NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087452

Metagenome Family F087452

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087452
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 44 residues
Representative Sequence MPRWMRDKLTWIVVFAAIAAASSSYSAYKVYLMTDGKAVPTKGKR
Number of Associated Samples 93
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.55 %
% of genes near scaffold ends (potentially truncated) 21.82 %
% of genes from short scaffolds (< 2000 bps) 84.55 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.909 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.636 % of family members)
Environment Ontology (ENVO) Unclassified
(30.909 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(59.091 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 42.47%    β-sheet: 0.00%    Coil/Unstructured: 57.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00571CBS 10.00
PF06627DUF1153 7.27
PF02557VanY 6.36
PF13763DUF4167 4.55
PF00072Response_reg 3.64
PF04828GFA 1.82
PF00691OmpA 1.82
PF02515CoA_transf_3 0.91
PF05853BKACE 0.91
PF04186FxsA 0.91
PF08501Shikimate_dh_N 0.91
PF05257CHAP 0.91
PF01252Peptidase_A8 0.91
PF01255Prenyltransf 0.91
PF14534DUF4440 0.91
PF12599DUF3768 0.91
PF10503Esterase_PHB 0.91
PF00005ABC_tran 0.91
PF08837DUF1810 0.91
PF00156Pribosyltran 0.91
PF05598DUF772 0.91
PF00816Histone_HNS 0.91
PF12802MarR_2 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG1876LD-carboxypeptidase LdcB, LAS superfamilyCell wall/membrane/envelope biogenesis [M] 6.36
COG2173D-alanyl-D-alanine dipeptidaseCell wall/membrane/envelope biogenesis [M] 6.36
COG0597Lipoprotein signal peptidaseCell wall/membrane/envelope biogenesis [M] 1.82
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.82
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 0.91
COG0169Shikimate 5-dehydrogenaseAmino acid transport and metabolism [E] 0.91
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.91
COG2916DNA-binding protein H-NSTranscription [K] 0.91
COG3030FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 familyGeneral function prediction only [R] 0.91
COG3246Uncharacterized conserved protein, DUF849 familyFunction unknown [S] 0.91
COG5579Uncharacterized conserved protein, DUF1810 familyFunction unknown [S] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.91 %
UnclassifiedrootN/A39.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101912407All Organisms → cellular organisms → Bacteria → Proteobacteria3248Open in IMG/M
3300000550|F24TB_13363563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300000787|JGI11643J11755_11094398Not Available551Open in IMG/M
3300000789|JGI1027J11758_12523154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300000956|JGI10216J12902_118874098Not Available641Open in IMG/M
3300004114|Ga0062593_101324836Not Available764Open in IMG/M
3300004463|Ga0063356_100445771All Organisms → cellular organisms → Bacteria → Proteobacteria1687Open in IMG/M
3300004463|Ga0063356_105270313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300004479|Ga0062595_100931719Not Available736Open in IMG/M
3300004479|Ga0062595_102038121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300005093|Ga0062594_102717348Not Available548Open in IMG/M
3300005177|Ga0066690_10671719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300005332|Ga0066388_100136209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium3011Open in IMG/M
3300005334|Ga0068869_100691381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales869Open in IMG/M
3300005353|Ga0070669_100591061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria929Open in IMG/M
3300005367|Ga0070667_102208066Not Available518Open in IMG/M
3300005440|Ga0070705_101634275Not Available543Open in IMG/M
3300005441|Ga0070700_100784774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria766Open in IMG/M
