Basic Information | |
---|---|
Family ID | F087424 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 48 residues |
Representative Sequence | VDVFDPVAYAASLLVIVTSCALAVSVPALRAARIDPIATLRKD |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 6.67 % |
% of genes near scaffold ends (potentially truncated) | 84.55 % |
% of genes from short scaffolds (< 2000 bps) | 88.18 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.545 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (16.364 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.455 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF13460 | NAD_binding_10 | 10.00 |
PF12704 | MacB_PCD | 4.55 |
PF12833 | HTH_18 | 4.55 |
PF03551 | PadR | 2.73 |
PF07676 | PD40 | 2.73 |
PF02687 | FtsX | 2.73 |
PF03786 | UxuA | 1.82 |
PF00679 | EFG_C | 1.82 |
PF01161 | PBP | 1.82 |
PF13419 | HAD_2 | 1.82 |
PF12706 | Lactamase_B_2 | 1.82 |
PF09084 | NMT1 | 1.82 |
PF04020 | Phage_holin_4_2 | 0.91 |
PF02894 | GFO_IDH_MocA_C | 0.91 |
PF04545 | Sigma70_r4 | 0.91 |
PF08241 | Methyltransf_11 | 0.91 |
PF01252 | Peptidase_A8 | 0.91 |
PF13632 | Glyco_trans_2_3 | 0.91 |
PF12681 | Glyoxalase_2 | 0.91 |
PF03764 | EFG_IV | 0.91 |
PF01381 | HTH_3 | 0.91 |
PF00109 | ketoacyl-synt | 0.91 |
PF13551 | HTH_29 | 0.91 |
PF00144 | Beta-lactamase | 0.91 |
PF07969 | Amidohydro_3 | 0.91 |
PF00528 | BPD_transp_1 | 0.91 |
PF08327 | AHSA1 | 0.91 |
PF02371 | Transposase_20 | 0.91 |
PF05685 | Uma2 | 0.91 |
PF11138 | DUF2911 | 0.91 |
PF00174 | Oxidored_molyb | 0.91 |
PF00293 | NUDIX | 0.91 |
PF13432 | TPR_16 | 0.91 |
PF07617 | DUF1579 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.73 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.73 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.73 |
COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.82 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.82 |
COG1312 | D-mannonate dehydratase | Carbohydrate transport and metabolism [G] | 1.82 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.82 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.91 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.91 |
COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.91 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.91 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.91 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.91 |
COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.55 % |
Unclassified | root | N/A | 25.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002070|JGI24750J21931_1045189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 677 | Open in IMG/M |
3300002073|JGI24745J21846_1008520 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300002124|C687J26631_10000662 | All Organisms → cellular organisms → Bacteria | 14140 | Open in IMG/M |
3300004156|Ga0062589_101091528 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300004156|Ga0062589_101321069 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300004463|Ga0063356_101431617 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300004463|Ga0063356_104779318 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300004463|Ga0063356_105240460 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300004463|Ga0063356_105726322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 533 | Open in IMG/M |
3300004480|Ga0062592_100581350 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300005290|Ga0065712_10749044 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005294|Ga0065705_10816628 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005328|Ga0070676_11610710 | Not Available | 502 | Open in IMG/M |
3300005347|Ga0070668_101443379 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300005354|Ga0070675_100304139 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
3300005364|Ga0070673_102321139 | Not Available | 510 | Open in IMG/M |
