMG/M
3300009792|Ga0126374_10677242Not Available772Open in IMG/M
3300009792|Ga0126374_11545662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria546Open in IMG/M
3300010047|Ga0126382_12498448Not Available504Open in IMG/M
3300010358|Ga0126370_12484474Not Available516Open in IMG/M
3300010376|Ga0126381_102196241Not Available794Open in IMG/M
3300010376|Ga0126381_103641386Not Available604Open in IMG/M
3300010376|Ga0126381_105133959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300010868|Ga0124844_1077134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1239Open in IMG/M
3300012362|Ga0137361_10310408All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300012582|Ga0137358_11073147All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae515Open in IMG/M
3300012923|Ga0137359_11136504All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300012971|Ga0126369_13614494All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300012989|Ga0164305_10707862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria824Open in IMG/M
3300014497|Ga0182008_10487635Not Available676Open in IMG/M
3300016319|Ga0182033_11164756All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300016319|Ga0182033_11841741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria549Open in IMG/M
3300016319|Ga0182033_12085818Not Available517Open in IMG/M
3300016341|Ga0182035_10706622All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300016357|Ga0182032_10330183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1214Open in IMG/M
3300016357|Ga0182032_10782889All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1805Open in IMG/M
3300016371|Ga0182034_10858840All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1779Open in IMG/M
3300016387|Ga0182040_10785977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria783Open in IMG/M
3300016422|Ga0182039_10373824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71203Open in IMG/M
3300016422|Ga0182039_11495239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria615Open in IMG/M
3300016445|Ga0182038_11337541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860641Open in IMG/M
3300020579|Ga0210407_10688243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860793Open in IMG/M
3300021478|Ga0210402_11177031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860694Open in IMG/M
3300021560|Ga0126371_10783983Not Available1100Open in IMG/M
3300021560|Ga0126371_11825890Not Available729Open in IMG/M
3300025905|Ga0207685_10168890Not Available1005Open in IMG/M
3300025915|Ga0207693_10693946Not Available789Open in IMG/M
3300025922|Ga0207646_10831982Not Available821Open in IMG/M
3300025939|Ga0207665_10456174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria982Open in IMG/M
3300026304|Ga0209240_1047919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1612Open in IMG/M
3300026319|Ga0209647_1011778All Organisms → cellular organisms → Bacteria → Proteobacteria5822Open in IMG/M
3300026557|Ga0179587_10751310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans643Open in IMG/M
3300027326|Ga0209731_1057013Not Available596Open in IMG/M
3300027748|Ga0209689_1090833All Organisms → cellular organisms → Bacteria → Proteobacteria1596Open in IMG/M
3300027874|Ga0209465_10034138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2402Open in IMG/M
3300028047|Ga0209526_10086026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2213Open in IMG/M
3300028876|Ga0307286_10011880Not Available2703Open in IMG/M
3300031543|Ga0318516_10178951All Organisms → cellular organisms → Bacteria → Proteobacteria1221Open in IMG/M