3300005457|Ga0070662_101259919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria636Open in IMG/M
3300005518|Ga0070699_101975519Not Available533Open in IMG/M
3300005564|Ga0070664_101282008Not Available692Open in IMG/M
3300005577|Ga0068857_102091720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300005719|Ga0068861_102152350Not Available558Open in IMG/M
3300005764|Ga0066903_100937927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1572Open in IMG/M
3300006038|Ga0075365_10023721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3861Open in IMG/M
3300006038|Ga0075365_10066411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2420Open in IMG/M
3300006042|Ga0075368_10039619All Organisms → cellular organisms → Bacteria → Proteobacteria1848Open in IMG/M
3300006046|Ga0066652_100126617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2106Open in IMG/M
3300006046|Ga0066652_100565099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1067Open in IMG/M
3300006046|Ga0066652_100816195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria891Open in IMG/M
3300006051|Ga0075364_10096263Not Available1968Open in IMG/M
3300006177|Ga0075362_10751405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300006178|Ga0075367_10010957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4778Open in IMG/M
3300006196|Ga0075422_10323847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium666Open in IMG/M
3300006353|Ga0075370_10915103Not Available536Open in IMG/M
3300006791|Ga0066653_10094422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1350Open in IMG/M
3300006844|Ga0075428_100027717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6267Open in IMG/M
3300006844|Ga0075428_100544577Not Available1241Open in IMG/M
3300006845|Ga0075421_100000477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae42013Open in IMG/M
3300006846|Ga0075430_101029260Not Available678Open in IMG/M
3300006852|Ga0075433_10141823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2136Open in IMG/M
3300006852|Ga0075433_10169678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1942Open in IMG/M
3300006852|Ga0075433_10809250All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300006852|Ga0075433_10947824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales750Open in IMG/M
3300006854|Ga0075425_101698293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium710Open in IMG/M
3300007076|Ga0075435_100606191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria950Open in IMG/M
3300009156|Ga0111538_10150690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2955Open in IMG/M
3300009156|Ga0111538_14113508All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300009162|Ga0075423_11097825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium847Open in IMG/M
3300009176|Ga0105242_12975670Not Available524Open in IMG/M
3300009837|Ga0105058_1184498Not Available517Open in IMG/M
3300010038|Ga0126315_10061349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2071Open in IMG/M
3300010044|Ga0126310_11524798Not Available549Open in IMG/M
3300010046|Ga0126384_11608694Not Available612Open in IMG/M
3300010366|Ga0126379_12569401Not Available607Open in IMG/M
3300010366|Ga0126379_13227591Not Available546Open in IMG/M
3300010397|Ga0134124_12359620Not Available573Open in IMG/M
3300010399|Ga0134127_10319496Not Available1503Open in IMG/M
3300010400|Ga0134122_11143954Not Available775Open in IMG/M
3300011119|Ga0105246_10833442Not Available821Open in IMG/M
3300011440|Ga0137433_1012704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium2484Open in IMG/M
3300012081|Ga0154003_1097417Not Available513Open in IMG/M
3300012349|Ga0137387_10783590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300012930|Ga0137407_11053634Not Available771Open in IMG/M
3300012944|Ga0137410_10377305Not Available1139Open in IMG/M