3300005456|Ga0070678_101449998 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005549|Ga0070704_100586693 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300005577|Ga0068857_100449924 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300005578|Ga0068854_101896871 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005615|Ga0070702_100151100 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
3300005713|Ga0066905_101631045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 591 | Open in IMG/M |
3300005719|Ga0068861_101599584 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300006194|Ga0075427_10036781 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300006358|Ga0068871_102171649 | Not Available | 529 | Open in IMG/M |
3300006579|Ga0074054_11881840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
3300006755|Ga0079222_12486966 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300006844|Ga0075428_100429811 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300006846|Ga0075430_100971564 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300006852|Ga0075433_11050662 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300006852|Ga0075433_11299760 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300006894|Ga0079215_10631907 | Not Available | 706 | Open in IMG/M |
3300006914|Ga0075436_101051303 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300007004|Ga0079218_13808335 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009038|Ga0099829_11756462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300009078|Ga0105106_10691021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 729 | Open in IMG/M |
3300009078|Ga0105106_11375525 | Not Available | 501 | Open in IMG/M |
3300009094|Ga0111539_10075669 | All Organisms → cellular organisms → Bacteria | 3965 | Open in IMG/M |
3300009094|Ga0111539_10269787 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
3300009094|Ga0111539_11514920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
3300009094|Ga0111539_11729375 | Not Available | 725 | Open in IMG/M |
3300009146|Ga0105091_10460825 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 640 | Open in IMG/M |
3300009147|Ga0114129_10983883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1063 | Open in IMG/M |
3300009147|Ga0114129_11634662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
3300009148|Ga0105243_12597156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300009156|Ga0111538_14134447 | Not Available | 501 | Open in IMG/M |
3300009162|Ga0075423_12563802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300009553|Ga0105249_10649285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
3300010329|Ga0134111_10222724 | Not Available | 768 | Open in IMG/M |
3300010362|Ga0126377_13167761 | Not Available | 531 | Open in IMG/M |
3300010398|Ga0126383_10820279 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300011119|Ga0105246_10102344 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
3300012204|Ga0137374_10159124 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
3300012499|Ga0157350_1010839 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300012915|Ga0157302_10311618 | Not Available | 615 | Open in IMG/M |
3300013308|Ga0157375_10240469 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300014154|Ga0134075_10415217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300014326|Ga0157380_13244690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300015201|Ga0173478_10686901 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300015256|Ga0180073_1111033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300018053|Ga0184626_10354549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300018063|Ga0184637_10531912 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300018429|Ga0190272_11520555 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300018429|Ga0190272_11789157 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300018429|Ga0190272_12096675 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300018432|Ga0190275_10961330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
