| Basic Information | |
|---|---|
| Family ID | F087500 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTSAHALGHFLRTLPASAAATFLALFPIVDPFGGIPIFFTM |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.545 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.43% β-sheet: 0.00% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF04253 | TFR_dimer | 50.91 |
| PF01850 | PIN | 20.00 |
| PF04389 | Peptidase_M28 | 19.09 |
| PF02604 | PhdYeFM_antitox | 1.82 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF03279 | Lip_A_acyltrans | 0.91 |
| PF13607 | Succ_CoA_lig | 0.91 |
| PF00171 | Aldedh | 0.91 |
| PF01914 | MarC | 0.91 |
| PF16925 | TetR_C_13 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.82 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.82 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.91 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.91 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.91 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.91 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.91 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.55 % |
| Unclassified | root | N/A | 5.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001471|JGI12712J15308_10003244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4752 | Open in IMG/M |
| 3300001593|JGI12635J15846_10327602 | Not Available | 948 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100304318 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300004080|Ga0062385_10713351 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300004092|Ga0062389_100572490 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300005434|Ga0070709_10502261 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300005435|Ga0070714_100601134 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300005568|Ga0066703_10866198 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005602|Ga0070762_10149716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1395 | Open in IMG/M |
| 3300005602|Ga0070762_10268281 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300006162|Ga0075030_100023976 | All Organisms → cellular organisms → Bacteria | 5236 | Open in IMG/M |
| 3300006162|Ga0075030_100037673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4097 | Open in IMG/M |
| 3300006176|Ga0070765_100414394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1259 | Open in IMG/M |
| 3300006893|Ga0073928_10376511 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300009143|Ga0099792_10906850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300009645|Ga0116106_1047611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300009839|Ga0116223_10009262 | All Organisms → cellular organisms → Bacteria | 7667 | Open in IMG/M |
| 3300009839|Ga0116223_10528847 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300009839|Ga0116223_10557937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300010043|Ga0126380_12030857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300010343|Ga0074044_11026973 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010360|Ga0126372_12398597 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010361|Ga0126378_12089447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300011270|Ga0137391_10153449 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300012683|Ga0137398_10251252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1178 | Open in IMG/M |
| 3300012927|Ga0137416_11307635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300014501|Ga0182024_10327381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2012 | Open in IMG/M |
| 3300015373|Ga0132257_102530764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300017823|Ga0187818_10179257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300017928|Ga0187806_1244555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300017933|Ga0187801_10016533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2468 | Open in IMG/M |
| 3300017942|Ga0187808_10402643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300017943|Ga0187819_10347260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300017943|Ga0187819_10834428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300017946|Ga0187879_10190914 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300017970|Ga0187783_10940945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300017972|Ga0187781_10025877 | All Organisms → cellular organisms → Bacteria | 4062 | Open in IMG/M |