3300012948|Ga0126375_10862375All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012957|Ga0164303_10451909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria809Open in IMG/M
3300012961|Ga0164302_10109070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1549Open in IMG/M
3300012987|Ga0164307_10485336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria930Open in IMG/M
3300014325|Ga0163163_13293545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300014326|Ga0157380_11598640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria707Open in IMG/M
3300014968|Ga0157379_10726854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria933Open in IMG/M
3300015084|Ga0167654_1044745Not Available624Open in IMG/M
3300015195|Ga0167658_1005494All Organisms → cellular organisms → Bacteria4332Open in IMG/M
3300015195|Ga0167658_1009793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3001Open in IMG/M
3300015371|Ga0132258_13314320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1108Open in IMG/M
3300015373|Ga0132257_100099848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3339Open in IMG/M
3300017792|Ga0163161_11549952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria583Open in IMG/M
3300017997|Ga0184610_1031994Not Available1481Open in IMG/M
3300018053|Ga0184626_10097022Not Available1248Open in IMG/M
3300018056|Ga0184623_10034416Not Available2290Open in IMG/M
3300018422|Ga0190265_12786546Not Available584Open in IMG/M
3300018429|Ga0190272_10397098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1123Open in IMG/M
3300018429|Ga0190272_11069629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium778Open in IMG/M
3300018429|Ga0190272_11452946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria693Open in IMG/M
3300018429|Ga0190272_11453474Not Available693Open in IMG/M
3300018433|Ga0066667_10311950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1230Open in IMG/M
3300018476|Ga0190274_11044274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium894Open in IMG/M
3300018482|Ga0066669_10145118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1736Open in IMG/M
3300019377|Ga0190264_10743008Not Available734Open in IMG/M
3300021560|Ga0126371_11367681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria840Open in IMG/M
3300025899|Ga0207642_11098915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300025918|Ga0207662_10372550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria963Open in IMG/M
3300025926|Ga0207659_11864776Not Available510Open in IMG/M
3300025936|Ga0207670_11159303Not Available653Open in IMG/M
3300025972|Ga0207668_12045376Not Available516Open in IMG/M
3300025972|Ga0207668_12067486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300026035|Ga0207703_11846796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria580Open in IMG/M
3300026067|Ga0207678_11936882Not Available514Open in IMG/M
3300026075|Ga0207708_10741974Not Available842Open in IMG/M
3300026118|Ga0207675_102222498Not Available563Open in IMG/M
3300026377|Ga0257171_1079068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium579Open in IMG/M
3300027866|Ga0209813_10022466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1784Open in IMG/M
3300027866|Ga0209813_10133831Not Available874Open in IMG/M
3300027909|Ga0209382_10004227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae19316Open in IMG/M
3300028536|Ga0137415_10268356Not Available1513Open in IMG/M
3300031716|Ga0310813_10869384Not Available816Open in IMG/M
3300031720|Ga0307469_11200366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales717Open in IMG/M
3300032180|Ga0307471_100288300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1721Open in IMG/M
