Metagenome Family F087394

Basic Information
Family ID	F087394
Family Type	Metagenome
Number of Sequences	110
Average Sequence Length	42 residues
Representative Sequence	MSERRPDEPVEKPAAPPPADSGYTEEEEAEVQKRLEDLGYVE
Number of Associated Samples	88
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	85.71 %
% of genes near scaffold ends (potentially truncated)	15.45 %
% of genes from short scaffolds (< 2000 bps)	55.45 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Most Common Taxonomy
Group	Bacteria (72.727 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (15.454 % of family members)
Environment Ontology (ENVO)	Unclassified (20.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (38.182 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF07683	CobW_C	48.18
PF03721	UDPG_MGDP_dh_N	32.73
PF01663	Phosphodiest	3.64
PF02033	RBFA	0.91
PF00072	Response_reg	0.91
PF02492	cobW	0.91
PF00535	Glycos_transf_2	0.91
PF00158	Sigma54_activat	0.91
PF00884	Sulfatase	0.91
PF14667	Polysacc_synt_C	0.91
PF03720	UDPG_MGDP_dh_C	0.91
PF13439	Glyco_transf_4	0.91
PF01351	RNase_HII	0.91
PF01243	Putative_PNPOx	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG0523	Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family	General function prediction only [R]	48.18
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	32.73
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	32.73
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	32.73
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	32.73
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	32.73
COG0164	Ribonuclease HII	Replication, recombination and repair [L]	0.91
COG0858	Ribosome-binding factor RbfA	Translation, ribosomal structure and biogenesis [J]	0.91
COG1039	Ribonuclease HIII	Replication, recombination and repair [L]	0.91

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.73 %
Unclassified	root	N/A	27.27 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.73 %
Unclassified	root	N/A	27.27 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	72.73 %
Unclassified	root	N/A	27.27 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.27 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	8.18 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.91 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.27 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	8.18 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.91 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.27 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	8.18 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.91 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.27 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	8.18 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.91 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.27 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	8.18 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.91 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002911\|JGI25390J43892_10159269	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300004463\|Ga0063356_104027749	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300005167\|Ga0066672_10049871	All Organisms → cellular organisms → Bacteria	2393	Open in IMG/M
3300005175\|Ga0066673_10334495	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300005176\|Ga0066679_10091528	All Organisms → cellular organisms → Bacteria	1834	Open in IMG/M
3300005177\|Ga0066690_10742805	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	645	Open in IMG/M
3300005332\|Ga0066388_100550229	All Organisms → cellular organisms → Bacteria	1784	Open in IMG/M
3300005332\|Ga0066388_101234130	All Organisms → cellular organisms → Bacteria	1282	Open in IMG/M
3300005439\|Ga0070711_101251031	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300005445\|Ga0070708_101856650	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	559	Open in IMG/M