| 3300018062|Ga0187784_10530484 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300019890|Ga0193728_1342794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300020580|Ga0210403_10561429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300020582|Ga0210395_10585009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300020582|Ga0210395_10828200 | Not Available | 689 | Open in IMG/M |
| 3300021046|Ga0215015_10004250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300021181|Ga0210388_10617778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 947 | Open in IMG/M |
| 3300021402|Ga0210385_10189769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1490 | Open in IMG/M |
| 3300021404|Ga0210389_10451623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300021404|Ga0210389_10598406 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300021406|Ga0210386_10380867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1215 | Open in IMG/M |
| 3300021432|Ga0210384_11344464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300021432|Ga0210384_11768445 | Not Available | 524 | Open in IMG/M |
| 3300021433|Ga0210391_10964643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300021474|Ga0210390_10550040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300021474|Ga0210390_11273971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300021475|Ga0210392_11248885 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021478|Ga0210402_11954604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300021560|Ga0126371_11701564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300021858|Ga0213852_1118964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300021860|Ga0213851_1254403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300021860|Ga0213851_1475030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300021861|Ga0213853_10246893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300021861|Ga0213853_11223047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300022557|Ga0212123_10631440 | Not Available | 671 | Open in IMG/M |
| 3300022728|Ga0224566_101514 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300025898|Ga0207692_10741265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300025905|Ga0207685_10041482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1722 | Open in IMG/M |
| 3300025939|Ga0207665_11436554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300026515|Ga0257158_1108940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300026557|Ga0179587_10529743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300027603|Ga0209331_1131347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300027605|Ga0209329_1152726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300027889|Ga0209380_10670403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300027894|Ga0209068_10069567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1816 | Open in IMG/M |
| 3300028036|Ga0265355_1010533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300028552|Ga0302149_1102864 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300028759|Ga0302224_10289978 | Not Available | 656 | Open in IMG/M |
| 3300028792|Ga0307504_10407540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300028798|Ga0302222_10159153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300028801|Ga0302226_10057513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1823 | Open in IMG/M |
| 3300029636|Ga0222749_10086818 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300029883|Ga0311327_10238454 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300029993|Ga0302304_10394170 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300030007|Ga0311338_10632206 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300030007|Ga0311338_10986154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300030490|Ga0302184_10143470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
| 3300030503|Ga0311370_10159490 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
| 3300030503|Ga0311370_10393829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1744 | Open in IMG/M |