3300034965|Ga0370497_0035668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1066Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.18%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere8.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.73%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.73%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.91%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.91%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012081Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaGHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015084Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)EnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10191240743300000364SoilMRWIRDKMTWVVLFAAIAATSSAYSAYKLYLMTDGRPVPATKSKR*
F24TB_1336356313300000550SoilMPRWLIDXXXXXXIFAAIAAASSSYSAYKIYLMTDGKPPVVKGKR*
JGI11643J11755_1109439823300000787SoilMRDKLTWILVFAFISAGGSTYSAYKVYQMTDGRPAPTKNKR*
JGI1027J11758_1252315413300000789SoilMPRWLXDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR*
JGI10216J12902_11887409823300000956SoilMPRWMRDKITWVVLFAGIAAASSAYSAYKLFQMPDGKLLASKSKR*
Ga0062593_10132483623300004114SoilMRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSKR*
Ga0063356_10044577133300004463Arabidopsis Thaliana RhizosphereMRDKLTWILVFAFIAAGGSTYSAYKVYQMTDGRPAPTKNKR*
Ga0063356_10527031313300004463Arabidopsis Thaliana RhizosphereMPRWLTDKLIWILVFAAIAAGASSYGAYKTYLMTDGKSVPAKGKR*
Ga0062595_10093171913300004479SoilCSRVGPRGEDREMPRWLTDKMTWLVVFAAIAAASSSYSAYKIYQMTDGKPVATKGKR*
Ga0062595_10203812113300004479SoilMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVVKGKR*
Ga0062594_10271734823300005093SoilTKREDREMPRWLTDKMTWLVVFAALAAASSSYSAYKIYQMTDGKPVPTKGKR*
Ga0066690_1067171913300005177SoilMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVA
Ga0066388_10013620943300005332Tropical Forest SoilMRWLTDKSLWLVLLAAIAAASSSYSAYKIYQMTDGKAAAAAAKSRR*
Ga0068869_10069138113300005334Miscanthus RhizosphereVGEKDVHMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR*
Ga0070669_10059106123300005353Switchgrass RhizosphereMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKG
Ga0070667_10220806623300005367Switchgrass RhizosphereMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR
Ga0070705_10163427523300005440Corn, Switchgrass And Miscanthus RhizosphereMPRWMRDKLTWIVVFAAIAAASSSYSAYKVYLMTDGKAVPTKGKR*
Ga0070700_10078477423300005441Corn, Switchgrass And Miscanthus RhizosphereMPRWIRDKLTWIVVFAAIAAASSVYSAYKLYQMTDGRPVPTKSKR*
Ga0070662_10125991923300005457Corn RhizosphereMPRWLTDRMTWLVIFAAIGAASSSYSAYKIYLMTDGKPPVVKGKR*
Ga0070699_10197551913300005518Corn, Switchgrass And Miscanthus RhizosphereMLPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR*
Ga0070664_10128200823300005564Corn RhizosphereMPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPGPVPAKSKR*
Ga0068857_10209172023300005577Corn RhizosphereMPRGLTDRLTWILVFAAIAAASSSYAAYKIYLMTDARPVPTK
Ga0068861_10215235013300005719Switchgrass RhizosphereMPRWMRDKLTWVVLFVGIAAASSAYSAYKLFQMTDGRLVASKSKR*
Ga0066903_10093792723300005764Tropical Forest SoilMPRWMRDKLTWIVVFAAVAAVSSAYSAYKLYQMTDGRPVPTKSRK*
Ga0075365_1002372143300006038Populus EndosphereMRDKLTWILVFAFIAAGGSSYSAYKTYQMTDGRPAPTKNKR*
Ga0075365_1006641133300006038Populus EndosphereMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR*
Ga0075368_1003961913300006042Populus EndosphereMPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR*
Ga0066652_10012661733300006046SoilMPRWLRDKMTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKAKR*
Ga0066652_10056509913300006046SoilMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR*
Ga0066652_10081619523300006046SoilMPRWLIDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR*
Ga0075364_1009626333300006051Populus EndosphereMPRWMRDKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR*
Ga0075362_1075140523300006177Populus EndosphereDVHMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR*