3300018469|Ga0190270_11023099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
3300018469|Ga0190270_11157128 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300019377|Ga0190264_10669011 | Not Available | 759 | Open in IMG/M |
3300021080|Ga0210382_10017398 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
3300025919|Ga0207657_10214497 | Not Available | 1543 | Open in IMG/M |
3300025926|Ga0207659_11493541 | Not Available | 578 | Open in IMG/M |
3300025930|Ga0207701_11538388 | Not Available | 537 | Open in IMG/M |
3300025937|Ga0207669_10382596 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300025938|Ga0207704_10928013 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300026067|Ga0207678_11459367 | Not Available | 604 | Open in IMG/M |
3300026075|Ga0207708_10091108 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
3300026118|Ga0207675_100008079 | All Organisms → cellular organisms → Bacteria | 9913 | Open in IMG/M |
3300026320|Ga0209131_1369724 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300027717|Ga0209998_10044497 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300027979|Ga0209705_10078894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1803 | Open in IMG/M |
3300028809|Ga0247824_11013915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 526 | Open in IMG/M |
3300028812|Ga0247825_10264198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1198 | Open in IMG/M |
3300031229|Ga0299913_11316719 | Not Available | 679 | Open in IMG/M |
3300031547|Ga0310887_11023983 | Not Available | 527 | Open in IMG/M |
3300031562|Ga0310886_10114503 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
3300031740|Ga0307468_102235490 | Not Available | 530 | Open in IMG/M |
3300031908|Ga0310900_10905789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300031940|Ga0310901_10208895 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300031943|Ga0310885_10699322 | Not Available | 569 | Open in IMG/M |
3300031944|Ga0310884_10021452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2612 | Open in IMG/M |
3300032002|Ga0307416_103883681 | Not Available | 500 | Open in IMG/M |
3300032003|Ga0310897_10249412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae | 794 | Open in IMG/M |
3300032017|Ga0310899_10061107 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300032017|Ga0310899_10118335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
3300032075|Ga0310890_10645930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 823 | Open in IMG/M |
3300032075|Ga0310890_11548339 | Not Available | 547 | Open in IMG/M |
3300032122|Ga0310895_10132914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
3300032122|Ga0310895_10782895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300032144|Ga0315910_10135372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1828 | Open in IMG/M |
3300032179|Ga0310889_10167918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 994 | Open in IMG/M |
3300032179|Ga0310889_10206207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 911 | Open in IMG/M |
3300032179|Ga0310889_10215919 | Not Available | 893 | Open in IMG/M |
3300033416|Ga0316622_100428328 | Not Available | 1493 | Open in IMG/M |
3300034147|Ga0364925_0365168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 545 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 16.36% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.09% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 5.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.82% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.91% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.91% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.91% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Host-Associated | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24750J21931_10451892 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | IVLRATPLAAEIGDSVDVFDPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD* |