| 3300030524|Ga0311357_11114770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300030659|Ga0316363_10285643 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300030687|Ga0302309_10356589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300030814|Ga0265741_110455 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031234|Ga0302325_10575811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1668 | Open in IMG/M |
| 3300031234|Ga0302325_10864919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1262 | Open in IMG/M |
| 3300031249|Ga0265339_10479622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300031474|Ga0170818_110964494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300031708|Ga0310686_109643066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300031708|Ga0310686_119331084 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031712|Ga0265342_10028799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3455 | Open in IMG/M |
| 3300031720|Ga0307469_10824136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300031720|Ga0307469_11406583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300031754|Ga0307475_10459602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300031823|Ga0307478_11774884 | Not Available | 507 | Open in IMG/M |
| 3300031910|Ga0306923_10339365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1714 | Open in IMG/M |
| 3300031910|Ga0306923_11703519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300031912|Ga0306921_10927075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300031941|Ga0310912_10616983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300032001|Ga0306922_10367169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1543 | Open in IMG/M |
| 3300032770|Ga0335085_10812343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300032783|Ga0335079_10289222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1791 | Open in IMG/M |
| 3300033158|Ga0335077_12191058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300033289|Ga0310914_10461244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.45% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 4.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.82% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_100032447 | 3300001471 | Forest Soil | MTSAHALGSFLRTLPASAATTFLALFPIVDPFGGVPIFFTLTSS |
| JGI12635J15846_103276024 | 3300001593 | Forest Soil | MTSAHALGHFLRTLPDSAVATFLALFPIVDPFGGIPIFFTMTS |
| JGIcombinedJ26739_1003043181 | 3300002245 | Forest Soil | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGVPIFF |
| Ga0062385_107133513 | 3300004080 | Bog Forest Soil | MTSAHALGTFLRTLPASAAETFLALFPIVDPFGGIPIFFSMTSTWTP |
| Ga0062389_1005724903 | 3300004092 | Bog Forest Soil | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFTMTSSWTAQ |
| Ga0070709_105022611 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTSAHALGQFLRTLPASAAATFLALFPIVDPFGGIPVFFTMTSSWTAQD |
| Ga0070714_1006011342 | 3300005435 | Agricultural Soil | MDTTSMTSAHALGQFLRTLSGSAVATFLALFPIVDPFGGIPV |
| Ga0066703_108661982 | 3300005568 | Soil | MTSANALGHFLRTLSGSAVATFLALFPIVDPFGGIPVFFTMTS |
| Ga0070762_101497163 | 3300005602 | Soil | LTNHMTSAHALGTFLRTLPASAVATFLALFPIVDPFGG |
| Ga0070762_102682811 | 3300005602 | Soil | MTSAHALGTFLRTLPASAAATFLALFPIVDPFGGIPIFFSMTSTWTP |
| Ga0075030_1000239765 | 3300006162 | Watersheds | MASAHALGMFLKTLPASAAATFLALFPIVDPFGGIPIFFTMTSSWTP |
| Ga0075030_1000376737 | 3300006162 | Watersheds | MTSAHAFGQILRTLPSSAAATFLALFPIVDPFGGVPIFFTMTSSW |
| Ga0070765_1004143942 | 3300006176 | Soil | MTPTTHALGQFLRTLPHSAAATFLALFPIVDPFGGIP |
| Ga0073928_103765111 | 3300006893 | Iron-Sulfur Acid Spring | MTSAHALGQFLRTLPASAAATFLALFPIVDPFGGIPIFFTMTSSWTAR |
| Ga0099792_109068501 | 3300009143 | Vadose Zone Soil | MNATHALAQFLRTLPHSAAATFLALFPIVDPFGGVPI |
| Ga0116106_10476111 | 3300009645 | Peatland | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIF |
| Ga0116223_1000926210 | 3300009839 | Peatlands Soil | MNAAHALGHFLRTLPNSAVATFLALFPIVDPFGGVPIFFTMTS |
| Ga0116223_105288472 | 3300009839 | Peatlands Soil | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFTMTSAWTPQ |
| Ga0116223_105579372 | 3300009839 | Peatlands Soil | MNSAHVLGHFLRTLPASAVATFLALFPIVDPPGGVPIFFTMTT |
| Ga0126380_120308571 | 3300010043 | Tropical Forest Soil | MGSHTLPHFLRDLPSAAVATFLALFPIVNPFGGVPLFFSLTSS |
| Ga0074044_110269731 | 3300010343 | Bog Forest Soil | MNTAHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFAMT |
| Ga0126372_123985971 | 3300010360 | Tropical Forest Soil | MKAANALQHLLLTLPAAATATFLALFPIVDPPGGVPIFFTMTSSW |
