| Basic Information | |
|---|---|
| Family ID | F087429 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MADKKKTNKKKLSTLVKQQVPEFVLTDHPKFTEFLTSY |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.73 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.273 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF04965 | GPW_gp25 | 3.64 |
| PF05488 | PAAR_motif | 0.91 |
| PF14743 | DNA_ligase_OB_2 | 0.91 |
| PF11753 | DUF3310 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.27 % |
| All Organisms | root | All Organisms | 22.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.45% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 21.82% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.64% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.27% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.64% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.82% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.91% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.91% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006414 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020259 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX556041-ERR599103) | Environmental | Open in IMG/M |
| 3300020276 | Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858) | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020476 | Marine microbial communities from Tara Oceans - TARA_B100001750 (ERX556108-ERR598958) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300023245 | Saline water microbial communities from Ace Lake, Antarctica - #423 | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026262 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100852761 | 3300000117 | Marine | MDKKKANKKKLSTLIKQQVPEFVLSDHPKFTEFLTSYFL |
| JGI20155J14468_100640332 | 3300001354 | Pelagic Marine | MATKYKTNKRKLSSLVKQQVPQFVLEDHPKFTEFLSSYYL |
| Ga0078893_101459021 | 3300005837 | Marine Surface Water | MATKYKTNKRKLSSLVKQQVPSYVLEDHPKFTEFLSSYFL |
| Ga0078893_106102041 | 3300005837 | Marine Surface Water | MSDKKKSNKKKISTLVKQQVPEFVLSEHPKFTEFL |
| Ga0066382_103302372 | 3300006013 | Marine | MSTKYKTNKRKLSSLVKQQVPQFVLEDHPKFTEFL |
| Ga0082015_10612181 | 3300006090 | Marine | MATKYKTNKRKLSSLVKQQVPEFVLSEHPKFTEFLSSYFLF |
| Ga0075445_101995281 | 3300006193 | Marine | MSIKYKTNKRKISSLVKQQVPEFVLTDHPKFTEFL |
| Ga0075445_102319562 | 3300006193 | Marine | MATKYKTNKRKLSSLVKQQVPSYVLEDHPKFTEFLSSYYL |
| Ga0099957_14770992 | 3300006414 | Marine | MATKYKTNKRKLSSLVKQQVPEFVLTDHPKFAEFLSS |
| Ga0098038_10226893 | 3300006735 | Marine | MTTFKKTHKRKVSNLVKKQLPEFVLEDHPKFAEFISSY |
| Ga0098054_11749362 | 3300006789 | Marine | MATKYKTNKRKISSLVKQQVPQFVLEDHPKFTEFLSSYFL |
| Ga0098054_11940871 | 3300006789 | Marine | MATKYKTNKRKISSLVKQQVPQYVLEDHPKFTEFLSSYFL |
| Ga0098060_11278012 | 3300006921 | Marine | MATKYKTNKRKISSLVKQQVPQYVLEDHPKFTEFLS |
