| Basic Information | |
|---|---|
| Family ID | F087525 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.64 % |
| % of genes near scaffold ends (potentially truncated) | 94.55 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.22% β-sheet: 16.44% Coil/Unstructured: 75.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01972 | SDH_sah | 4.55 |
| PF00999 | Na_H_Exchanger | 4.55 |
| PF03358 | FMN_red | 3.64 |
| PF13462 | Thioredoxin_4 | 2.73 |
| PF00578 | AhpC-TSA | 2.73 |
| PF06684 | AA_synth | 2.73 |
| PF13193 | AMP-binding_C | 2.73 |
| PF07992 | Pyr_redox_2 | 1.82 |
| PF13668 | Ferritin_2 | 1.82 |
| PF12680 | SnoaL_2 | 1.82 |
| PF00482 | T2SSF | 0.91 |
| PF12833 | HTH_18 | 0.91 |
| PF01965 | DJ-1_PfpI | 0.91 |
| PF01022 | HTH_5 | 0.91 |
| PF14329 | DUF4386 | 0.91 |
| PF02518 | HATPase_c | 0.91 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF12903 | DUF3830 | 0.91 |
| PF10431 | ClpB_D2-small | 0.91 |
| PF10604 | Polyketide_cyc2 | 0.91 |
| PF06803 | DUF1232 | 0.91 |
| PF07366 | SnoaL | 0.91 |
| PF06772 | LtrA | 0.91 |
| PF10011 | DUF2254 | 0.91 |
| PF03446 | NAD_binding_2 | 0.91 |
| PF02780 | Transketolase_C | 0.91 |
| PF07724 | AAA_2 | 0.91 |
| PF01243 | Putative_PNPOx | 0.91 |
| PF09423 | PhoD | 0.91 |
| PF12802 | MarR_2 | 0.91 |
| PF06965 | Na_H_antiport_1 | 0.91 |
| PF14833 | NAD_binding_11 | 0.91 |
| PF13458 | Peripla_BP_6 | 0.91 |
| PF13561 | adh_short_C2 | 0.91 |
| PF06224 | HTH_42 | 0.91 |
| PF00196 | GerE | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 9.09 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 5.45 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 4.55 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 4.55 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 4.55 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 4.55 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.91 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.91 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.09 % |
| Unclassified | root | N/A | 40.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725002|GPICC_F5MS3JC01DHAVL | Not Available | 532 | Open in IMG/M |
| 2170459007|GJ61VE201C0XEH | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300003319|soilL2_10047857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6181 | Open in IMG/M |
| 3300003321|soilH1_10125090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4015 | Open in IMG/M |
| 3300003322|rootL2_10029050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1280 | Open in IMG/M |
| 3300004153|Ga0063455_101353850 | Not Available | 546 | Open in IMG/M |
| 3300004157|Ga0062590_101393828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 697 | Open in IMG/M |
| 3300004157|Ga0062590_102183018 | Not Available | 579 | Open in IMG/M |
| 3300004157|Ga0062590_102659039 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300004479|Ga0062595_101878503 | Not Available | 573 | Open in IMG/M |
| 3300004643|Ga0062591_102214185 | Not Available | 572 | Open in IMG/M |
| 3300005093|Ga0062594_102748987 | Not Available | 546 | Open in IMG/M |
| 3300005294|Ga0065705_10859292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300005329|Ga0070683_101322079 | Not Available | 693 | Open in IMG/M |
| 3300005347|Ga0070668_100270735 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300005356|Ga0070674_101543850 | Not Available | 598 | Open in IMG/M |