3300031543|Ga0318516_10594365Not Available632Open in IMG/M
3300031545|Ga0318541_10619316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria605Open in IMG/M
3300031572|Ga0318515_10372294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria765Open in IMG/M
3300031573|Ga0310915_10037097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3082Open in IMG/M
3300031640|Ga0318555_10275365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria910Open in IMG/M
3300031668|Ga0318542_10446052All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1670Open in IMG/M
3300031680|Ga0318574_10892910Not Available520Open in IMG/M
3300031713|Ga0318496_10130597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1363Open in IMG/M
3300031724|Ga0318500_10391105All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1690Open in IMG/M
3300031744|Ga0306918_10556087Not Available899Open in IMG/M
3300031747|Ga0318502_10935097Not Available528Open in IMG/M
3300031768|Ga0318509_10234528All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300031781|Ga0318547_10731325Not Available615Open in IMG/M
3300031796|Ga0318576_10186064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria975Open in IMG/M
3300031796|Ga0318576_10358831Not Available689Open in IMG/M
3300031819|Ga0318568_10710175Not Available625Open in IMG/M
3300031832|Ga0318499_10150592All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031835|Ga0318517_10021783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2478Open in IMG/M
3300031846|Ga0318512_10137038All Organisms → cellular organisms → Bacteria → Terrabacteria group1174Open in IMG/M
3300031860|Ga0318495_10094085All Organisms → cellular organisms → Bacteria → Proteobacteria1346Open in IMG/M
3300031879|Ga0306919_10124121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1852Open in IMG/M
3300031879|Ga0306919_10658079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium807Open in IMG/M
3300031879|Ga0306919_11387676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300031890|Ga0306925_11310463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria719Open in IMG/M
3300031890|Ga0306925_11313114Not Available718Open in IMG/M
3300031890|Ga0306925_11447095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria675Open in IMG/M
3300031890|Ga0306925_11750633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria597Open in IMG/M
3300031896|Ga0318551_10269053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria955Open in IMG/M
3300031910|Ga0306923_10227625All Organisms → cellular organisms → Bacteria → Proteobacteria2132Open in IMG/M
3300031910|Ga0306923_11356163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria751Open in IMG/M
3300031942|Ga0310916_10687224All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae866Open in IMG/M
3300031945|Ga0310913_10689592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria722Open in IMG/M
3300031945|Ga0310913_10775808All Organisms → cellular organisms → Bacteria → Proteobacteria676Open in IMG/M
3300032001|Ga0306922_10224218All Organisms → cellular organisms → Bacteria2018Open in IMG/M
3300032001|Ga0306922_12252328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300032025|Ga0318507_10095705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1233Open in IMG/M
3300032025|Ga0318507_10482863Not Available539Open in IMG/M
3300032054|Ga0318570_10282620Not Available754Open in IMG/M
3300032063|Ga0318504_10244750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium843Open in IMG/M
3300032076|Ga0306924_11631683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria678Open in IMG/M