| Ga0126378_120894472 | 3300010361 | Tropical Forest Soil | MTAAHALGHFLRTLPASAAATFLALFPIVDPFGGIPVFFTM |
| Ga0137391_101534491 | 3300011270 | Vadose Zone Soil | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGI |
| Ga0137398_102512522 | 3300012683 | Vadose Zone Soil | MTSAHALGQLLRTLPVSAAATFLALFPIVDPFGGV |
| Ga0137416_113076351 | 3300012927 | Vadose Zone Soil | MTSAHALGQFLRTLPASAAATFLALFPIVDPFGGVPIFF |
| Ga0182024_103273811 | 3300014501 | Permafrost | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFSMT |
| Ga0132257_1025307641 | 3300015373 | Arabidopsis Rhizosphere | MHSAHVLGQILRTLPASAAATFLALFPIVDPFGGVPIFFAMTSEW |
| Ga0187818_101792572 | 3300017823 | Freshwater Sediment | MTSAHALGHFLRTLPASAAATFLALFPIVDPFGGIPIFFTM |
| Ga0187806_12445551 | 3300017928 | Freshwater Sediment | MTSTHALGHFLRTLPASAAATFLALFPIVDPFGGIPIF |
| Ga0187801_100165332 | 3300017933 | Freshwater Sediment | MTSAHALGHFLRTLPASAAATFLALFPIVDPFGGIPIFFTMTSS |
| Ga0187808_104026431 | 3300017942 | Freshwater Sediment | MHSAHALGQFLRTLPHSALATFLALFPIVDPPGGIPIFYGMTSS |
| Ga0187819_103472601 | 3300017943 | Freshwater Sediment | MNTTHALGHFLRTLPQSAAATFLALFPIVDPFGGVPIFFTMTSSWTAQE |
| Ga0187819_108344281 | 3300017943 | Freshwater Sediment | MNSAHVLGQFLRTLPASAAATFLALFPIVDPFGGI |
| Ga0187879_101909144 | 3300017946 | Peatland | MNTAHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFAMTSSWTPQNRR |
| Ga0187783_109409452 | 3300017970 | Tropical Peatland | MNSAHVFGQFLRTLPASAAATYLALFPIVDPFGGVPIFFSMTSDWTARD |
| Ga0187781_100258773 | 3300017972 | Tropical Peatland | MTSAHALESFLRTLPASAAATFLALFPIVDPLGGIPIFYAMTSG |
| Ga0187784_105304841 | 3300018062 | Tropical Peatland | MTSAHVLGQFLRTLPASALATFLALFPIVDPFGGIP |
| Ga0193728_13427941 | 3300019890 | Soil | MTSAHALGQLFRTLPVSAAATFLALFPIVDPFGGVP |
| Ga0210403_105614292 | 3300020580 | Soil | MTPTTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPI |
| Ga0210395_105850092 | 3300020582 | Soil | MTSAHALGTFLRTLPASAAATFLALFPIVDPFGGIPIFF |
| Ga0210395_108282001 | 3300020582 | Soil | MTSAHGLGQFLRTLPASAAATFLALFPIVDPFGGIPNFFSM |
| Ga0215015_100042501 | 3300021046 | Soil | MTSAHALGQLLRTLPVSAAATFLALFPIVDPFGGVPIFFGLTSSWPAV |
| Ga0210388_106177783 | 3300021181 | Soil | MTPTPALGEFLRTLPASAAATFLALFPIVDPFGGVPIFFSMTS |
| Ga0210385_101897692 | 3300021402 | Soil | MNHAHALAQFLRTLPHSAAATFLALFPIVDPPGGVPIFFSM |
| Ga0210389_104516231 | 3300021404 | Soil | MTSAHALGQFLRTLSGSAVATFLALFPIVDPFGGIP |
| Ga0210389_105984061 | 3300021404 | Soil | MNSAHVLGHILRSLPASAAATFLALFPIVDPFGGIP |
| Ga0210386_103808672 | 3300021406 | Soil | MNTAHALGHFLRTLPNSAAATFLALFPIVDPFGGV |
| Ga0210384_113444641 | 3300021432 | Soil | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFSMTSS |
| Ga0210384_117684451 | 3300021432 | Soil | MTSAHVLGDFLRTLPRSAAATFLALFPIVDPFGGVPIFFSMTST |
| Ga0210391_109646431 | 3300021433 | Soil | MNSAHVLGQFLRTLPASAAATFLALFPIVDPFGGIP |
| Ga0210390_105500402 | 3300021474 | Soil | MTPTTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFSMTSSW |
| Ga0210390_112739711 | 3300021474 | Soil | MHTTHTLGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFSMTSSWTAHD |
| Ga0210392_112488851 | 3300021475 | Soil | MNTAHALGVFLRSLPHSAVATFLALFPIVDPPGGIPIFFAMTSSWTEQ |
| Ga0210402_119546041 | 3300021478 | Soil | MTSAHVLGDFLRTLPRSAAATFLALFPIVDPFGGVPIF |
| Ga0126371_117015642 | 3300021560 | Tropical Forest Soil | MTSGHGLGHFFLTLPASAAATFLALFPIVDPFGGIPVFFTMTS |
| Ga0213852_11189641 | 3300021858 | Watersheds | MTSTHALGHFLRTLPASAVATFLALFPIVDPFGGIPIFFTMTSGWTARE |
| Ga0213851_12544031 | 3300021860 | Watersheds | MASAHALGQFLRTLPDSAAATFLALFPIVDPFGGIPIFFTMTS |
| Ga0213851_14750302 | 3300021860 | Watersheds | MTPAHALGHFLRTLSGSAVATFLALFPIVDPFGGIPVFFTISSSGTPRDRYRTALK |
| Ga0213853_102468932 | 3300021861 | Watersheds | MTSAHALGHFLRTLPASAAATFLALFPIVDPFGGIPIFFTMTSTWTAGER |
| Ga0213853_112230471 | 3300021861 | Watersheds | MTSAHALGHFLRTLSGSAIATFLALFPIVDPFGGIPVFFTMTT |
| Ga0212123_106314403 | 3300022557 | Iron-Sulfur Acid Spring | MTSAHALGQFLRTLPSSAAATFLALFPIVDPFGGIPI |
| Ga0224566_1015144 | 3300022728 | Plant Litter | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFF |
| Ga0207692_107412651 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSHVLGHLLHTLPASAAATFLALFPIVDPFGGIP |
| Ga0207685_100414821 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSHVLGHLLHTLPASAAATFLALFPIVDPFGGIPIFFTMTSKW |
| Ga0207665_114365542 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTYALGQILRTLPASAAATFLALFPIVDPFGGIPVFFTM |