| Ga0098057_10614911 | 3300006926 | Marine | MATKYKTNKRKLSTLVKQQVPEFVLTDHPKFTEFL |
| Ga0070747_12636741 | 3300007276 | Aqueous | MTNFKNTNKKKLSTLVAQQLPEYVLADHPKFIEFLESY |
| Ga0070752_12135761 | 3300007345 | Aqueous | MDKKKTNKKKLSTLIKQQVPEFVLSDHPKFTEFLTSYFL |
| Ga0115566_101465491 | 3300009071 | Pelagic Marine | MDKKKTNKKKLSTLIKQQVPEFVLSDHPKFTEFLTSY |
| Ga0114995_100747402 | 3300009172 | Marine | MAYKKKTNKKKISTLVKQQVPEFVLTDHPKFTEFLSS |
| Ga0114996_110546131 | 3300009173 | Marine | MADKKKTNKKKISTLVAQQVPEFVLTDHPKFTEFLSSYFL |
| Ga0114994_100531834 | 3300009420 | Marine | MADKKKTNKKKISTLVKQQVPEFVLTDHPKFTEFLS |
| Ga0114994_100945231 | 3300009420 | Marine | MANKKKTNKKKLSTLVAQQVPEFVLTDHPKFTEFLSSYF |
| Ga0115565_103863862 | 3300009467 | Pelagic Marine | MDKKKTNKKKLSTLVRQQVPEYVLSDHPKFTEFLSSYFL |
| Ga0115003_105657032 | 3300009512 | Marine | MDIKKTNKKKLSTLIKQQVPQFVLEDHPKFTEFLTSYFLF |
| Ga0115004_104820612 | 3300009526 | Marine | MSTKYKTNKRKLSSLVKQQVPQFVLEDHPKFTEFLS |
| Ga0115011_115998491 | 3300009593 | Marine | MTTFKKTNKRKVSNLVKRQLPEFVLEDHPKFAEFIKS |
| Ga0115012_107276281 | 3300009790 | Marine | MSDRKKTNKKKLSTLVKQQVPEFVLTDHPKFTEFLTSYFL |
| Ga0160423_102794911 | 3300012920 | Surface Seawater | MDKKKTNKKKLSTLVKQQVPEFVLSDHPKFTEFLTSY |
| Ga0163109_103089162 | 3300012936 | Surface Seawater | MSDRKKTHKKKISTLIKQQVPEFVLTDHPKFTEFLT |
| Ga0163179_104258331 | 3300012953 | Seawater | MATFKKTNKKKLSNLVKRQLPEFVLEEHPKFAEFIKSYYL |
| Ga0181417_10670151 | 3300017730 | Seawater | MDKKKTNKKKLSTLVKQQVPEFVLTDHPKFTEFLTSY |
| Ga0187218_10956571 | 3300017737 | Seawater | MATKYKTNKRKLSSLVKQQVPQYVLEDHPKFTEFL |
| Ga0187218_11285671 | 3300017737 | Seawater | MDKKKTNKKKLSTLVKKQITEFVLSDHPKYTEFLTSYFILM |
| Ga0181428_11561752 | 3300017738 | Seawater | MDIKKTNKKKLSTLVKQQVPEFVLSDHPKFTEFLTS |
| Ga0181421_10092864 | 3300017741 | Seawater | MDTKKTNKKKLSTLIKQQVPQFVLEDHPKFTEFLTSY |
| Ga0181397_10399871 | 3300017744 | Seawater | MATFKKTNTRKLSNLVKRQLPEFVLAEHPKFAEFIKS |
| Ga0181409_10846631 | 3300017758 | Seawater | MTDKKKTNKKKISTLIKQQVPEFVLSDHPKFTELLTSYFLF |
| Ga0181414_10944191 | 3300017759 | Seawater | MDIKKTNKKKLSTLVKQQVPEFVLTDHPKFTEFLTS |
| Ga0181422_10805272 | 3300017762 | Seawater | MTDKKKTNKRKLSTLVKQQVPEFVLSEHPKFTEFLSSYFLFM |
| Ga0181410_11377011 | 3300017763 | Seawater | MTTKYKTNKRKISSLVKQQVPQYVLEDHPKFTEFL |
| Ga0181425_10498671 | 3300017771 | Seawater | MDKKKTNKKKLSTLIKQQVPQFVLEDHPKFTEFLT |
| Ga0181425_12598932 | 3300017771 | Seawater | MAIKYKTNKRKISSLVKQQVPQYVLEDHPKFTEFLS |
| Ga0181432_11854032 | 3300017775 | Seawater | MDKKKTNKKKLSTLVKQQVPEFVLTKHPKFTEFLS |
| Ga0181395_10299372 | 3300017779 | Seawater | MATFKKTNKKKLSNLVKRQLPEFILEDHPKFAEFI |
| Ga0181424_100396611 | 3300017786 | Seawater | MAIKYKTNKRKISSLVKQQVPQYVLEDHPKFTEFLSSY |
| Ga0194023_10750551 | 3300019756 | Freshwater | MATKYKTNKRKLSSLVKQQVPQYVLEDHPKFTEFLSS |