| 3300005438|Ga0070701_10139365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1385 | Open in IMG/M |
| 3300005439|Ga0070711_100163695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1688 | Open in IMG/M |
| 3300005441|Ga0070700_100020543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3827 | Open in IMG/M |
| 3300005530|Ga0070679_101640819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300005535|Ga0070684_101992083 | Not Available | 548 | Open in IMG/M |
| 3300005543|Ga0070672_101654083 | Not Available | 575 | Open in IMG/M |
| 3300005615|Ga0070702_100912689 | Not Available | 689 | Open in IMG/M |
| 3300005617|Ga0068859_100876996 | Not Available | 983 | Open in IMG/M |
| 3300005718|Ga0068866_10919426 | Not Available | 617 | Open in IMG/M |
| 3300005719|Ga0068861_100389403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300005842|Ga0068858_100382600 | Not Available | 1350 | Open in IMG/M |
| 3300005874|Ga0075288_1019485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
| 3300006175|Ga0070712_101902563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300006581|Ga0074048_12974352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300006844|Ga0075428_101182148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
| 3300006846|Ga0075430_101558677 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006853|Ga0075420_101641672 | Not Available | 551 | Open in IMG/M |
| 3300006854|Ga0075425_100297723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1856 | Open in IMG/M |
| 3300006854|Ga0075425_102549232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300006880|Ga0075429_101008935 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300006881|Ga0068865_100661754 | Not Available | 889 | Open in IMG/M |
| 3300009094|Ga0111539_10445414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1508 | Open in IMG/M |
| 3300009094|Ga0111539_11094536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
| 3300009094|Ga0111539_12113825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300009148|Ga0105243_12303639 | Not Available | 576 | Open in IMG/M |
| 3300009156|Ga0111538_11268521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 930 | Open in IMG/M |
| 3300009156|Ga0111538_13841986 | Not Available | 520 | Open in IMG/M |
| 3300009176|Ga0105242_11464156 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300010371|Ga0134125_11802411 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300010373|Ga0134128_11455467 | Not Available | 754 | Open in IMG/M |
| 3300010403|Ga0134123_10105650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 2252 | Open in IMG/M |
| 3300010403|Ga0134123_11687534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300011439|Ga0137432_1309841 | Not Available | 504 | Open in IMG/M |
| 3300012212|Ga0150985_115224123 | Not Available | 590 | Open in IMG/M |
| 3300012897|Ga0157285_10083805 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012897|Ga0157285_10086963 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300012898|Ga0157293_10105365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300012905|Ga0157296_10076267 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300012907|Ga0157283_10236162 | Not Available | 598 | Open in IMG/M |
| 3300012910|Ga0157308_10134869 | Not Available | 770 | Open in IMG/M |