3300005467\|Ga0070706_100709391	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300005468\|Ga0070707_100787345	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300005518\|Ga0070699_101440331	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300005524\|Ga0070737_10000385	All Organisms → cellular organisms → Bacteria	99384	Open in IMG/M
3300005526\|Ga0073909_10014118	All Organisms → cellular organisms → Bacteria	2488	Open in IMG/M
3300005529\|Ga0070741_10000101	All Organisms → cellular organisms → Bacteria	320166	Open in IMG/M
3300005529\|Ga0070741_10002114	All Organisms → cellular organisms → Bacteria	55295	Open in IMG/M
3300005529\|Ga0070741_10011438	All Organisms → cellular organisms → Bacteria	16394	Open in IMG/M
3300005533\|Ga0070734_10000137	All Organisms → cellular organisms → Bacteria	201073	Open in IMG/M
3300005536\|Ga0070697_100136106	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2063	Open in IMG/M
3300005536\|Ga0070697_100831518	All Organisms → cellular organisms → Bacteria	818	Open in IMG/M
3300005546\|Ga0070696_100442908	All Organisms → cellular organisms → Bacteria	1024	Open in IMG/M
3300005764\|Ga0066903_100175155	All Organisms → cellular organisms → Bacteria	3149	Open in IMG/M
3300005764\|Ga0066903_102743603	All Organisms → cellular organisms → Bacteria	956	Open in IMG/M
3300005764\|Ga0066903_107326960	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300006224\|Ga0079037_100246327	All Organisms → cellular organisms → Bacteria	1632	Open in IMG/M
3300006847\|Ga0075431_101248392	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300006865\|Ga0073934_10010381	All Organisms → cellular organisms → Bacteria	11588	Open in IMG/M
3300006904\|Ga0075424_100438611	All Organisms → cellular organisms → Bacteria	1393	Open in IMG/M
3300007004\|Ga0079218_10526478	All Organisms → cellular organisms → Bacteria	1054	Open in IMG/M
3300009012\|Ga0066710_102437513	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300009012\|Ga0066710_102833442	All Organisms → cellular organisms → Bacteria	684	Open in IMG/M
3300009038\|Ga0099829_10614809	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300009137\|Ga0066709_101141696	All Organisms → cellular organisms → Bacteria	1146	Open in IMG/M
3300009137\|Ga0066709_104651924	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300009162\|Ga0075423_10396799	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1448	Open in IMG/M
3300010360\|Ga0126372_11342710	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300010391\|Ga0136847_10127399	All Organisms → cellular organisms → Bacteria	5343	Open in IMG/M
3300010391\|Ga0136847_10657524	All Organisms → cellular organisms → Bacteria	1002	Open in IMG/M
3300012198\|Ga0137364_10491514	All Organisms → cellular organisms → Bacteria	922	Open in IMG/M
3300012922\|Ga0137394_10027158	All Organisms → cellular organisms → Bacteria	4630	Open in IMG/M
3300013100\|Ga0157373_11295743	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300014150\|Ga0134081_10048474	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1265	Open in IMG/M
3300014269\|Ga0075302_1172208	Not Available	538	Open in IMG/M
3300014885\|Ga0180063_1002053	All Organisms → cellular organisms → Bacteria	5565	Open in IMG/M
3300015259\|Ga0180085_1127985	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300015358\|Ga0134089_10246535	Not Available	729	Open in IMG/M
3300018431\|Ga0066655_10437088	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	864	Open in IMG/M
3300018468\|Ga0066662_10454277	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1149	Open in IMG/M
3300018482\|Ga0066669_10024210	All Organisms → cellular organisms → Bacteria	3466	Open in IMG/M
3300019458\|Ga0187892_10028820	All Organisms → cellular organisms → Bacteria	4650	Open in IMG/M
3300019458\|Ga0187892_10494507	All Organisms → cellular organisms → Bacteria → Terrabacteria group	564	Open in IMG/M
3300019789\|Ga0137408_1207891	All Organisms → cellular organisms → Bacteria	1050	Open in IMG/M