| Ga0206128_13156031 | 3300020166 | Seawater | MSIKYKTNKRKISSLVKQQVPQFVLEDHPKFTEFL |
| Ga0211633_10536331 | 3300020259 | Marine | MSDKKKTNKKKISTLVKQQVPQFVLENHPKFTEFLTSYFLFLES |
| Ga0211509_11399271 | 3300020276 | Marine | MSDKKKTNKKKISTLVKQQVPQFVLENHPKFTEFLTSYFLF |
| Ga0211626_10705892 | 3300020343 | Marine | MADKKKTNKRKLSTLVKQQVPEFVLSDHPKFTEFLSSYF |
| Ga0211672_102911631 | 3300020370 | Marine | MTDKKKTNKRKLSTLVKQQVPEFVLTDHPKFTEFLSSYFLF |
| Ga0211682_103190591 | 3300020376 | Marine | MSTKYKTNKRKLSTLVKQQVPEFVLTDHPKFTEFLS |
| Ga0211682_103396512 | 3300020376 | Marine | MDIKKTNKKKLSTLIKQQVPEFVLTDHPKFTEFLTSYFL |
| Ga0211678_100372511 | 3300020388 | Marine | MADKKKTNKKKISTLIKQQVPEFVLTDHPKFTEFLTSY |
| Ga0211678_101053132 | 3300020388 | Marine | MTDFKKTNKKKLSNLVKEQLPSFVLEDHPQFAEFVS |
| Ga0211678_103063392 | 3300020388 | Marine | MADKKKTNKRKLSTLVKQQVPEFVLSEHPKFTEFLSSYFLFM |
| Ga0211687_100509491 | 3300020396 | Marine | MATKYKTNKRKISSLVKQQVPEFVLTDHPKFTEFLSSY |
| Ga0211516_102142682 | 3300020413 | Marine | MADKKKTNKRKLSTLVKQQVPEFVLSEHPKFTEFLSSYF |
| Ga0211512_104251262 | 3300020419 | Marine | MTTFKKTNKRKIKNLVKRQLPEFVLTDHPKFAEFVSSYYLF |
| Ga0211702_101134801 | 3300020422 | Marine | MSDRKKTNKKKISKLIKRQVPEFVLSEHPKFAEFLTS |
| Ga0211695_100308511 | 3300020441 | Marine | MSDKKKSNKKKISTLVKQQVPEFVLSEHPKFTEFLTSY |
| Ga0211473_101009092 | 3300020451 | Marine | MADKKKTNKKKLSTLIKQQVPEFVLEQHPKFTEFLTSYFL |
| Ga0211543_100515741 | 3300020470 | Marine | MTTFKKTNKRKVSNLIKRQLPEFVLEDHPKFAEFVKSY |
| Ga0211614_104836292 | 3300020471 | Marine | MSDIKKTHKKKISKLIKQQLPEFVLSEHPKFAEFLTSYF |
| Ga0211579_103316881 | 3300020472 | Marine | MATFKKTNKKKLSNLVKRQLPEFVLEDHPKFAEFIKSYYL |
| Ga0211541_101933511 | 3300020475 | Marine | MDKKKTNKKKLSTLVRQQVPEYVLSDHPKFTEFLS |
| Ga0211715_106648631 | 3300020476 | Marine | MADKKKTNKKKISTLVKQQVPEYVLTDHPQFTEFLSSY |
| Ga0206677_103579461 | 3300021085 | Seawater | MATKYKTNKRKLSSLVKQQVPQYVLEDHPKFTEFLS |
| Ga0206685_100395051 | 3300021442 | Seawater | MSTKYKTNKRKISSLVKQQVPEFVLTDHPKFAEFLSSYFL |
| Ga0222715_106602952 | 3300021960 | Estuarine Water | MAIKYKTNKRKISSLVKQQVPQYVLEDHPKFTEFLSS |
| Ga0222655_10320361 | 3300023245 | Saline Water | MDIKKTNKKKLSTLIKQQVPEFVLENHPKFTEFLTSYFLFM |
| Ga0208013_10575851 | 3300025103 | Marine | MAIKYKTNKRKISSLVKQQVPQYVLEDHPKFTEFL |
| Ga0209348_11583592 | 3300025127 | Marine | MTDKKKTNKRKISTLVKQQVPEFVLSEHPKFTEFLS |
| Ga0209337_10478103 | 3300025168 | Marine | MATFKKTNKKKLSNLVKRQLPEFVLEEHPKFAEFIKSYYLF |
| Ga0209630_101840882 | 3300025892 | Pelagic Marine | MATFKKTNKKKLSNLVKRQLPEFILEDHPKFAEFIKS |
| Ga0207990_10033231 | 3300026262 | Marine | MTTYKKSHKRKLSSLVKQQVPEYVLTDHPKFLEFLKAY |
| Ga0209383_11925281 | 3300027672 | Marine | MDIKKLNKKKLSTLVKQQVPEFVLTDHPKFTEFLTSYF |
| Ga0209710_11821361 | 3300027687 | Marine | MDIKKTNKKKLSTLIKQQVPEFVLTDHPKFAEFLTS |
| Ga0209710_12124572 | 3300027687 | Marine | MAYKKKTNKKKISTLVKQQVPEFVLTDHPKFTEFL |