JGI24745J21846_10085201 | 3300002073 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRATPLAAEIGDSVDVFDPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD* |
C687J26631_100006622 | 3300002124 | Soil | VAYAASALVIATACLIAMSVPILRAASVDPIATLRKD* |
Ga0062589_1010915282 | 3300004156 | Soil | SVDVFDPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD* |
Ga0062589_1013210692 | 3300004156 | Soil | LMASPFASEIGDVVHVFDPLAYAASVLVIAAACLLAVSVPALRAARIDPIATLRND* |
Ga0063356_1002577511 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AGTGLAAAVATLLLSTPAASEIGSLVHVLDPVAYITGVLVIASACLLASSLPMLRAARIDPIAALRNE* |
Ga0063356_1014316172 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AIVLMATPVAAEIGSLVNVFDPVAYTASLLCIGTACVLAASIPALRAARIDPIATLRQD* |
Ga0063356_1047793182 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DPVAYAASALVIVASCMLAVSVPALRAARIDPIVTLRMD* |
Ga0063356_1052404601 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DPLAYAASVLVIAAACLLAVSVPALRAARIDPIATLRND* |
Ga0063356_1057263222 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SPFASEIGDAVHVFDPLAYFASVLVIAAACLLGVSVPALRAARIDPIAALRKD* |
Ga0062592_1005813502 | 3300004480 | Soil | DVFDPAAYAASALVIATACLIAVSVPTLRAARIDPIATLRKD* |
Ga0065712_107490441 | 3300005290 | Miscanthus Rhizosphere | VLDPAAYGVSVITIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0065705_108166283 | 3300005294 | Switchgrass Rhizosphere | AASEIGGVVKVFDPVAYAASLLVIITSCALAVSVPALRAARIDPIAMLRKD* |
Ga0070676_116107101 | 3300005328 | Miscanthus Rhizosphere | DVFDPVAYAGSLLVIVTSCALAVSVPALRATRIDPIATLKKE* |
Ga0070668_1014433791 | 3300005347 | Switchgrass Rhizosphere | VDVFDPVAYAASLLVIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0070675_1003041391 | 3300005354 | Miscanthus Rhizosphere | VQVFDPVAYAASLLVIVTSCVLAASVPALRAARIDPIATLRKD* |
Ga0070673_1023211391 | 3300005364 | Switchgrass Rhizosphere | VAIVLMATPAASETGGVIDVFDPVAYAASALVIATACLIAVSVPTLRATRIDPIATLRKD |
Ga0070678_1014499982 | 3300005456 | Miscanthus Rhizosphere | GASEIGDWVHVLDPAAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0070704_1005866932 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | IGDWVHVLDPVAYGTSALTIVMSSALAVSVPALRAARIDPIATLRKD* |
Ga0068857_1004499243 | 3300005577 | Corn Rhizosphere | PVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD* |
Ga0068854_1018968712 | 3300005578 | Corn Rhizosphere | PGASEIGDWVHVLDPAAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0070702_1001511004 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | DPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD* |
Ga0066905_1016310452 | 3300005713 | Tropical Forest Soil | ALDDSGEVGRMIHVLDPIPYVASALIIAMACLLATSIPTLRAARIDPIATLRKD* |
Ga0068861_1015995842 | 3300005719 | Switchgrass Rhizosphere | AGAGLAAALAILLLTLPGASEIGDWVHVLDPAAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0075427_100367811 | 3300006194 | Populus Rhizosphere | YATSALVIVTACLLAALVPTWRAVRIDPIATLRQQ* |
Ga0068871_1021716491 | 3300006358 | Miscanthus Rhizosphere | AILLAAVDSGIGGIVDVFDPVAYLASVLVIVTSCAVAVLVPALRASRIDPIATLRKD* |
Ga0074054_118818402 | 3300006579 | Soil | IASVLLIVTSCVLAVSVPALRAARIDPIATLRKD* |
Ga0079222_124869662 | 3300006755 | Agricultural Soil | VLTATATELQGWMHVLDPVAYIASVLLIATSCVVAVSVPALRAVRIDPIATLGKD* |
Ga0075428_1004298111 | 3300006844 | Populus Rhizosphere | TVNVLDPLAYVSSTLVIVTACLIAVSVPTLRAVRVDPITTLRKE* |
Ga0075430_1009715643 | 3300006846 | Populus Rhizosphere | VKVFDPVAYAASLLVIITSCALAVSVPALRAARIDPIAMLRKD* |
Ga0075431_1005698101 | 3300006847 | Populus Rhizosphere | AVATLLLSTPAASEIGSLVHVLDPVAYITGVLVIASACLLASSLPMLRAARIDPIAALRNE* |
Ga0075433_110506622 | 3300006852 | Populus Rhizosphere | AYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0075433_112997601 | 3300006852 | Populus Rhizosphere | AYAASVLVIAAACLLAVSVPALRAARIDPIATLRND* |