3300025160\|Ga0209109_10552966	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300025310\|Ga0209172_10054846	All Organisms → cellular organisms → Bacteria	2452	Open in IMG/M
3300025325\|Ga0209341_10332251	All Organisms → cellular organisms → Bacteria	1245	Open in IMG/M
3300025910\|Ga0207684_10293378	All Organisms → cellular organisms → Bacteria	1402	Open in IMG/M
3300025922\|Ga0207646_10836349	All Organisms → cellular organisms → Bacteria	819	Open in IMG/M
3300026313\|Ga0209761_1167134	All Organisms → cellular organisms → Bacteria	1018	Open in IMG/M
3300026317\|Ga0209154_1057118	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1725	Open in IMG/M
3300026329\|Ga0209375_1103601	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1275	Open in IMG/M
3300026529\|Ga0209806_1341982	Not Available	502	Open in IMG/M
3300027706\|Ga0209581_1000777	All Organisms → cellular organisms → Bacteria	49273	Open in IMG/M
3300027706\|Ga0209581_1000971	All Organisms → cellular organisms → Bacteria	40150	Open in IMG/M
3300027821\|Ga0209811_10022683	All Organisms → cellular organisms → Bacteria	2062	Open in IMG/M
3300027826\|Ga0209060_10000229	All Organisms → cellular organisms → Bacteria	128432	Open in IMG/M
3300027885\|Ga0209450_11069617	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300027886\|Ga0209486_10853451	Not Available	600	Open in IMG/M
3300027900\|Ga0209253_10005611	All Organisms → cellular organisms → Bacteria	10882	Open in IMG/M
3300031280\|Ga0307428_1113289	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300031720\|Ga0307469_11800085	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300031754\|Ga0307475_10658368	All Organisms → cellular organisms → Bacteria	836	Open in IMG/M
3300032180\|Ga0307471_101424748	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300032205\|Ga0307472_101164236	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300032397\|Ga0315287_10091826	All Organisms → cellular organisms → Bacteria	3435	Open in IMG/M
3300032770\|Ga0335085_12461513	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300032829\|Ga0335070_10917091	All Organisms → cellular organisms → Bacteria	811	Open in IMG/M
3300033004\|Ga0335084_10362211	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1496	Open in IMG/M
3300033233\|Ga0334722_11082203	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300033414\|Ga0316619_11362943	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300033433\|Ga0326726_10740200	All Organisms → cellular organisms → Bacteria	950	Open in IMG/M
3300033480\|Ga0316620_10022933	All Organisms → cellular organisms → Bacteria	3782	Open in IMG/M
3300033480\|Ga0316620_10289022	All Organisms → cellular organisms → Bacteria	1428	Open in IMG/M
3300033487\|Ga0316630_11255694	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.73%
Host-Associated	Host-Associated	7.27%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	80.00%
Aquatic	Environmental → Aquatic	12.73%
Plants	Host-Associated → Plants	7.27%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	77.27%
Freshwater	Environmental → Aquatic → Freshwater	7.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.45%
Marine	Environmental → Aquatic → Marine	1.82%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.82%
Sediment	Environmental → Aquatic → Sediment	1.82%
Cave	Environmental → Terrestrial → Cave	1.82%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.82%
Peat	Environmental → Terrestrial → Peat	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.36%
Loam	Environmental → Terrestrial → Soil → Loam	22.73%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.18%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	5.45%
