Basic Information | |
---|---|
Family ID | F087431 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 37 residues |
Representative Sequence | KHVKWNAIPPLKGPNPQGLIKDKKQDKKKQENLNGRYR |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (56.364 % of family members) |
Environment Ontology (ENVO) | Unclassified (94.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.09% β-sheet: 0.00% Coil/Unstructured: 90.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF01106 | NifU | 2.73 |
PF00166 | Cpn10 | 0.91 |
PF03237 | Terminase_6N | 0.91 |
PF13640 | 2OG-FeII_Oxy_3 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 2.73 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 56.36% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 11.82% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.45% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.55% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.73% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.82% |
Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.82% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.82% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.82% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.82% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.82% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.91% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.91% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.91% |
Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.91% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.91% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.91% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.91% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.91% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001738 | Marine viral communities from the Deep Pacific Ocean - MSP-118 | Environmental | Open in IMG/M |
3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
3300006768 | Marine viral communities from Cariaco Basin, Caribbean Sea - 29_WHOI_OMZ | Environmental | Open in IMG/M |
3300006856 | Marine viral communities from Cariaco Basin, Caribbean Sea - 25B_WHOI_OMZ_CsCl | Environmental | Open in IMG/M |
3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
3300006988 | Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl | Environmental | Open in IMG/M |
3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
3300008735 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022845 | Saline water microbial communities from Ace Lake, Antarctica - #602 | Environmental | Open in IMG/M |
3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
3300025028 | Marine viral communities from Cariaco Basin, Caribbean Sea - 29_WHOI_OMZ (SPAdes) | Environmental | Open in IMG/M |
3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