Ga0079215_106319071 | 3300006894 | Agricultural Soil | AAGVLVIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0075436_1010513032 | 3300006914 | Populus Rhizosphere | AAGAGLAAALSILLLALPGAAELGDWVHVLDPVAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0079218_138083351 | 3300007004 | Agricultural Soil | GLAAGGGLAAAVAIVLTATPLAAEIGDLDVLDPVAYGASVLLIVTSCVLAVSVPALRAARIDPIATLRKD* |
Ga0099829_117564622 | 3300009038 | Vadose Zone Soil | DIVHVFDPVAYAASILVIVTSCVLAVSVPALRAARIDPIATLRQD* |
Ga0105106_106910212 | 3300009078 | Freshwater Sediment | VAYAASLLVIVTSCVLAVSVPALRAARIDPIATLRRD* |
Ga0105106_113755251 | 3300009078 | Freshwater Sediment | VAYAAGLLVIVTSCALAVSVPALRAARIDPIATLRRD* |
Ga0111539_100756691 | 3300009094 | Populus Rhizosphere | VLDPVAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0111539_102697873 | 3300009094 | Populus Rhizosphere | AVATMLMAVSDGEVGTMIKVFDPTAYTTSVLVIVVSCALAATVPALRAARIDPIATLRRE |
Ga0111539_115149202 | 3300009094 | Populus Rhizosphere | AAALAILLLTLPGAAEIADWVHVLDPAAYGAGIVTILLSCALAVSIPALRAARIDPIATLRKD* |
Ga0111539_117293751 | 3300009094 | Populus Rhizosphere | AGLAAALSILLLALPGAAELGDWVHVLDPVAYGVSVMTIVTSCALAVSVPARRAARIDPIATLRKD* |
Ga0105091_104608252 | 3300009146 | Freshwater Sediment | VAYAASLLVIVTSCALAVSVPALRAARIDPMVTLRKD* |
Ga0114129_109838833 | 3300009147 | Populus Rhizosphere | DPVAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0114129_116346621 | 3300009147 | Populus Rhizosphere | VAYAASLLIIVTSCVLAVSVPALRAARIDPIATLRKD* |
Ga0105243_125971561 | 3300009148 | Miscanthus Rhizosphere | GSELGAWVDVFDPVAYATSLLLIVAASMIATVFPALRAASLDPIATLRID* |
Ga0111538_141344472 | 3300009156 | Populus Rhizosphere | EIGDIVHVFDPLAYAASVLVIAAACLLAVSVPALRAARIDPIATLRND* |
Ga0075423_111661072 | 3300009162 | Populus Rhizosphere | GIVLIAIPGASSPLSQIVHVFDPVAYAASLICIVAACALAALIPAMRAAGIAPVDALRQD |
Ga0075423_125638022 | 3300009162 | Populus Rhizosphere | PAAYVTCVLVIASACLLAASLPTLRAARIDPIAALRNE* |
Ga0105249_106492851 | 3300009553 | Switchgrass Rhizosphere | VAYAGSVLVIVTSCALAASVPAWRAARIDPITTLRRD* |
Ga0134111_102227241 | 3300010329 | Grasslands Soil | SASLLVIVTSCALAVSVPALRAACIDPIATLKKD* |
Ga0126377_131677612 | 3300010362 | Tropical Forest Soil | LAAGGGLAIAVAIVLTATATELRGWMHLLDPVAYIACVLVIVTSCVLAVSVPALRVARIDPIATLRKD* |
Ga0126383_108202791 | 3300010398 | Tropical Forest Soil | MYSIFDPVAYAASLLVIVTSCGLAVWIPSLRAARIDPFETLRKD* |
Ga0105246_101023445 | 3300011119 | Miscanthus Rhizosphere | VFDPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD* |
Ga0137374_101591243 | 3300012204 | Vadose Zone Soil | VAYSASLLVIVTSCALAVSVPALRAACIDPIATLKKD* |
Ga0157350_10108391 | 3300012499 | Unplanted Soil | EIGDSVDVFDPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD* |
Ga0157302_103116182 | 3300012915 | Soil | LPGASEIGDWVHVLDPAAYGVSVITIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0157375_102404693 | 3300013308 | Miscanthus Rhizosphere | PVAYGTSALTIVMSSALAVSVPALRAARIDPIATLRKD* |
Ga0134075_104152172 | 3300014154 | Grasslands Soil | VAYSASLLVIVTSCALAVSVPALRAACIDPIATLRKD* |
Ga0157380_132446901 | 3300014326 | Switchgrass Rhizosphere | DPSAYATSLLVIVVSCTLAAAVPALRAARIDPIATLRRE* |
Ga0173478_106869012 | 3300015201 | Soil | VWVDVFDPVAYAASLLVIVTSCALAVSVPALRAARIDPIATLRKD* |
Ga0180073_11110331 | 3300015256 | Soil | IPDMVQVFDPVAYAASLLVIVTSCVLAVSVPALRAARIDPIATLRKD* |
Ga0180121_101224581 | 3300017695 | Polar Desert Sand | ATVLMAIPAASQIRDIVHIFDPVAYAATLLCIVMACALAALIPALRAARIDPIATLRQD |
Ga0184626_103545491 | 3300018053 | Groundwater Sediment | GDIVRVFDPLAYTVSLLCIVTACALAASIPALRAARIDPIATLRQD |
Ga0184637_105319121 | 3300018063 | Groundwater Sediment | VLMATPAASEIGNLVHVFDPVAYAASLLVIVTACVLAASVPALRAARIDPIATLRKD |
Ga0190272_115205552 | 3300018429 | Soil | SEIGDLKVLDPLAYGASVLVIVTSCVLAVSVPALRAARIDPIATLRQD |
Ga0190272_117891572 | 3300018429 | Soil | PAASQIGAVVRVFDPVAYAASLLLVVTTCTLAASIPAWRAALIDPIATLRND |
Ga0190272_120966752 | 3300018429 | Soil | GGIVHVFDPVAYAASLACIVTACVFAGFIPALRAARIDPMKTLRQE |
Ga0190275_109613301 | 3300018432 | Soil | AGGVIAAALAIVLMTTPVAAEIGDSVRVFDPVAYLASLLVIVTSCALAVSVPALRASRIDPIATLRKD |
Ga0190270_110230991 | 3300018469 | Soil | PIAAEIGGSVNVFDPVAYAAGLLVIVSSCVVAVSVPTWRAARIDPIATLRKD |