| 3300012910|Ga0157308_10140307 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012930|Ga0137407_11501242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300012938|Ga0162651_100047617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300013297|Ga0157378_11155371 | Not Available | 813 | Open in IMG/M |
| 3300013306|Ga0163162_11408272 | Not Available | 793 | Open in IMG/M |
| 3300013307|Ga0157372_11751801 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300013308|Ga0157375_11538704 | Not Available | 786 | Open in IMG/M |
| 3300014326|Ga0157380_12409504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300014745|Ga0157377_11758118 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300014969|Ga0157376_11463194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 716 | Open in IMG/M |
| 3300015053|Ga0137405_1321698 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
| 3300015077|Ga0173483_10579023 | Not Available | 613 | Open in IMG/M |
| 3300015242|Ga0137412_10935319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300015371|Ga0132258_10529895 | All Organisms → cellular organisms → Bacteria | 2950 | Open in IMG/M |
| 3300015371|Ga0132258_11596131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1647 | Open in IMG/M |
| 3300015372|Ga0132256_100941373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
| 3300015373|Ga0132257_102909877 | Not Available | 624 | Open in IMG/M |
| 3300015374|Ga0132255_103782003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300018066|Ga0184617_1148394 | Not Available | 685 | Open in IMG/M |
| 3300018466|Ga0190268_10124450 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300018466|Ga0190268_10258457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
| 3300018469|Ga0190270_10052870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2837 | Open in IMG/M |
| 3300018469|Ga0190270_12972978 | Not Available | 536 | Open in IMG/M |
| 3300018476|Ga0190274_11724360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
| 3300018481|Ga0190271_10215933 | Not Available | 1924 | Open in IMG/M |
| 3300018481|Ga0190271_11754944 | Not Available | 733 | Open in IMG/M |
| 3300019356|Ga0173481_10217651 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300019361|Ga0173482_10572343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300021078|Ga0210381_10033343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1462 | Open in IMG/M |
| 3300023261|Ga0247796_1088445 | Not Available | 582 | Open in IMG/M |
| 3300025898|Ga0207692_10183278 | Not Available | 1221 | Open in IMG/M |
| 3300025907|Ga0207645_10058458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2461 | Open in IMG/M |
| 3300025920|Ga0207649_11599282 | Not Available | 516 | Open in IMG/M |
| 3300025928|Ga0207700_11706298 | Not Available | 555 | Open in IMG/M |
| 3300025932|Ga0207690_10914190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300025933|Ga0207706_10024006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5471 | Open in IMG/M |
| 3300025935|Ga0207709_10854267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 737 | Open in IMG/M |
| 3300025937|Ga0207669_10162940 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300025941|Ga0207711_10151112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2095 | Open in IMG/M |