3300025047 | Marine viral communities from the Pacific Ocean - LP-42 (SPAdes) | Environmental | Open in IMG/M |
3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
3300025218 | Marine viral communities from the Deep Pacific Ocean - MSP-103 (SPAdes) | Environmental | Open in IMG/M |
3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
3300025244 | Marine viral communities from the Deep Pacific Ocean - MSP-81 (SPAdes) | Environmental | Open in IMG/M |
3300025247 | Marine viral communities from the Deep Pacific Ocean - MSP-91 (SPAdes) | Environmental | Open in IMG/M |
3300025278 | Marine viral communities from the Deep Pacific Ocean - MSP-82 (SPAdes) | Environmental | Open in IMG/M |
3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
3300025281 | Marine viral communities from the Deep Pacific Ocean - MSP-97 (SPAdes) | Environmental | Open in IMG/M |
3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
3300025301 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes) | Environmental | Open in IMG/M |
3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
3300026079 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A (SPAdes) | Environmental | Open in IMG/M |
3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031655 | Marine microbial communities from water near the shore, Antarctic Ocean - #282 | Environmental | Open in IMG/M |
3300031683 | Marine microbial communities from water near the shore, Antarctic Ocean - #69 | Environmental | Open in IMG/M |
3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
3300031703 | Marine microbial communities from water near the shore, Antarctic Ocean - #34 | Environmental | Open in IMG/M |
3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
3300031848 | Marine microbial communities from water near the shore, Antarctic Ocean - #3 | Environmental | Open in IMG/M |
3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24657J20077_10147693 | 3300001738 | Deep Ocean | WRAIPPLKGPNPEGLRKVKEQDTKKPESLNGRHR* |
JGI25129J35166_10544592 | 3300002484 | Marine | NMQHVKWSQIPPLRGPNPQGLRKDVKQDTKKPEKLNGRQSNR* |
JGI25129J35166_10997161 | 3300002484 | Marine | MKDVKWNAIPPLKGPNPQGLIKVVKKDKKKQENLNGRXX* |
Ga0075445_100310112 | 3300006193 | Marine | VKLNEIPPLKGPNSQGLIKEIKKDKKNTEKLNGRYR* |
Ga0068482_12489151 | 3300006338 | Marine | MQHVKWSQIPPLRGPNPEGLRKDKEQDTKKPEKLNGRR* |
Ga0068482_13153291 | 3300006338 | Marine | MKHVKWRAIPPLKGPTPQGLRKEVKQDTKKPESLNGRHR* |
Ga0068481_13349842 | 3300006339 | Marine | SQIPPLRGPNPEGLRKPIKQDTKKPEKLNGRQSNR* |
Ga0098033_10485412 | 3300006736 | Marine | KNMQHVKWKEIPPLKGPNPQGLRKDLKQDTKKPEKLNGRQSNR* |
Ga0098033_11086681 | 3300006736 | Marine | KWKAIPPLRGPNPQGLIKDKKQDRPIQENKYGRYR* |
Ga0098035_11418862 | 3300006738 | Marine | MKHVKLNAIPPLKGPNPEGLIKVVKKDKKKQENLNGRNR* |
Ga0098035_12171761 | 3300006738 | Marine | WNAIPPLKGPNPQGLIKVVKKDKKKQENLNGRYR* |