Ga0190270_111571281 | 3300018469 | Soil | LDPVAYASGLLVIVTSCALAVSVPALRAARIDPIATLRQD |
Ga0190264_106690111 | 3300019377 | Soil | AASQIGSVVHVFDPVAYAASLLVIVTSCVLAASVPALRAARIDPIATLRKD |
Ga0210382_100173983 | 3300021080 | Groundwater Sediment | VAYSASLLVIVTSCALAVSVPALRAACIDPIATLKKD |
Ga0207657_102144974 | 3300025919 | Corn Rhizosphere | LLLTLPGASEIGDWVHVLDPAAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD |
Ga0207659_114935412 | 3300025926 | Miscanthus Rhizosphere | VFDPVAYAASLLVIVTSCVLAASVPALRAARIDPIATLRKD |
Ga0207701_115383882 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ASEIGNLVQVFDPVAYAASLLVIVTSCVLAASVPALRAARIDPIATLRKD |
Ga0207669_103825963 | 3300025937 | Miscanthus Rhizosphere | DGSEIHGWVDVFDPVAYATSLLVIVTASICATLVPALRAACIDPIATLRQD |
Ga0207704_109280132 | 3300025938 | Miscanthus Rhizosphere | AEMGDSVDVFDPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD |
Ga0207678_114593671 | 3300026067 | Corn Rhizosphere | PVAYSASALVIATACLIAVSVPTLRATRIDPIATLRKD |
Ga0207708_100911085 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIVLRATPLAAEMGDSVDVFDPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD |
Ga0207675_10000807915 | 3300026118 | Switchgrass Rhizosphere | IVLRATPLAAEIGDSVDVFDPVAYAASALIIATACLIAVSIPALRAARIDPIATLRKD |
Ga0209131_13697242 | 3300026320 | Grasslands Soil | YAASLLVIVTSCALAVSVPALRAACIDPIATLRKD |
Ga0209998_100444972 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MATPAASEIGNVVHVFDPVAYLASALIIAAASLLGVAVPALRAARIDLIATLRRD |
Ga0209382_113772493 | 3300027909 | Populus Rhizosphere | PAASAIGDIVRVFDPVAYALSGLVVVTACALAAWVPALRACRLDPVATLRQD |
Ga0209705_100788942 | 3300027979 | Freshwater Sediment | VAYAASLLVIVTSCVLAVSVPALRAARIDPIATLRRD |
Ga0247824_110139152 | 3300028809 | Soil | YWCAHGGVIDVFDPVAYAASALIIATACLIAVSVPTLRAARIDPIATLRKD |
Ga0247825_102641982 | 3300028812 | Soil | MATPAAAEIGAVVDIFDPVAYAASALVIATASLIAVSVPTVRATRIDPIEILRKD |
Ga0299913_113167191 | 3300031229 | Soil | AASLFGGALIHVYDPVAYTGSLLVIVTACALAAAIPTWRAARIDPIATLRQD |
Ga0310887_110239832 | 3300031547 | Soil | AGIGSIVHVFDPMAYTASLLVIVTSCLLAVSVPALRAVRIDPIATLRKE |
Ga0310886_101145033 | 3300031562 | Soil | ALAVVLTSAAAEIGSIVHVFDPMAYTASLLVIVTSCLLAVSVPALRAVRIDPIATLRKE |
Ga0307468_1022354902 | 3300031740 | Hardwood Forest Soil | VAYAASLLVIVTSCVLAASVPALRAARIDPIATLRKD |
Ga0310900_109057892 | 3300031908 | Soil | LAAAVAIVLMTTPIAAEMGDSIDVLDPGAYAASLLVIVTSCVFAVSLPALRAARIDPIATLRKD |
Ga0310901_102088951 | 3300031940 | Soil | GDVINVFDPVAYAASALVIATACLIAVSVPTLRAARIDPIATLRKD |
Ga0310885_106993221 | 3300031943 | Soil | LMATPMASEIGNLVQVFDPVAYAASLLVIVTSCVLAASVPALRAARIDPIATLRKD |
Ga0310884_100214522 | 3300031944 | Soil | DSIDVLDPGAYAASLLVIVTSCVFAVSLPALRAARIDPIATLRKD |
Ga0307416_1038836812 | 3300032002 | Rhizosphere | YLASALIIAAASLLGVAVPALRAARIDPIATLRRD |
Ga0310897_102494121 | 3300032003 | Soil | TPVAAEIGSLVNVFDPVAYTASLLCIGTACVLAASIPALRAARIDPIATLRQD |
Ga0310899_100611071 | 3300032017 | Soil | VHVLDPVAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD |
Ga0310899_101183352 | 3300032017 | Soil | AYAASLLVIVTSCVFAVSLPALRAARIDPIATLRKD |
Ga0310890_106459301 | 3300032075 | Soil | PLAYAASALVIATASLIAVSVPTLRAARIEPIAILRKD |
Ga0310890_115483391 | 3300032075 | Soil | VAAIVLMSTSLASEIGGVVDVFDPVAYAASLAVIVMSCAIAVSVPALRAARIDPIATLRR |
Ga0310895_101329141 | 3300032122 | Soil | IVLMTTPIAVEIGDSIDVLDPGAYAASLLVIVTSCVFAVSLPALRAARIDPIATLRKD |
Ga0310895_107828952 | 3300032122 | Soil | SLVNVFDPVAYTASLLCIGTACVLAASIPALRAARIDPIATLRQD |
Ga0315910_101353723 | 3300032144 | Soil | EVGMLITVFDPTAYATSLLVIVVSCTLAAAVPALRAARIDPIATLRRE |
Ga0310889_101679181 | 3300032179 | Soil | LSILLLALPGAAELGDWVHVLDPVAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD |
Ga0310889_102062071 | 3300032179 | Soil | TPASAEIAAVVDVFDPVAYAASALVIATASLIAVSVPTLRAARIDPIAILRKD |
Ga0310889_102159191 | 3300032179 | Soil | LPGAAELGDWVHVLDPVAYGVSVMTIVTSCALAVSVPALRAARIDPIATLRKD |
Ga0316622_1004283281 | 3300033416 | Soil | PVAYAASLLVIIMACVLAALVPGLRAARIDSMVALRQE |
Ga0364925_0365168_429_542 | 3300034147 | Sediment | VAYAASALVIATASLIAVSVPTVRAARIDPIAILRKD |
⦗Top⦘ |