| 3300025944|Ga0207661_11390367 | Not Available | 644 | Open in IMG/M |
| 3300026067|Ga0207678_11549870 | Not Available | 584 | Open in IMG/M |
| 3300028381|Ga0268264_12282884 | Not Available | 548 | Open in IMG/M |
| 3300028589|Ga0247818_10874394 | Not Available | 631 | Open in IMG/M |
| 3300028754|Ga0307297_10090984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 993 | Open in IMG/M |
| 3300028810|Ga0307294_10410688 | Not Available | 510 | Open in IMG/M |
| 3300028885|Ga0307304_10541269 | Not Available | 536 | Open in IMG/M |
| 3300030336|Ga0247826_10489626 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300030336|Ga0247826_10911954 | Not Available | 694 | Open in IMG/M |
| 3300030336|Ga0247826_11377401 | Not Available | 569 | Open in IMG/M |
| 3300030336|Ga0247826_11392605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300031731|Ga0307405_11034645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300031740|Ga0307468_101031120 | Not Available | 727 | Open in IMG/M |
| 3300031908|Ga0310900_10476516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
| 3300032002|Ga0307416_101019011 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICC_03160070 | 2067725002 | Soil | GALQSDDRIRVDYDDVQLTFDVDKGAAEAMEEVEEPESQPAHV |
| L02_03202260 | 2170459007 | Grass Soil | ALQTHDRVRVDYDDVQLTFDVDKGAEEVEEPHSQPAHV |
| soilL2_1004785711 | 3300003319 | Sugarcane Root And Bulk Soil | ENEVSRLLLRGALQPDDRVRVDYDDVQLTLDVDKGAAEAMEEVEEPESQPAHV* |
| soilH1_101250901 | 3300003321 | Sugarcane Root And Bulk Soil | QRELENEVSRLLLRGALQPDDRVRVDYDDVQLTLDVDKGAAEAMEEVEEPESQPAHV* |
| rootL2_100290501 | 3300003322 | Sugarcane Root And Bulk Soil | SRLLLSGALQPDDRVRVDFQLTFDIDKGAAEAMEEVEEPEPQPANV* |
| Ga0063455_1013538502 | 3300004153 | Soil | ALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV* |
| Ga0062590_1013938282 | 3300004157 | Soil | IEPGDRVRVDYDDVQLTFDVEKGAEADEKVEQPERQPAHA* |
| Ga0062590_1021830181 | 3300004157 | Soil | LRGALQPDDRVHVDYDDVQLTFDIDKGAAEAIETQELQPAQV* |
| Ga0062590_1026590392 | 3300004157 | Soil | RELENEVSRLLLSGALQPDDRLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV* |
| Ga0062595_1018785031 | 3300004479 | Soil | PDDRVRVDYDDVQLTFDVDKGAAEEMEEVEEPESQPAHV* |
| Ga0062591_1022141851 | 3300004643 | Soil | ENELSRLLLSGALQPDDRVRIDYDDVQLTFEIDKGAAEAIEEVEDPESQPAQV* |
| Ga0062594_1027489872 | 3300005093 | Soil | RLLLGGSIEPGDRVRVDYDGVQLTFDVEKGAAEADEQVEQPERQPAHA* |
| Ga0065705_108592921 | 3300005294 | Switchgrass Rhizosphere | RGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV* |
| Ga0070683_1013220792 | 3300005329 | Corn Rhizosphere | LSGALQPDDRVRVDHDGVQLTFEVDKGAAEAMEEVEEPEPQPAHV* |
| Ga0070668_1002707351 | 3300005347 | Switchgrass Rhizosphere | LRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV* |
| Ga0070674_1015438503 | 3300005356 | Miscanthus Rhizosphere | SGALQPDDRVRVDYDDVQLTFDIDRGAVEAMEEVEEPEPQPAHV* |
| Ga0070701_101393653 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | IEPGDRVRVDYDGVQLTFDVEKGAAEADEQVEQPERQPAHA* |
| Ga0070711_1001636953 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RLLLSGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPELQPAHV* |
| Ga0070700_1000205434 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSDSTSSSSSDRRELENEVSRLLLSRALQPDDRVRVDFDDVQLTFDIDKGGAESMEEVEEPESQLAHV* |
| Ga0070679_1016408192 | 3300005530 | Corn Rhizosphere | LQPDDRVRVDYDDVQLTFDVDKGAAEAMEEVDEPEPQPAPV* |