Ga0098058_10361152 | 3300006750 | Marine | MKHVKWNAIPPLKGPNPQGLIKVAKKDKKKQENLNGRN |
Ga0098040_10177792 | 3300006751 | Marine | MQHVKWKEIPPLKGPNPQGLRKDLKQDTKKPEKLNGRQSNR* |
Ga0098040_10573682 | 3300006751 | Marine | WKEIPPLKGPNPQGLRKDLKQDTKKPEKLNGRQSNR* |
Ga0098039_10941212 | 3300006753 | Marine | MKHVKWNAIPPLKGPNPQGLIKVAKKDKKKQENLN |
Ga0098044_12663421 | 3300006754 | Marine | MKHVKWRAIPPLKGPSPQGLRKEVKQDTKKPESLNGRHR* |
Ga0098071_1030013 | 3300006768 | Marine | MKHVKWSQIPPLRGPNPQGLRKEVKQDTKKTEKLNGRQSNR* |
Ga0098066_10527742 | 3300006856 | Marine | WSQIPPLRGPNPQGLRKDVKQDTKKPEKLNGRQSNR* |
Ga0066376_107969902 | 3300006900 | Marine | HVKWNAIPPLKGPDPKGLIKDKKQDKPIQEKKYGRY* |
Ga0098060_11807171 | 3300006921 | Marine | HVKWKAIPPLKGPNPQGLIKVEKKDKSKQENLNGRNR* |
Ga0098053_11086932 | 3300006923 | Marine | VKWSQIPPLRGPNPQGLRKEVKQDTKKLEKLNGRQSNR* |
Ga0098051_12039981 | 3300006924 | Marine | KWKAIPPLKGPNPQGLIKVEKKDKNKPEKIYGRYR* |
Ga0098041_10513382 | 3300006928 | Marine | MKHVKWSQIPPLRGPNPQGLRKEVKQDTKKLEKLNGRQSNR* |
Ga0098041_12782392 | 3300006928 | Marine | KWNTIPPLKGPNPQGLIKDKKQDKKKQENLNGRNR* |
Ga0098036_10105214 | 3300006929 | Marine | HVKWNAIPPLKGPNPEGLIKVVKKDKKKQENLNGRNR* |
Ga0098036_12278371 | 3300006929 | Marine | KWKEIPPLRGPNPQGLIKDKKQDKKKQENLNGRNR* |
Ga0075444_100956932 | 3300006947 | Marine | FNAIPPLQGPNPQGLIKQNKQDKPSKEKKYGRYR* |
Ga0098064_1222392 | 3300006988 | Marine | WSQIPPLRGPNPQGLRKEVKQDTKKPEKLNGRQSNR* |
Ga0098064_1476732 | 3300006988 | Marine | KWKEIPPLRGPNPEGLIKPKKQDKKKQENLNGRNR* |
Ga0110931_11041572 | 3300007963 | Marine | VKWNAIPPLKGPNPEGLIKNKKQDKKKQENLNGRYR* |
Ga0098052_11078402 | 3300008050 | Marine | VKWKAIPPLKGPNPQGLIKVEKKDKNKQENLNGRNR* |
Ga0098052_11400771 | 3300008050 | Marine | VKWNAIPPLKGPNPQGLIKVVKKDKKKQENLNGRYR* |
Ga0114916_11207922 | 3300008221 | Deep Ocean | VKWKEIPPLKGPNSQGLIKDKKQDKPIQENKYGRYR* |
Ga0115371_101138751 | 3300008470 | Sediment | NMKYVKFDQIPPVSGPNPQGLIKDKKQDKPIQENKYGRYR* |
Ga0115657_13393752 | 3300008735 | Marine | VKWKEIPPLRGPSSQGLIKDKKQDKKKQENLNGRNR* |
Ga0102963_10235941 | 3300009001 | Pond Water | KWESIPPLRGPNPQGLIKEKKQDKLIQEKKYGRYR* |
Ga0114996_100712074 | 3300009173 | Marine | VKWSQIPPLKGPDPQGLRKVVKKDKKNTEKLNGRCR* |
Ga0114993_108106292 | 3300009409 | Marine | KHVKWKEIPPLKGPNSQGLIKDKKQDKQIQEKKYGRY* |
Ga0114994_104465831 | 3300009420 | Marine | KWKEIPPLKGPNSQGLIKDKKQDKPIQENKYGRYR* |
Ga0115007_110335982 | 3300009441 | Marine | VKFNSIPPLRGPNPQGLIKEKKQDKPSKEKKYGRYR* |
Ga0115555_11842891 | 3300009476 | Pelagic Marine | KWKEIPPLRGPNPQGLIKDKKQDKPIQENKYGRYR* |
Ga0115004_104835791 | 3300009526 | Marine | KNKKHVKCDSIPPLKGPDPKGLITDKKQHRTRQEKKYGRYR* |
Ga0114911_10109441 | 3300009603 | Deep Ocean | WKTLPPLKGPTPQGLRKEVKQDTKKPESLNGRYR* |
Ga0105236_10441331 | 3300009619 | Marine Oceanic | VKWNAIPPLKGPDPKGLIKDKKQDKPIQEKKYGRY* |