Lake	Environmental → Aquatic → Freshwater → Lake	4.55%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.82%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	1.82%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.82%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.82%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.82%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.91%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.91%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.91%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	15.45%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	14.55%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.18%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.27%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	5.45%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	4.55%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.82%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.82%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.82%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.91%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.91%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.91%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.91%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.91%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	15.45%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	9.09%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	9.09%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	7.27%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	7.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.45%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.45%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.55%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.64%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	2.73%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.73%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.82%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.82%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	1.82%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.82%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.82%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.82%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	1.82%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.82%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.91%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.91%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.91%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.91%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.91%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002911	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm	Environmental	Open in IMG/M
3300004067	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005524	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014269	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1	Environmental	Open in IMG/M
3300014885	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D	Environmental	Open in IMG/M
3300015259	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D	Environmental	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025160	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2	Environmental	Open in IMG/M
3300025310	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)	Environmental	Open in IMG/M
3300025325	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)	Environmental	Open in IMG/M
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300031280	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033406	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25390J43892_101592692	3300002911	Grasslands Soil	MRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE*
Ga0055485_100858352	3300004067	Natural And Restored Wetlands	RGGLSMAERRRDDERADEPPSPPAEHGYTADEEAEVQKRLEDLGYVE*
Ga0063356_1022288491	3300004463	Arabidopsis Thaliana Rhizosphere	MSKRPDAPGEGDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE*
Ga0063356_1040277492	3300004463	Arabidopsis Thaliana Rhizosphere	MSERRRDEDEKPADPAAPPADGGYTAEEEAEVQKRLEDLGYVE*
Ga0066672_100498712	3300005167	Soil	MRDRRGDDPEKKPDDERPADSGYTKDEEAEVRKRLEDLGYVE*