| Ga0209815_10830732 | 3300027714 | Marine | MDIKKLNKKKLSTLVKQQVPDFVLENHPKFTEFLT |
| Ga0209192_101365532 | 3300027752 | Marine | MADKKKTNKKKISTLVAQQVPEFVLTDHPKFTKFLSSY |
| Ga0209709_100403031 | 3300027779 | Marine | MAYKKKTNKKKISTLVKQQVPEFVLTDHPKFTEFLS |
| Ga0209709_100743912 | 3300027779 | Marine | MADKKKTNKKKISTLVKQQVPEFVLTDHPKFTEFLSSYFLFL |
| Ga0209711_100744382 | 3300027788 | Marine | MSTKYKTNKRKISSLVKQQVPEFVLTDHPKFTEFLSSYY |
| Ga0209830_102019182 | 3300027791 | Marine | MADKKKTNKKKISTLVKQQVPEFVLTDHPKFTEFLSSYFLF |
| Ga0209830_104038122 | 3300027791 | Marine | MSTKYKTNKRKLSSLVKQQVPQFVLEDHPKFTEFLSSYY |
| Ga0209089_101002901 | 3300027838 | Marine | MDIKKTNKKKLSTLVKQQVPEFVLTDHPKFTEFLTSY |
| Ga0257106_12037872 | 3300028194 | Marine | MDIKKLNKKKLSTLVKQQVPEFVLTDHPKFTEFLTSYFLF |
| Ga0257106_13141052 | 3300028194 | Marine | MSVKYKTNKRKISSLVKSQVPEFVLTDHPKFTEFLSSY |
| Ga0257110_10031781 | 3300028197 | Marine | MATFKKTNKKKLSNLVKRQLPEFVLEEHPKFAEFIKSY |
| Ga0257110_10493011 | 3300028197 | Marine | MTDFKKTNKKKLSNLVKRQLPEFVLEDHPKFAEFIKSYYLF |
| Ga0257110_10693651 | 3300028197 | Marine | MDIKKTNKKKLSTLVKQQVPEFVLTDHPKFTEFLTSYFLFMES |
| Ga0257110_11859852 | 3300028197 | Marine | MADKKKTNKKKISTLVKQQVPEFVLTDHPKFTEFLSSYFLFM |
| Ga0257110_12835411 | 3300028197 | Marine | MADKKKTNKKKISTLVAQQVPEYVLSDHPKFTEFLSSYFLFLESA |
| Ga0257110_13367162 | 3300028197 | Marine | MDIKKTNKKKLSTLIKQQVPEFVLTDHPKFTEFLT |
| Ga0308022_10870761 | 3300031142 | Marine | MSTKYKTNKRKLSSLVKQQVPQFVLEDHPKFTEFLSS |
| Ga0308022_12038092 | 3300031142 | Marine | MDIKKTNKKKLSTLIKQQVPQFVVEDHPKFTEFLTS |
| Ga0308025_10828592 | 3300031143 | Marine | MDIKKTNKKKLSTLIKQQVPEFVLTDHPKFTEFLTSY |
| Ga0308025_11332052 | 3300031143 | Marine | MSTKYKTNKRKLSSLVKQQVPSYVLEDHPKFTEFLSSYFLFME |
| Ga0308010_10395921 | 3300031510 | Marine | MSTKYKTNKRKISSLVKQQVPEFVLTDHPKFTEFLSS |
| Ga0308010_11683262 | 3300031510 | Marine | MATKYKTNKRKLSSLVKQQVPSYVLTDHPKFTEFLSSY |
| Ga0308010_11824942 | 3300031510 | Marine | MATKYKTNKRKLSSLVKQQVPSYVLTDHPKFTEFL |
| Ga0308010_13371431 | 3300031510 | Marine | MDIKKTNKKKLSTLIKQQVPEFVLTDHPKFTEFLTSYF |
| Ga0307489_106111732 | 3300031569 | Sackhole Brine | MSTKYKTNKRKISSLVKQQVPEFVLTDHPKFTEFLSSYYL |
| Ga0308019_100699682 | 3300031598 | Marine | MATKYKTNKRKLSSLVKQQVPSYVLEDHPKFTEFL |
| Ga0308019_103917721 | 3300031598 | Marine | MSTKYKTNKRKISSLVKQQVPQYVLEDHPKFTEFL |
| Ga0308001_100528121 | 3300031644 | Marine | MSIKYKTNKRKLSSLVKQQVPSYVLEDHPKFTEFLSS |
| Ga0307986_101159321 | 3300031659 | Marine | MDIKKTNKKKLSTLISQQVPQFVVEDHPKFTEFLTSYFLFM |
| Ga0308016_100681261 | 3300031695 | Marine | MATKYKTNKRKLSSLVKQQVPSYVLTDHPKFTEFLS |
| Ga0315315_107753471 | 3300032073 | Seawater | MTDFKKTNKKKLSNLVKRQLPEFVLEDHPKFADFIKSY |
| Ga0315315_110287142 | 3300032073 | Seawater | MADKKKTNKKKLSTLVKQQVPEFVLTDHPKFTEFLTSY |
| ⦗Top⦘ |