Ga0105236_10588222 | 3300009619 | Marine Oceanic | VKWKEIPPLRGPNPQGLIKDKKQDKKKQENLNGRNR* |
Ga0098056_10737192 | 3300010150 | Marine | VKWKAIPPLKGPNPQGLIKVEKKDKNKPEKIYGRYR* |
Ga0181367_10837562 | 3300017703 | Marine | MKHVKLNAIPPLKGPNPEGLIKVVKKDKKKQENLNGRNR |
Ga0181432_11255051 | 3300017775 | Seawater | KWKAIPPLKGPNPEGLRKEVKQDTKKPESLNGRYR |
Ga0181394_12638331 | 3300017776 | Seawater | HVKWKAIPPLRGPNSQGLIKDKKQDKPIPEKKYGRY |
Ga0211680_102713102 | 3300020389 | Marine | MKYVKFDQIPPLKGPSSQGLIKEQKQDKPIQDKKYGRYR |
Ga0196899_10201441 | 3300022187 | Aqueous | VKWKSIPPLRGPNPQGLIKEKKQDKLIQEKKYGRYR |
Ga0222663_10167052 | 3300022845 | Saline Water | MLNVKWDQIPPLSGPEPRGLINETKQDKLIQDKKYGRYR |
(restricted) Ga0255047_102650851 | 3300024520 | Seawater | MKYVKWKAIPPLKGPNPEGLRKEIKQDTKKPEKLNGRYR |
Ga0208302_1041282 | 3300025028 | Marine | MKHVKWSQIPPLRGPNPQGLRKEVKQDTKKTEKLNGRQSNR |
Ga0207889_10071132 | 3300025042 | Marine | MQHVKWSQIPPLRGPNPEGLRKEVKQDTKKPEKLNGRQSNR |
Ga0207902_10274452 | 3300025046 | Marine | KWKAIPPLKGPDPQGLRKEVKQDTKKPESLNGRESNR |
Ga0207897_1231131 | 3300025047 | Marine | VKWKAIPPLKGPTPQGLRKEVKQDTKKPESLNGRYR |
Ga0207898_10153342 | 3300025049 | Marine | MKHVKWKAIPPLKGPNPEGLRKEVKQDTKKPESLNGRESSR |
Ga0208012_10296012 | 3300025066 | Marine | MKHVKWSQIPPLRGPNPQGLRKEVKQDTKKLEKLNGRQSNR |
Ga0208668_10136321 | 3300025078 | Marine | MQHVKWKEIPPLKGPNPQGLRKDLKQDTKKPEKLNGRQSNR |
Ga0208156_10291812 | 3300025082 | Marine | KNMQHVKWKEIPPLKGPNPQGLRKDLKQDTKKPEKLNGRQSNR |
Ga0208434_10280522 | 3300025098 | Marine | RHVKWNAIPPLKGPNPEGLIKVVKKDKKKQENLNGRNR |
Ga0208013_10100361 | 3300025103 | Marine | MQHVKWKEIPPLKGPNPQGLRKEVKQDTKKSEKLNGRQSNR |
Ga0208013_11621812 | 3300025103 | Marine | VKWKAIPPLKGPNPQGLIKVEKKDKNKQENLNGRNR |
Ga0209349_11142092 | 3300025112 | Marine | MQHVKWKEIPPLRGPNPQGLRKDVKQDTKKPEKLNGRQSNR |
Ga0208790_10573221 | 3300025118 | Marine | KHVKWNAIPPLKGPNPQGLIKDKKQDKKKQENLNGRYR |
Ga0208790_11381372 | 3300025118 | Marine | KWRAIPPLRGPNPQGLIKDKKQDKPIQEKKYGRYR |
Ga0209644_10054082 | 3300025125 | Marine | MQHVKWSQIPPLRGPNPQGLRKPIKQDTKKPEKLNGRQSNR |
Ga0209644_11772531 | 3300025125 | Marine | KWKTLPPLKGPNPQGLRNEVKQDTKKSESLNGRQSNR |
Ga0208919_10302221 | 3300025128 | Marine | WKEIPPLRGPNPQGLRKDVKQDTKKPEKLNGRQSNR |
Ga0209128_10604331 | 3300025131 | Marine | MQHVKWKEIPPLKGPNPQGLRKEVKQDTKKLEKLNGRQSNR |
Ga0209756_10886911 | 3300025141 | Marine | YVKWNQIPPLKGPNPQGLRKVVKKDRTKLRSLNGRQSNR |
Ga0207882_10362261 | 3300025218 | Deep Ocean | HVKWKAIPPLKGPNPEGLRKVKEQDTKKLESLNGRYR |
Ga0208031_10051611 | 3300025237 | Deep Ocean | VKWKEIPPLKGPNSQGLIKDKKQDKPIQENKYGRYR |
Ga0207908_10367641 | 3300025244 | Deep Ocean | KHVKWKAIPPLRGPNPQDLRKEVKQDTKKPESLNGRQSNR |
Ga0207880_10038761 | 3300025247 | Deep Ocean | MKHVKWKAIPPLKGPNPEGLRKVKEQDTKKPESLNGRHR |
Ga0207417_10645192 | 3300025278 | Deep Ocean | KHVKWKAIPPLKGPNPEGLRKVKEQDTKKLESLNGRDR |