| Ga0257158_11089401 | 3300026515 | Soil | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFTMTAS |
| Ga0179587_105297431 | 3300026557 | Vadose Zone Soil | MTSAHALGQFLRTLPASAAATFLALFPIVDPFGGVPIFFSLTS |
| Ga0209331_11313471 | 3300027603 | Forest Soil | MTSAHALGQFLRTLPASAAATFLALFPIVDPFGGVPIF |
| Ga0209329_11527261 | 3300027605 | Forest Soil | MNPTHALGQVLRTLPHSAAATFLALFPIVDPFGGIP |
| Ga0209380_106704031 | 3300027889 | Soil | MTPTTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFSMTSSWTVQE |
| Ga0209068_100695671 | 3300027894 | Watersheds | LIAPVHAVGQMLRTLPSAAAATFLALFPIVNPFGGVPLF |
| Ga0265355_10105332 | 3300028036 | Rhizosphere | MDATHALGQFLRTLPHSAAATFLALFPIVDPFGGVPIFFSMT |
| Ga0302149_11028643 | 3300028552 | Bog | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFT |
| Ga0302224_102899782 | 3300028759 | Palsa | MTSAHVFGEFLRTLPASAAATFLALFPIVDPFGGVPIFFSMTSTW |
| Ga0307504_104075401 | 3300028792 | Soil | MTSAHVLGHFLRTLSGSAVATFLALFPIVDPFGGIPVFFTMTSSWT |
| Ga0302222_101591532 | 3300028798 | Palsa | MTSTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFTMTSSWTPQD |
| Ga0302226_100575131 | 3300028801 | Palsa | MHPTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFTMTASWTA |
| Ga0222749_100868181 | 3300029636 | Soil | MNTAHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFSMTSTWSA |
| Ga0311327_102384544 | 3300029883 | Bog | MNTTHALGQFLRTLPQSAAATFLALFPIVDPFGGIPI |
| Ga0302304_103941701 | 3300029993 | Palsa | MTSAHVLGQFLRTLPASAAATFLALFPIVDPFGGIPIFFTMTASWSPRD |
| Ga0311338_106322062 | 3300030007 | Palsa | MTSADTLGHFLRTLPASAATTFLALFPIVDPFGGIPIFF |
| Ga0311338_109861541 | 3300030007 | Palsa | MTSAHALGEFLRTLPRSAAATFLALFPIVDPLGGVPIFF |
| Ga0302184_101434703 | 3300030490 | Palsa | MHPTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFTMTASWT |
| Ga0311370_101594904 | 3300030503 | Palsa | MTATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFF |
| Ga0311370_103938292 | 3300030503 | Palsa | MTSTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFF |
| Ga0311357_111147703 | 3300030524 | Palsa | MTYAHALGHFLRTLPASAVATFLALFPIVDPFGGIPI |
| Ga0316363_102856431 | 3300030659 | Peatlands Soil | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFTM |
| Ga0302309_103565891 | 3300030687 | Palsa | MNPTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFSMTSSW |
| Ga0265741_1104551 | 3300030814 | Soil | MTSAHALGTFLRTLPASAAATFLALFPIVDPFGGIPIF |
| Ga0302325_105758112 | 3300031234 | Palsa | VTSTHALGQFLRTLPHSAAATFLALFPIVDPFGGVPIFFSM |
| Ga0302325_108649193 | 3300031234 | Palsa | MTSSHALQPFLHDLPSAAAATFLALFPIVNPFGGVPFFFSL |
| Ga0265339_104796221 | 3300031249 | Rhizosphere | VTYAHALGQFLRTLPASAAATFLALFPIVDPFGGIPI |
| Ga0170818_1109644941 | 3300031474 | Forest Soil | MTATHALGEFLRTLPRSALATFLALFPIVDPFGGVP |
| Ga0310686_1096430662 | 3300031708 | Soil | MTPTTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFS |
| Ga0310686_1193310842 | 3300031708 | Soil | MNATHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFSMTSSWTAQD |
| Ga0265342_100287993 | 3300031712 | Rhizosphere | MGPGHAFGEFLRTLPASAAATFLALFPIVDPFGGIPIFFTMT |
| Ga0307469_108241361 | 3300031720 | Hardwood Forest Soil | MIPAHAHALGQFLRTLPESAVATFLALFPIVDPFGGVPV |
| Ga0307469_114065831 | 3300031720 | Hardwood Forest Soil | MTSSHVLGHLLHTLPASAAAIFLALFPIVDPFGGIPIFYTMTSQWS |
| Ga0307475_104596022 | 3300031754 | Hardwood Forest Soil | MTSTHALGQFLRTLPHSAAATFLALFPIVDPFGGIPIFFTMTSSW |
| Ga0307478_117748841 | 3300031823 | Hardwood Forest Soil | MNTAQALGHFLRTLPHSAAATFLALFPIVDPPGGIPIF |
| Ga0306923_103393651 | 3300031910 | Soil | MTAAHALGHFLRTLPASAAATFLALFPIVDPFGGIPVFFTMTSSWTP |
| Ga0306923_117035192 | 3300031910 | Soil | MTSAHALGQFLRTLPASAAATFLALFPIVDPFGGVPV |
| Ga0306921_109270751 | 3300031912 | Soil | MTSAHALGQFLRTLPASAAATFLALFPIVDPFGGVPVFFS |
| Ga0310912_106169832 | 3300031941 | Soil | MTAAHALGHFLRTLPASAAATFLALFPIVDPFGGIP |
| Ga0306922_103671691 | 3300032001 | Soil | MTSAHALGQFLRTLPASAAATFLALFPIVDPFGGVPVFFSMTSRWDP |
| Ga0335085_108123431 | 3300032770 | Soil | MTSAHALGQFLRTLPASAAATFLALFPIVDPFGGIPIF |
| Ga0335079_102892221 | 3300032783 | Soil | MNAAHALGHFLRTLPASAAATFLALFPIVDPFGGVPIFFTMTSGWTRRDRYRTA |
| Ga0335077_121910581 | 3300033158 | Soil | MNSAHALGHFLRTLPASAAATFLALFPIVDPFGGIPIFFSMTSSWTAR |
| Ga0310914_104612441 | 3300033289 | Soil | MTAAHALGHFLRTLPASAAATFLALFPIVDPFGGIPVFFTMTSSWTPRDRY |
| ⦗Top⦘ |