Ga0066673_103344951	3300005175	Soil	MLERRENDPTPPAPEPPADDSAYSEDEEAEVRKRLEDLGYVE*
Ga0066679_100915282	3300005176	Soil	MRDRRGDDPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE*
Ga0066690_107428052	3300005177	Soil	MPERRPDEPPNEPPARRDDAGYTEEEEDEVRKRLEDLGYVE*
Ga0065707_102856242	3300005295	Switchgrass Rhizosphere	MSKRPEAPGDDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE*
Ga0066388_1005502292	3300005332	Tropical Forest Soil	MAERRPEDSEDTPAPPPATDSGYTEEEEAEVQKRLEDLGYVE*
Ga0066388_1012341302	3300005332	Tropical Forest Soil	MSERRPEAPPPANEPAPSDSAYTEEEEAEVQKRLEDLGYVE*
Ga0070711_1012510312	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MLERRPEAPLPTNEPAPSDSAYTEEEEAEVQKRLEDLGYVE*
Ga0070700_1000849022	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MSKRPDAPGDGDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE*
Ga0070708_1000873302	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MAERRPDTPEPPAPPAERDDTAYSEEEEAEVRKRLEDLGYVE*
Ga0070708_1018566502	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MSERRPDEPPNEPPRGGDDAGYTEEEEDEVRKRLEDLGYVE*
Ga0070706_1007093912	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MAERRPADETDPPAPPAEDSSYTEEEEAEVQKRLEDLGYVE*
Ga0070707_1007873452	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MRDRRRDEPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE*
Ga0070698_1004083781	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MDKRRTETPEPPAPPAERDGTAYSEEEEAEVRKRLEDLGYVE*
Ga0070699_1014403312	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	STTMLERRPEAPLPTNEPAPSDSAYTEEEEAEVQKRLEDLGYVE*
Ga0070737_1000038512	3300005524	Surface Soil	MVERDPDPAEKAPASPPAADPAYTEEEEAEVQKRLEELGYVE*
Ga0073909_100141184	3300005526	Surface Soil	MSERRPEAPPPTADPAPSDSAYTEEEEAEVQKRLEDLGYVE*
Ga0070741_10000101136	3300005529	Surface Soil	MVERDPDPAEKTPASPPPADAAYTEEEEAEVQKRLEELGYVE*
Ga0070741_1000211410	3300005529	Surface Soil	MSDRRPEAPPPPEEPKDSAYTEEEEAEVQKRLEDLGYVE*
Ga0070741_100114385	3300005529	Surface Soil	MADRHPQPSPAENEEPKPPTATDTAYTEEEEAEVHKRLEDLGYVE*
Ga0070734_1000013741	3300005533	Surface Soil	MAERDPHPPEKQPTPTSPADAAYTEEEEAEVQKRLEELGYVE*
Ga0070697_1001361062	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MSERRPDEPPNEPPARRDDAGYTEEEEDEVRKRLEDLGYVE*
Ga0070697_1002414102	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MSDRRREQPQAPEPPKPADDAGYTDEEAAEVQKRLEELGYVE*
Ga0070697_1008315181	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MAERRPDSPSPEQPPKRPGDGYTEEEEAEVRKRLEDLGYVE*
Ga0070696_1004429082	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	PPARPTKGSTTMLERRPEAPLPTNEPAPSDSAYTEEEEAEVQKRLEDLGYVE*
Ga0066905_1002792472	3300005713	Tropical Forest Soil	MSDRHPDAPREQPAAPPPAEADDAGYTEDEEAEVRKRLEDLGYVE*
Ga0066903_1001751553	3300005764	Tropical Forest Soil	MPERRPPAESEQPPAPSTPATDSAYTEEEEAEVQKRLEDLGYVE*
Ga0066903_1027436032	3300005764	Tropical Forest Soil	MAERRPDPSEPPVAPTPADSAYTEEEEAEVQKRLEDLGYVE*
Ga0066903_1073269601	3300005764	Tropical Forest Soil	MDERRRDDVPSSPPPPQPKDDAGYTEDEEAEVRKRLEDLGYVE*
Ga0079037_1002463272	3300006224	Freshwater Wetlands	MAERRPDAPEEPKPEPPADGSAYTEDEEAEVRKRLEDLGYVE*
Ga0075431_1012483921	3300006847	Populus Rhizosphere	PTMPDRRPNEEQPTKPVPPAGNDDAAYTEEEEAEVQKRLEDLGYVE*
Ga0073934_100103814	3300006865	Hot Spring Sediment	MADRHPKKDDQEPTKPAAPEDSAYTEDEEAEVQKRLEDLGYVE*
Ga0075424_1004386112	3300006904	Populus Rhizosphere	MPERRPEAPPPANEPAPSDSAYTEEEEAEVQKRLEDLGYVE*
Ga0075436_1007499902	3300006914	Populus Rhizosphere	MPDRRPESPQPPASEPPTQDESGYSEEEEAEVRKRLEDLGYVE*
Ga0079218_105264782	3300007004	Agricultural Soil	MSERRQDDPVEKTPATPPPADTGYTEEEEAEVQKRLEDLGYVE*
Ga0066710_1024375131	3300009012	Grasslands Soil	MADRRPANETDPPAPPAEDSSYTEEEEAEVQKRLEDLGYVE
Ga0066710_1028334421	3300009012	Grasslands Soil	MSDRHPDAPREQPVAPPPADDAGYTEDEEAEVRKRLEDLGYVE
Ga0099829_106148092	3300009038	Vadose Zone Soil	MDERRTETHEPPAPPAERDGTAYSEEEEAEVRKRLEDLGYVE*
Ga0066709_1011416962	3300009137	Grasslands Soil	MVERRRDDVPDTPPAPPKDDAGYTDEEEAEVRKRLEDLGYVE*
Ga0066709_1019135772	3300009137	Grasslands Soil	SASAGGARAGAPGSPPPEHPEDASYSEEEEAEVRKRLEDLGYVK*