| Ga0070684_1019920832 | 3300005535 | Corn Rhizosphere | SRLLLSGALQPDDRVRVDHDGVQLTFDIDKGPEEATEEEVIEPESPAYV* |
| Ga0070672_1016540831 | 3300005543 | Miscanthus Rhizosphere | RVRVDYDDVQLTFDIDKGAVEAMEEVEESEPQPAHV* |
| Ga0070702_1009126893 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ALQPDDRVRVDYDDVQLTFDIDKGGAEAMEEVEEPEPQPAHV* |
| Ga0068859_1008769961 | 3300005617 | Switchgrass Rhizosphere | LSGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV* |
| Ga0068866_109194261 | 3300005718 | Miscanthus Rhizosphere | PDDRVRVDYDDVQLTFDVDKGAAEAMEEVEEPEAQPAHV* |
| Ga0068861_1003894031 | 3300005719 | Switchgrass Rhizosphere | IQRELENEVSRLLLSGALQPDDRLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV* |
| Ga0068858_1003826001 | 3300005842 | Switchgrass Rhizosphere | PDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV* |
| Ga0075288_10194854 | 3300005874 | Rice Paddy Soil | RVDYDDVQLTFDIDKGGAEAMEEVEEPEPQPAHV* |
| Ga0070712_1019025632 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTLDVDKGAAEAMEAVEEPESQPAHV* |
| Ga0074048_129743521 | 3300006581 | Soil | ENEVSRLLLSGALQPDDRVRADFDDVQLTFDVEKGAAEQIEEVEEPESEPAHV* |
| Ga0075428_1011821481 | 3300006844 | Populus Rhizosphere | RAIQRELENEVSRLLLSGALQSDDRVRVDYDDIQLTFDVDKGAAEALEEVDEPESQPAHV |
| Ga0075430_1015586772 | 3300006846 | Populus Rhizosphere | LLSGALQPDDRVRVDYDDVQLTFDIDKGGAEAIDEVEEPEPQPAHV* |
| Ga0075420_1016416722 | 3300006853 | Populus Rhizosphere | LQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPESEPAHV* |
| Ga0075425_1002977234 | 3300006854 | Populus Rhizosphere | SGALQPDDRIRVDYDDVQLTFDVEKEAAEAMEEVEEPELQPAHA* |
| Ga0075425_1025492321 | 3300006854 | Populus Rhizosphere | QPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPAHV* |
| Ga0075429_1010089351 | 3300006880 | Populus Rhizosphere | LQPDDRVRVDYDDVQLTFDIDKGAAEALEEVEEPEPAHV* |
| Ga0068865_1006617541 | 3300006881 | Miscanthus Rhizosphere | DRVRVDYDDVQLTFDVEKGAAEADEQVEQPERQPAHA* |
| Ga0111539_104454141 | 3300009094 | Populus Rhizosphere | IQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV* |
| Ga0111539_110945363 | 3300009094 | Populus Rhizosphere | LSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV* |
| Ga0111539_121138251 | 3300009094 | Populus Rhizosphere | VIEEGLEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPAHV* |
| Ga0105243_123036391 | 3300009148 | Miscanthus Rhizosphere | LRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPARV* |
| Ga0111538_112685211 | 3300009156 | Populus Rhizosphere | LLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV* |
| Ga0111538_138419862 | 3300009156 | Populus Rhizosphere | RAIQRELENEVSRLLLSGALQPDDRVRVDFDDVQLTFDVDKGAAEAMEEVEEPESQPAHA |
| Ga0105242_114641563 | 3300009176 | Miscanthus Rhizosphere | EPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPELQPSHV* |
| Ga0134125_118024112 | 3300010371 | Terrestrial Soil | VRVDYDDVQLTFDIDKGAAEAIEEVEEPESQPAHV* |
| Ga0134128_114554672 | 3300010373 | Terrestrial Soil | QRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPQPAHV* |
| Ga0134123_101056501 | 3300010403 | Terrestrial Soil | LENEVSRLLLSRALQPDDRVRVDFDDVQLTFDIDKGGAESMEEVEEPESQLAHV* |
| Ga0134123_116875341 | 3300010403 | Terrestrial Soil | RRAIQRELENEVSRLHLSGALQTDDRVRVDYDDVQLTFDVEKGAAEEVEEPESQLAHA* |
| Ga0137432_13098412 | 3300011439 | Soil | RAIQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV |
| Ga0150985_1152241232 | 3300012212 | Avena Fatua Rhizosphere | ENELSRLLLSGALQPDDRVRVDYDDVQLFFDVEKGAAEAMEEVEEPELEAAHV* |
| Ga0157285_100838051 | 3300012897 | Soil | PGDRVRVDYDGVQLTFDVEKGAAEADEQVEQPERQPAHA* |
| Ga0157285_100869632 | 3300012897 | Soil | GALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEESEPAHV* |
| Ga0157293_101053652 | 3300012898 | Soil | LSGALQPDDRVRVDYDDIQLTFDVDKGAAEAMEEVDEPESQPAHV* |
| Ga0157296_100762673 | 3300012905 | Soil | RVRIDYDDVQLTFEVDKGAAEAMEEVDEPESEPAHA* |
| Ga0157283_102361621 | 3300012907 | Soil | LQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPELESAHV* |
| Ga0157308_101348691 | 3300012910 | Soil | ELENEVSRLLLSGGLQPDDRVRVDYDDVQLSFDIDKGAAEAMEEVEEPEPQPAHV* |
| Ga0157308_101403072 | 3300012910 | Soil | RLVLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEESEPAHV* |
| Ga0137407_115012422 | 3300012930 | Vadose Zone Soil | ENELSRLLLRGSIEPGDRVRVDYDEVELKFDVEKGAAEADQKVDQPERERAHAS* |
| Ga0162651_1000476172 | 3300012938 | Soil | IQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVDKGAAEQMEKVEEPESQPAHA* |
| Ga0157378_111553712 | 3300013297 | Miscanthus Rhizosphere | QRELENEVSRLLLSGALQPDDRLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV* |
| Ga0163162_114082721 | 3300013306 | Switchgrass Rhizosphere | QPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV* |
| Ga0157372_117518013 | 3300013307 | Corn Rhizosphere | LRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV* |
| Ga0157375_115387042 | 3300013308 | Miscanthus Rhizosphere | DYDDVQLTFDIDKGAAEAMEEVEEPEPQPQPQPAHV* |
| Ga0157380_124095042 | 3300014326 | Switchgrass Rhizosphere | AIQRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVDKGAAEAMEEVDEPEPQPAPV* |
| Ga0157377_117581182 | 3300014745 | Miscanthus Rhizosphere | GALQPDDRVRVDYDDVQLTFDVDKGAAEAMEEVEEPEAQPAHV* |
| Ga0157376_114631942 | 3300014969 | Miscanthus Rhizosphere | VSRLLLRGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQLAHV* |
| Ga0137405_13216985 | 3300015053 | Vadose Zone Soil | LASDYDEVELTFDVEKGAAESDQKVEQTERQPAHAS* |
| Ga0173483_105790231 | 3300015077 | Soil | RRAIQRELENEVSRLVLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEESEPAHV* |
| Ga0137412_109353193 | 3300015242 | Vadose Zone Soil | RVRVDYDDVQLTFDVEKGAAEADEKVEQPEREPAYAS* |
| Ga0132258_105298951 | 3300015371 | Arabidopsis Rhizosphere | SGALQPDDRVRVDYDDVQLTFDIDKGAAEETEEVEEPEPQPAHV* |
| Ga0132258_115961313 | 3300015371 | Arabidopsis Rhizosphere | RAIQRELENEVSRLLLSGALQPDDRVRVDYGDVQLTFDIDKGAAEEMEEVEEPEPQPAHV |
| Ga0132256_1009413732 | 3300015372 | Arabidopsis Rhizosphere | VTIVHGTARGALLLSGALQPDDRVRVDYDDVQLTFDIGKGAAEAIEEVEEPDSQPAHV* |
| Ga0132257_1029098771 | 3300015373 | Arabidopsis Rhizosphere | VRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV* |
| Ga0132255_1037820032 | 3300015374 | Arabidopsis Rhizosphere | LSGALQPDDRVRVDYDDVQLTFDIDRGAVEAMEEVEESEPQPAHV* |
| Ga0184617_11483942 | 3300018066 | Groundwater Sediment | ELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQPAHA |
| Ga0190268_101244503 | 3300018466 | Soil | ENEVSRLLLSGAVQPDDRVRVDYDHVQLTFDVDKGAAEAMEEVEEPESQPAHA |
| Ga0190268_102584572 | 3300018466 | Soil | LQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPAHV |
| Ga0190270_100528706 | 3300018469 | Soil | ENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEEMEEVEEPESQPAHV |
| Ga0190270_129729782 | 3300018469 | Soil | ENELSRLLLSGALQPDDRVRVDYDDVQLIFDVEKGAAEAMEEVEEPEPQPAHA |
| Ga0190274_117243602 | 3300018476 | Soil | LESEVSRLLLSGALQPDDRVRVDYDDVQFTFDVDKGAAEAMEEVEEPQSQPAHV |
| Ga0190271_102159331 | 3300018481 | Soil | QRELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEEMEEVEEPESQPAHV |
| Ga0190271_117549442 | 3300018481 | Soil | VRVDYDDVQLTFDVEKGAAEAMEEVEEPESQPAHV |
| Ga0173481_102176512 | 3300019356 | Soil | LLLGGSIEPSDRVRVDYDDVQLTFDVEKGAAEADEEVEQPEREPAHAS |
| Ga0173482_105723431 | 3300019361 | Soil | RAIQRELENEVSRLLLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV |
| Ga0210381_100333431 | 3300021078 | Groundwater Sediment | EVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAIEEVEEPEPQPAHV |
| Ga0247796_10884451 | 3300023261 | Soil | DDRVRVDYDDVQLTFDIDKGAAEAMEEVEESEPAHV |
| Ga0207692_101832781 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QPDDRVRVDYDEVQLTFDIDKGGAEAMEEVEEPEPQPAHV |
| Ga0207645_100584583 | 3300025907 | Miscanthus Rhizosphere | DRVRVDYDDVQLTFDVDKGAAEAMEEVDEPEPQPAPV |
| Ga0207649_115992821 | 3300025920 | Corn Rhizosphere | DDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV |
| Ga0207700_117062981 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLSGALQPDDRVRVDYDEVQLTFDIDKGGAEAMEEVEEPEPQPAHV |
| Ga0207690_109141901 | 3300025932 | Corn Rhizosphere | LLSGALQPDDRVRVDYDDVQLTFDVDKGAAEEMEEVEEPESQPAHV |
| Ga0207706_100240061 | 3300025933 | Corn Rhizosphere | VSRLLLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV |
| Ga0207709_108542672 | 3300025935 | Miscanthus Rhizosphere | LVTSDSTSSSSSDRRELENEVSRLLLSRALQPDDRVRVDFDDVQLTFDIDKGGAESMEEVEEPESQLAHV |
| Ga0207669_101629403 | 3300025937 | Miscanthus Rhizosphere | SRLLLSGALQPDDRLRVDYDDVQLTFEIEKEAAETIEEVDEPESQPAHV |
| Ga0207711_101511121 | 3300025941 | Switchgrass Rhizosphere | LLLSGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPEPQPAHV |
| Ga0207661_113903671 | 3300025944 | Corn Rhizosphere | IQRELENEVSRLLLSGALQPDDRVRVDHDGVQLTFEVDKGAAEAMEEVEEPEPQPAHV |
| Ga0207678_115498702 | 3300026067 | Corn Rhizosphere | QPDDRVRVDYDDVQLTFDVEKGAAEAMDEVEEPESQLAHV |
| Ga0268264_122828841 | 3300028381 | Switchgrass Rhizosphere | PDDRVRVDYDDVQLTFDIDKGAVEAMEEVEEPEPQPAHV |
| Ga0247818_108743942 | 3300028589 | Soil | RLLLSGALQPDDRVRVDYDGVQLTFEVGKGGAEEREEVEEPESQPAHV |
| Ga0307297_100909841 | 3300028754 | Soil | ENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQPAHI |
| Ga0307294_104106882 | 3300028810 | Soil | RLLLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHI |
| Ga0307304_105412691 | 3300028885 | Soil | ELENEVSRLLLSGALQPDDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV |
| Ga0247826_104896261 | 3300030336 | Soil | RVRVDYDDVQLTFDVEKGAEAMEEVEEPESQPAHV |
| Ga0247826_109119542 | 3300030336 | Soil | RLLLRGALQPDDRVRVDYDDVQLTFDVDKGAAEVMEEVEEPESQPAHV |
| Ga0247826_113774011 | 3300030336 | Soil | GDRVRVDYDGVQLTFDVEKGAAEADEQVEQPERQPAHA |
| Ga0247826_113926052 | 3300030336 | Soil | LLGGALQPDDRVRVDYDDVQLTFDVDKDAAEAMEEVDEPESQPAHV |
| Ga0307405_110346452 | 3300031731 | Rhizosphere | DDRVRVDYDDVQLTFDIDKGAAEEMEEVEEPESQPAHV |
| Ga0307468_1010311202 | 3300031740 | Hardwood Forest Soil | DDRVRVDYDDVQLTFDIDKGAAEAMEEVEEPEPQPAHV |
| Ga0310900_104765161 | 3300031908 | Soil | ENEVSRLLLSGALQPDDRVRVDYDDVQLTFDVEKGAAEAMEEVEEPESQPAHV |
| Ga0307416_1010190111 | 3300032002 | Rhizosphere | SDDRVRVDYDDVQLTFDIDKGAAEEMEEVEEPESQPAHV |
| ⦗Top⦘ |