3300032090|Ga0318518_10549558Not Available590Open in IMG/M
3300032261|Ga0306920_101813593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860860Open in IMG/M
3300033289|Ga0310914_10949707All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1759Open in IMG/M
3300033290|Ga0318519_10850430Not Available562Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil10.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.82%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L02_027455802170459007Grass SoilMRLLLYLIISWPLLSLICGPANAQTVAVFDFELIDTSLEG
2ZMR_017454202170459016Switchgrass, Maize And Mischanthus LitterLWAVLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGVRPDEQE
AF_2010_repII_A100DRAFT_104647623300000655Forest SoilMIIPSYLVTLWALVFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARPDEQERLPV*
AP72_2010_repI_A100DRAFT_100323013300000837Forest SoilMIRSHLATLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARPDEQERL
JGI10216J12902_10283107223300000956SoilMRVPSYLVMLWALLLVVCGPTDAQTVAVFDFELIDTSLQG
JGI12627J18819_1015049813300001867Forest SoilMTCLIPRSYLVTLWAVLFVSCGPAVAQSVAVFDFELIDTSLEGAIRGVRPDEQE
JGI25617J43924_1008438443300002914Grasslands SoilMIIPSYLVTLWTLLIVSCGPTVAQSVAVFDFELIDASLKGIIRGTRPDE
Ga0062591_10026817413300004643SoilMRIPSYLAMSWALLLIICGPTVAQRVAVFDFELIDTSLQGE
Ga0008090_1018481823300005363Tropical Rainforest SoilMIIPSYIVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAVRGVRPDEQERLARL
Ga0008090_1589931113300005363Tropical Rainforest SoilMIIASYLVTLWALLFISCGPTVAQSVAVFDFELIDTSLEGA
Ga0070707_10079541923300005468Corn, Switchgrass And Miscanthus RhizosphereMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGA
Ga0066661_1034067813300005554SoilMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELID
Ga0066905_10054054723300005713Tropical Forest SoilMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGA
Ga0066905_10123506633300005713Tropical Forest SoilMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARP
Ga0066903_10012152763300005764Tropical Forest SoilMIIASYLVTLWTLLFVSCGATIAQSVAVFDFELIDTSLEGAIRGARADEQSGLPV*
Ga0066903_10027452153300005764Tropical Forest SoilMLIASYPVTLWTLLFVSCGSTAAQPIAGFDFELIDTSVGGRCQGRSD*
Ga0066903_10097293423300005764Tropical Forest SoilMIIASYPVTLWALLFISCGPTVAQSVAVFDFELIDTSLEGAIRGAR
Ga0066903_10403021333300005764Tropical Forest SoilMMRSHLVTLWALLFLSCGPTVAQSIAVFDFELIDTS
Ga0066903_10462124443300005764Tropical Forest SoilMIIRSYLVTLWALLFISCGPTVAQSVAVFDFELIDTSLEGAIR
Ga0066903_10721024823300005764Tropical Forest SoilTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGGYSGCSA*
Ga0066903_10770221623300005764Tropical Forest SoilMIIRSYVVTLCALLFVSCGPTVAQSVAVFDFELIDTSLEG
Ga0070717_1019360633300006028Corn, Switchgrass And Miscanthus RhizosphereMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARL
Ga0070712_10160819413300006175Corn, Switchgrass And Miscanthus RhizosphereMIVRLYLVTLWALLCVSCGPTVAQSVAVFDFELIDTSLEGAIRGA
Ga0066710_10195662333300009012Grasslands SoilMKTCRSTKSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGVR
Ga0126374_1067724223300009792Tropical Forest SoilMIIRSCLVTLWALLFVSCGPTVAESVAVFDFELIDTSLEGAIRGARPDEQ
Ga0126374_1154566223300009792Tropical Forest SoilMIIPSYLVTLWALLFVGYGPTVAQPVAVFDLELIDTSLEGAIRGARP
Ga0126382_1249844823300010047Tropical Forest SoilMIIPSYLVTLWALLLVSCGPTVAQSVAVFDFELIDTSLEGAIRGAR
Ga0126370_1248447413300010358Tropical Forest SoilMIIPAYLVTLWALLFVSCGPAVAQSVAVFDFELIDTSLEGAIR
Ga0126381_10219624113300010376Tropical Forest SoilMIIPSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLE
Ga0126381_10364138613300010376Tropical Forest SoilMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIE
Ga0126381_10513395913300010376Tropical Forest SoilMIIRSYLVTLWALLFVSCGPTVAQSIAVFDFELIDTSLE
Ga0124844_107713443300010868Tropical Forest SoilMIIRSYLVTLWALLFVSCGPTVAQSIAVFDFELIDTSL
Ga0137361_1031040813300012362Vadose Zone SoilMIIRSHLATLWALLFVSCGPTVAQSVAVFDFELIDTSLEGA
Ga0137358_1107314723300012582Vadose Zone SoilMLWALLVVTCGQTDAQTVAVFDFELIDTSLQGEISGSR
Ga0137359_1113650423300012923Vadose Zone SoilMKTCRSTKSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGV
Ga0126369_1361449413300012971Tropical Forest SoilMIIRSYLVTLWALLFVSCEPTVAQSIAVFDFELIDTSLEGAIR
Ga0164305_1070786213300012989SoilMIIRSYLVTLWAVLFVSCGPTVADSVAVFDFELIDTSLEGAIRGARLDEQER
Ga0182008_1048763523300014497RhizosphereMIIRSHLVTLWALLFVSCGTSVAQSVAVFDFELIDTSLEGAI
Ga0182033_1116475623300016319SoilMIIRSYLVTLWALLFLSCGPTVAQSVAVFDFELIDTSLEGAIRGARPDEQ
Ga0182033_1184174123300016319SoilMIIRSHLVTLWALLFVSCGTTVAQSVAVFDFELIDTSLEG
Ga0182033_1208581813300016319SoilMIIRSYVVTLCTLLFVSCGTTVAQSVAVFDFELIDTSLEGAIRGARPDEQQR
Ga0182035_1070662233300016341SoilMIIPSYLVTLWALVFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARPDEQERLARL
Ga0182032_1033018313300016357SoilMIIRSYLVTLSALLFVSCGPTVAQSVAVFDFELIDTSL
Ga0182032_1078288913300016357SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDISLEGA
Ga0182034_1085884023300016371SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDI
Ga0182040_1078597713300016387SoilMIIPSYLVTLWAVLFVSGGPTAAQSVAVFVFELIDTSLESAIRGARPDEQERLARLSDRLRQL
Ga0182039_1037382423300016422SoilMIIPAYLAMLWALLFASCGPAVAQSVAVLDFELIDTS
Ga0182039_1149523913300016422SoilMIIASYLVTLWALLFVGGGPTVAQSVAVFDFELIDTSLEGAIRGARPDEQER
Ga0182038_1133754123300016445SoilMTCLIPRSYLVTLWAVLFVSCGPAVAQSVAVCNFELIDTSLEGAIRGVRPD
Ga0210407_1068824313300020579SoilMTCLIPRSYLVALWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRG
Ga0210402_1117703123300021478SoilMTCLIPRSYLVTLWAVLFVSCGPAVAQSVAVFDFELIDTSLEGAIRGVRPDE
Ga0126371_1078398323300021560Tropical Forest SoilMIIPSYIVTLWALLFLSCGPTVAQSVAVFDFELIDTSLEGAVRGVRPDEQERLARL
Ga0126371_1182589013300021560Tropical Forest SoilMIIPSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTS
Ga0207685_1016889013300025905Corn, Switchgrass And Miscanthus RhizosphereMTCLIPRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARPDEQER
Ga0207693_1069394613300025915Corn, Switchgrass And Miscanthus RhizosphereMIVRSYLVTLWALLCVSCGPTVAQSVAVFDFELIDTSLEG
Ga0207646_1083198223300025922Corn, Switchgrass And Miscanthus RhizosphereMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSL
Ga0207665_1045617413300025939Corn, Switchgrass And Miscanthus RhizosphereMTCLIPRSYLVTLWAALFVSCGPAVAQSVAVFDFELIDTSLEGAIRG
Ga0209240_104791913300026304Grasslands SoilMIIPSYLVTLWTLLIVSCGPTVAQSVAVFDFELIDASLKGIIRGT
Ga0209647_101177843300026319Grasslands SoilMIIPSYLVTLWTLLIVSCGPTVAQSVAVFDFELIDASLKGIIRGTRPDEHRRNPAGTHDT
Ga0179587_1075131023300026557Vadose Zone SoilMIVRLFLMTLWALLCVSCGPTVAQSVAVFDFELIDTSLEGAIRGVRLDEQE
Ga0209731_105701323300027326Forest SoilVRAYAAGSYLVTLWALLFVSCTPTVAQSVAVFDFELIDTSLEGAIRGVRPDEQE
Ga0209689_109083333300027748SoilMRVPSYLVMLWALLFVTCGPTDAQTVAVFDFELIDTSLEGAI
Ga0209465_1003413853300027874Tropical Forest SoilMIIRSYLVTLWALLFVSCGSTVAQSVAVFDFELIDTSLEG
Ga0209526_1008602613300028047Forest SoilMKTCLITRSYLVALWAVLFVSCGPAVAQSVAVFDFELIDTSLEGAIRGARLDEQE
Ga0307286_1001188033300028876SoilMRIPSYLMVSWALLLLVCGPTLAQTVAVFDFELIDTSLEGEING
Ga0318516_1017895133300031543SoilMIIPSYLVTLWALVFVSCGPTVAQSVAVFDFELID
Ga0318516_1059436513300031543SoilMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAI
Ga0318541_1061931613300031545SoilMIIRSYLVTLWALLFVSCGPTVAQSIAVFDFELIDTSLEGAIRGARPDE
Ga0318515_1037229413300031572SoilMIIASYLVTLWALLFVGGGPTVAQSVAVFDFELIDTSLE