Ga0208449_10723642 | 3300025280 | Deep Ocean | VKNMKHVKWSQIPPLRGPNPQDLRKFLKQDTKKPEKLNGRQSNR |
Ga0207881_10059691 | 3300025281 | Deep Ocean | WKAIPPLKGPNPEGLRKVKEQDTKKPESLNGRQSNR |
Ga0208315_10036143 | 3300025286 | Deep Ocean | MQHVKWKEIPPLRGPNPQGLRKEVKQDTKKPEKLNGRQSNR |
Ga0208934_10216771 | 3300025293 | Deep Ocean | WSQIPPLRGPNPQGLRKEVKQDTKKPEKLNGRQSNR |
Ga0208450_10003243 | 3300025301 | Deep Ocean | MKHVKWSQIPPLKGPNPQDLRKEVKQDTKKPEKLNGRR |
Ga0209757_100103682 | 3300025873 | Marine | MKYVKWKAIPPLRGPNPQGLIKDKKEDKPIQEKKYGRY |
Ga0209757_101083051 | 3300025873 | Marine | VKWRAIPPLKGPNPQGLRKEVKQDTKKPESLNGRYR |
Ga0209757_101533432 | 3300025873 | Marine | KAIPPLKGPNPEGLRKVKEQDTKKPESLNGRESNR |
Ga0209757_101666292 | 3300025873 | Marine | VKWRAIPPLKGPNPEGLRKEVKQDTKKPESLNGRYR |
Ga0209757_103104962 | 3300025873 | Marine | HVKWSQIPPLRGPNPQGLRKEVKQDTKKPEKLNGRQSNR |
Ga0208748_10270321 | 3300026079 | Marine | HVKWNAIPPLKGPDPKGLIKDKKQDKPIQEKKYGRY |
Ga0208748_10890542 | 3300026079 | Marine | KHVKWKAIPPLKGPNPEGLRKVKEQDTKKLESLNGRYR |
Ga0208766_10125684 | 3300026269 | Marine | MKHVKWNAIPPLKGPNPEGLIKVVKKDKKKQENLNGRNR |
Ga0208277_10138297 | 3300026292 | Marine | VKNMKHVKWNQIPPLKGPNPQGLRKVVKKDRTKPRSLNGR |
Ga0209384_10300861 | 3300027522 | Marine | HVKFDAIPPVSGPNPQGLIKDKKQDKPIQDKKYGRYR |
Ga0209071_10598442 | 3300027686 | Marine | VKFDQIPPLKGPDSQGLIKDKKQDKPIQENKYGRYR |
Ga0209815_100415518 | 3300027714 | Marine | KFNAIPPLQGPNPQGLIKQNKQDKPSKEKKYGRYR |
Ga0209711_100490412 | 3300027788 | Marine | KLNEIPPLKGPNSQGLLKEIKKDKKNTEKLNGRYR |
(restricted) Ga0255053_102927741 | 3300027868 | Seawater | KHVKWKAIPPLRGPNPEGLRKEVKQDTKKPEKLNGRQSNR |
Ga0256381_10271531 | 3300028018 | Seawater | HVKWKAIPPLKGPNPEGLRKEVKQDTKKPESLNGRHR |
Ga0256382_10047532 | 3300028022 | Seawater | MQHVKWKEIPPLKGPASQGLRKEVKQDTKKSEKLNGRQSNR |
Ga0257107_11783172 | 3300028192 | Marine | MKNVKWKAIPPLKGPDPRGLIKDPKQYKPERLEKPTWQK |
Ga0307380_109341691 | 3300031539 | Soil | VKWDSIPPLKGPDPKGLLKDKKQDKPIQEKKYGRYR |
Ga0308018_102337592 | 3300031655 | Marine | VKFDAIPPLRGPDPQGLIKEKKQDKPIQENKYGRYR |
Ga0308006_100320171 | 3300031683 | Marine | MKYVKFDQIPPVSGPNPQGLIKDKKQDKPIQENKYGRYR |
Ga0308016_100795661 | 3300031695 | Marine | HVKFDQIPPLKGPDSQGLIKDKKQDKPIQENKYGRYR |
Ga0308002_11179731 | 3300031703 | Marine | VKFDQIPPVSGPNPQGLIKDKKQDKPIQENKYGRYR |
Ga0310122_100541481 | 3300031800 | Marine | VKWKAIPPLKGPNPEGLRKVKEQDTKKLESLNGRYR |
Ga0310122_100552761 | 3300031800 | Marine | KWKAIPPLKGPNPEGLRKVKEQDTKKPESLNGRHR |
Ga0308000_100371761 | 3300031848 | Marine | KYVKFDQIPPVSGPNPQGLIKDKKQDKPIQENKYGRYR |
Ga0310344_102718022 | 3300032006 | Seawater | MKHVKWSQIPPLRGPNPQGLRKEVKQDTKKPEKLNGRQSNR |
Ga0310342_1018522842 | 3300032820 | Seawater | KHVKWKEIPPLRGPNPQGLIKPKKQDKKKQENLNGRNR |
Ga0326756_051313_407_514 | 3300034629 | Filtered Seawater | KWKAIPPLKGPDPQGLRKVKEQDTKKLESLNGRYR |
⦗Top⦘ |