Ga0075367_1001095763300006178Populus EndosphereMPRWMREKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR*
Ga0075422_1032384723300006196Populus RhizosphereMRWITDKMTWFMVFAAIAAASSSYSAYKTYSMTDGK
Ga0075370_1091510323300006353Populus EndosphereMPRWMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPV
Ga0066653_1009442223300006791SoilMPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDARTPVTKAKR*
Ga0075428_10002771753300006844Populus RhizosphereMRWITDKMTWLMVFAAIAAASSSYSAYKTYLMTDGKAVPTAVPTKGKR*
Ga0075428_10054457723300006844Populus RhizosphereMPRWMKDKLTWILVLAFITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0075421_100000477133300006845Populus RhizosphereMRWLRDKTLWVMLFAAIAAASSSYSAYKVYQMTDGKAAPTKAKGKR*
Ga0075430_10102926023300006846Populus RhizosphereMRWLRDKMTWLAVLVAIAAASSSYSAYKIYLMTDGKAVPAKGKR*
Ga0075433_1014182353300006852Populus RhizosphereMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR*
Ga0075433_1016967823300006852Populus RhizosphereMPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDSKMPVTKAKR*
Ga0075433_1080925023300006852Populus RhizosphereMPRWMKDRLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0075433_1094782423300006852Populus RhizosphereMRWIKDKMTWVVLFAAIAATSSAYSAYKLYQMTDGRPVPATKSKR*
Ga0075425_10169829323300006854Populus RhizosphereMTWLVILAAIAAASSSYSAYKIYLMTDSKMPVTKAKR*
Ga0075435_10060619123300007076Populus RhizosphereMPRWLTDRMTWLVIFAAIGAASSSYSAYKIYLMTDGKPPV
Ga0111538_1015069013300009156Populus RhizosphereRWMKDRLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0111538_1411350813300009156Populus RhizosphereMPRWMKDKLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0075423_1109782523300009162Populus RhizosphereMPRWMNNKLTWILVLALITAGSSGYSAYKIYLMTDGKAAPAKGRR*
Ga0105242_1297567023300009176Miscanthus RhizosphereMPRWFTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR*
Ga0105058_118449813300009837Groundwater SandMRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK*
Ga0126315_1006134933300010038Serpentine SoilMREKLTWVVLFAGIAAASSAYSAYKLFQMTDGRLVASKSKR*
Ga0126310_1152479823300010044Serpentine SoilMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR*
Ga0126384_1160869423300010046Tropical Forest SoilRSTSGVRRMPRWITDKLAWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR*
Ga0126379_1256940113300010366Tropical Forest SoilMRDKLTWIVVFAAVAAASSAYSAYKLYQMTDGRPVPTKSRK*
Ga0126379_1322759123300010366Tropical Forest SoilMPRWITDKLAWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR*
Ga0134124_1235962013300010397Terrestrial SoilLVGKLLLQGRTKREDREMPRWLTDKMTWLVVFAAIAAASSSYSAYKIYQMTDGKPVPTKGKR*
Ga0134127_1031949613300010399Terrestrial SoilMRDKLTWIVVFAAVAAASSSYSAYKVYLMTDGKAVPTKGKR*
Ga0134122_1114395423300010400Terrestrial SoilMPRWIRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKSKR*
Ga0105246_1083344223300011119Miscanthus RhizosphereMRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKSKR*
Ga0137433_101270443300011440SoilMPRWMRDKLTWIVVFAAIAAASSSYSAYKIYLMTDGKAVPTKGRR*
Ga0154003_109741723300012081Attine Ant Fungus GardensMRDKLTWILVFAFIAAGGSSYSAYKVYQMTDGRPAPTKNK
Ga0137387_1078359013300012349Vadose Zone SoilMPRWLTDKLTWVLIFAAIAAASSSYGAYKIYLMTDGK
Ga0137407_1105363423300012930Vadose Zone SoilMIWLLLLAAIAAASSSYSAYKVYLMTDGRPVPTKGKR*
Ga0137410_1037730533300012944Vadose Zone SoilMTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKAKR*
Ga0126375_1086237513300012948Tropical Forest SoilMPRWITDKLTWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR*
Ga0164303_1045190913300012957SoilMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVTKGKR*
Ga0164302_1010907033300012961SoilMPRGLTDRLTWILVFAAIAAASSSYAAYKIYLMTDARPVPTKAKR*
Ga0164307_1048533623300012987SoilMPRWFTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVTKGKR*
Ga0163163_1329354513300014325Switchgrass RhizosphereMPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPS
Ga0157380_1159864023300014326Switchgrass RhizosphereMSRWLTDKLTWILILAAIAAASSSYGAYKIYLMTDGKPA
Ga0157379_1072685423300014968Switchgrass RhizosphereMPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVSVKSKR*
Ga0167654_104474523300015084Glacier Forefield SoilMPRWIRDKLTWIVVFAAIAAASSAYSAYKLYQMTDGRPVPTKGKR*
Ga0167658_100549433300015195Glacier Forefield SoilMPRWLRDKLTWILVFAAVAAVSSTYSAYKTYQMTDGRQVPAKSRR*
Ga0167658_100979343300015195Glacier Forefield SoilMTWLVILAAIAAASSSYSAYKIYLMTDAKTPVTKARR*
Ga0132258_1331432013300015371Arabidopsis RhizosphereMPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR*
Ga0132257_10009984863300015373Arabidopsis RhizosphereMPRWLIDRMTWLLIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR*
Ga0163161_1154995213300017792Switchgrass RhizosphereMPRWLTDRMTWLVIFATIAAASSSYSAYKIYLMTDGKPPVAKGKR
Ga0184610_103199423300017997Groundwater SedimentMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK
Ga0184626_1009702213300018053Groundwater SedimentGSDAPMRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK
Ga0184623_1003441623300018056Groundwater SedimentMRWMRDKLTWIVLFAAIAAGSSSYSAYKIYLMTDGKPAPVKGKK
Ga0190265_1278654613300018422SoilMPRWLTDKLTWILILAAISAASSSYGAYKIYLMTDGKPVPARGKR
Ga0190272_1039709813300018429SoilMRWIRDKMTWLVVFAAIAAATSSYNAYKIYLMTDGKPVPAAAKAKR
Ga0190272_1106962933300018429SoilMPRWLTDKMTWILVFAAIAAASSSYGAYKTYLMTDGK
Ga0190272_1145294613300018429SoilMPRWMKDKLTWILVLAFISAASSGYSAYKIYLMTDGKPAPAKGRR
Ga0190272_1145347413300018429SoilMTWLVVFAAIAATSSSYSAYKIYLMTDGKAAPAAKGRR
Ga0066667_1031195023300018433Grasslands SoilMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPVAKGKR
Ga0190274_1104427423300018476SoilMRDKLTWIVVFAAIAAASSAYSAYKMYQMTDGRPVPAKSKR
Ga0066669_1014511823300018482Grasslands SoilMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKPPIAKGKR
Ga0190264_1074300813300019377SoilMRWFRDKMTWLVVFAAIAATSSSYSAYKIYLMTDGKAAPPVKGKR
Ga0126371_1136768123300021560Tropical Forest SoilMPRWITDKLTWILVFAAIAAGSSSYCAYKIYLMTDGKLVPTKAKR
Ga0207642_1109891523300025899Miscanthus RhizosphereMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTGGKPPVV
Ga0207662_1037255023300025918Switchgrass RhizosphereMRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSKR
Ga0207659_1186477623300025926Miscanthus RhizosphereMRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAPTKSK
Ga0207670_1115930323300025936Switchgrass RhizosphereMPRWLTDKLTWVLVFAAIAAASSSYGAYKIYLMTDGKPSSVPVKSKR
Ga0207668_1204537623300025972Switchgrass RhizosphereMRDKLTWVVVFAGIAAASSAYSAYKLYQMTDGRPMATKSKR
Ga0207668_1206748613300025972Switchgrass RhizosphereMPRWLRDRMTWLVILAAIAAASSSYSAYKIYLMTDAKTPLTKAKR
Ga0207703_1184679613300026035Switchgrass RhizosphereMPRWLTDRMTWLVIFAAIAAASSSYSAYKIYLMTDGKP
Ga0207678_1193688223300026067Corn RhizosphereMRDKLTWILVFAVIAAGGSSYSAYKAYQMTDGRPAP
Ga0207708_1074197423300026075Corn, Switchgrass And Miscanthus RhizosphereMTAEDESMPRWIRDKLTWIVVFAAIAAASSVYSAYKLYQMTDGRPVPTKSKR
Ga0207675_10222249823300026118Switchgrass RhizosphereMPRWMRDKLTWVVLFVGIAAASSAYSAYKLFQMTDGRLVASKSKR
Ga0257171_107906813300026377SoilPRWLRDRMTWLVVLAAIAAASSSYSAYKIYLMTDAKTPVTKVKR
Ga0209813_1002246643300027866Populus EndosphereMPRWIRDKLTWIAVFAAIAAASSAYSAYKLYQMTDGRPVPAKSKR
Ga0209813_1013383123300027866Populus EndosphereMRWIKDKMTWVVLFAAIAATSSAYSAYKLYLMTDGRPVPASKSKR
Ga0209382_10004227103300027909Populus RhizosphereMRWLRDKTLWVMLFAAIAAASSSYSAYKVYQMTDGKAAPTKAKGKR
Ga0137415_1026835623300028536Vadose Zone SoilMTWLVLFAAIAAASSSYSAYKIYLMTDGKPVLTKAKR
Ga0310813_1086938413300031716SoilMRWIKDKMTWVVLFAAIAATSSAYSAYKLYQMTDGRPVPATKSKR
Ga0307469_1120036623300031720Hardwood Forest SoilMRWIRDKMTWVVVFAAIAATSSAYSAYKLYQMTDGRPAPTTKSKR
Ga0307471_10028830043300032180Hardwood Forest SoilMRWITDKMTWLMVFAAIAAASSSYSAYKTYLMTDGKAVPTAVPTKGKR
Ga0370497_0035668_211_3543300034965Untreated Peat SoilMPRWLTDKMTWLIVLAAITAASSSYSAYKLYLMTDGKPAAASTKSKR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.