Ga0310915_1003709713300031573SoilMIIRSYLVTLWALLLVSCGPTVAQSIAVFDFELIDTSLEGAIRGARPDEQER
Ga0318555_1027536513300031640SoilMIIRSYLVTLWAVLFVGCGPTVAQSIAVFDFELIDTILEGAIRG
Ga0318542_1044605223300031668SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDISLE
Ga0318574_1089291013300031680SoilMIIPSYLVTLWALLFVSCGPTAAQSVAIFDFELIDTSVEGAIRG
Ga0318496_1013059733300031713SoilMIIRSYLVTLWAVLFVGCGPTVAQSIAVFDFELIDTSLEGAIRGARPDEQ
Ga0318500_1039110513300031724SoilMIIRSYLVMLWAVLFVSCGPTVAQSVAVFDFELID
Ga0306918_1055608713300031744SoilMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGAAR
Ga0318502_1093509723300031747SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELID
Ga0318509_1023452813300031768SoilMIIRSYLVMLWAVLFVSCGPTVAQSVAVFDFELIDTSLEGAI
Ga0318547_1073132513300031781SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDTSLE
Ga0318576_1018606413300031796SoilMIIRSYLVTLWAVLFVGCGPTVAQSIAVFDFELIDTSLEGAIRGARPG
Ga0318576_1035883113300031796SoilMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARPDEQERL
Ga0318568_1071017513300031819SoilMIIPSYLVTLWALLFVSCGPTAAQSVAIFDFELIDTSVEGAI
Ga0318499_1015059213300031832SoilMIIRSYLVMLWAVLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGA
Ga0318517_1002178343300031835SoilMIIRSYLVTLWAVLFVGCGPTVAQSIAVFDFELIDTSLEGAIRGARP
Ga0318512_1013703813300031846SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGA
Ga0318495_1009408513300031860SoilMIIPSYLVTLWALVFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARPDE
Ga0306919_1012412133300031879SoilMIIRSYLVTLWAVLFVGCGPTVAQSIAVFDFELIDTSLEGAIRGARPDEQER
Ga0306919_1065807923300031879SoilMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLEGAIRG
Ga0306919_1138767613300031879SoilMIIPSYLVTLWALLFVSCGPTVAQSVALFDFELIDTSLEGAIRGARP
Ga0306925_1131046333300031890SoilMIIRSHLVTLWALLFVGCGPTVAQSVAVFDFELIDTSLE
Ga0306925_1131311413300031890SoilMIIPAYLAMLWALLFASCGPAVAQSVAVLDFELIDTSLEGAIRGARADEQERLARQID
Ga0306925_1144709513300031890SoilMIIPSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSLESAIRGARPDEQERLARPSE
Ga0306925_1175063333300031890SoilMIIRSYLVTLWALLFVSCGPTVAQSIAVFDFELIDTSLEGAIRGARPD
Ga0318551_1026905333300031896SoilMIIPSYLVTLWPLLFVSCGPTVAQSVAVFDFELIDTSLEGAI
Ga0306923_1022762533300031910SoilMIIRSYLVMLWAVLFVSCGPTVAQSVAVFDFELIDTSL
Ga0306923_1135616313300031910SoilMIIPSHLVTLWALLFISCGPTVAQSVAVFDFELIDTSLEGAIRGARPD
Ga0310916_1068722413300031942SoilMIIPSYLVTLWPLLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARPD
Ga0310913_1068959223300031945SoilMIIRSYLVTLWALLLVSCGPTVAQSIAVFDFELIDTSLEGAIRGARP
Ga0310913_1077580813300031945SoilMIIRSYLVTLWALLFVSCGPTVAQSIAVFDFELIDTSLEGAIRGARP
Ga0306922_1022421813300032001SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDISLEGAIRGAR
Ga0306922_1225232813300032001SoilMKTCLITRSYLVALWALLFVGCGPTVAQSVAVFDFELIDT
Ga0318507_1009570543300032025SoilMIIPSYVVTLWALLFASCGPTVAQSVAVFDFELIDTS
Ga0318507_1048286313300032025SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDIS
Ga0318570_1028262013300032054SoilSGPTMIIRSYLVTLWALLFVSCGPTVAQSVAVFDFELIDTSL
Ga0318504_1024475013300032063SoilMIIPSHLVTLWALLFISCGPTVAQSVAVFDFELIDTSLEGAIRGARPDEQ
Ga0306924_1163168333300032076SoilMIIRSHLVTLWALLFVSCGTTVAQSVAVFDFELIDTSL
Ga0318518_1054955823300032090SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDISLEGAIRG
Ga0306920_10181359323300032261SoilMTCLIPRSYLVTLCAVLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGVRP
Ga0310914_1094970723300033289SoilMIIRSYLVMLWAVLFVSCGPTVAQSVAVFDFELIDTSLEGAIRGARLDE
Ga0318519_1085043013300033290SoilMIIRSYLVTLWAVLFVSCGPTVAQSVAVFDFELIDISLEGAIR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.