Ga0066709_1046519241	3300009137	Grasslands Soil	MAERRRDDVPEMPPAAPPKDNAGYTEEEEAEVRKRLEDLGYVE*
Ga0111538_120199581	3300009156	Populus Rhizosphere	MSKRPDSPGDGDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE*
Ga0075423_103967992	3300009162	Populus Rhizosphere	MSERRPDAPPPVDPAEPRDSAYTEEEEAEVQKRLEDLGYVE*
Ga0126382_109836232	3300010047	Tropical Forest Soil	MSDRHPDAPREQPAAPPPADDAGYTEDEEAEVRKRLEDLGYVE*
Ga0126372_113427102	3300010360	Tropical Forest Soil	MSERRPDDPVEKPTTPPPADTGYTEEEEAEVQKRLEDLGYVE*
Ga0136847_100119443	3300010391	Freshwater Sediment	MSKRPEVPSGDEQRPYAPPPDNTGYTDEEEAEVKKRLEDLGYVE*
Ga0136847_101273994	3300010391	Freshwater Sediment	MPDGRPDVPAEQPAAPPPADDAGYTEEEEAEVRKRLEDLGYVE*
Ga0136847_106575242	3300010391	Freshwater Sediment	MAERRSPDDPTPAAPPAPATESAYTEEEEAEVQKRLEDLGYVE*
Ga0134124_130173452	3300010397	Terrestrial Soil	MPERRQDDPRRDEQGRPADDGYTPEEEAEVQKRLEDLGYVE*
Ga0134122_102734962	3300010400	Terrestrial Soil	MSKRPEAPRREEERPYAPPPPDNSGYTDEEEAEVRKRLEDLGYLE*
Ga0137364_104915141	3300012198	Vadose Zone Soil	MRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGY
Ga0137394_100271582	3300012922	Vadose Zone Soil	MRKPDPDSPPPDKPEDTAYTDEEEAEVQKRLEDLGYVE*
Ga0157373_112957431	3300013100	Corn Rhizosphere	MSERRPDDPVEKPASPPPADTGYTEEEEAEVQKRLEDLGYVE*
Ga0134081_100484741	3300014150	Grasslands Soil	VMRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE*
Ga0075302_11722082	3300014269	Natural And Restored Wetlands	MPDQQEAEQQPTAPPPADDAGYTDDEEAEVRKRLEDLGYVE*
Ga0180063_10020534	3300014885	Soil	MPERRPDQPAEQPAAPPPADTGYTEEEEAEVQKRLEDLGYVE*
Ga0180085_11279851	3300015259	Soil	QPAEQPAAPPPADTGYTEEEEAEVQKRLEDLGYVE*
Ga0134089_102465352	3300015358	Grasslands Soil	MLERRQPDEDVDPPPAPEAPKDDSAYSEDEEAEVRKRLEDLGYVE*
Ga0134112_100707761	3300017656	Grasslands Soil	PEAPAPPAPEPAEDAAYSEEEEAEVRKRLEDLGYVE
Ga0066655_104370882	3300018431	Grasslands Soil	MRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE
Ga0066662_104542772	3300018468	Grasslands Soil	MPERRPDEPPNEPPARRDDAGYTEEEEDEVRKRLEDLGYVE
Ga0066669_100242104	3300018482	Grasslands Soil	MHDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE
Ga0187892_100288203	3300019458	Bio-Ooze	MSERRRDDEEKPAEPAAPPADGGYTAEEEAEVQKRLEDLGYVE
Ga0187892_104945072	3300019458	Bio-Ooze	MSDRRPEEPKDRETPPPASDAAYTEEEEAEVQKRLEDLGYVE
Ga0137408_12078911	3300019789	Vadose Zone Soil	MRDRRGDDPEKKPDAERPADSGYTEDEEAEVRKRLE
Ga0209109_105529661	3300025160	Soil	MAERRREQPEDAPPAPPASDAAYTEEEEAEVQKRLEDLGY
Ga0209172_100548461	3300025310	Hot Spring Sediment	MADRHPKKDDQEPTKPAAPEDSAYTEDEEAEVQKRLEDLGYVE
Ga0209341_103322512	3300025325	Soil	MAERRREQPEDVPPAPPASDAAYTEEEEAEVQKRLEDLGYVE
Ga0207684_102933781	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MAERRPADETDPPAPPAEDSSYTEEEEAEVQKRLEDLGYVE
Ga0207684_110465821	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MAERRPDTPEPPAPPAERDDTAYSEEEEAEVRKRL
Ga0207646_100807572	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MAERRPDTPEPPAPPAERDDTAYSEEEEAEVRKRLEDLGYVE
Ga0207646_108363492	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MRDRRRDEPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE
Ga0207708_101125612	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MSKRPDAPGDGDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE
Ga0209761_11671341	3300026313	Grasslands Soil	MRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRL
Ga0209154_10571182	3300026317	Soil	MRDRRGDDPEKKPDDERPADSGYTKDEEAEVRKRLEDLGYVE
Ga0209375_11036012	3300026329	Soil	RSTRRGEPVMHDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE
Ga0209806_13419821	3300026529	Soil	RGEPVMRDRRGDDPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE
Ga0209581_100077719	3300027706	Surface Soil	MVERDPDPAEKAPASPPAADPAYTEEEEAEVQKRLEELGYVE
Ga0209581_100097118	3300027706	Surface Soil	MVERDPDPAEKTPASPPPADAAYTEEEEAEVQKRLEELGYVE
Ga0209811_100226833	3300027821	Surface Soil	MSERRPEAPPPTADPAPSDSAYTEEEEAEVQKRLEDLGYVE
Ga0209060_1000022991	3300027826	Surface Soil	MAERDPHPPEKQPTPTSPADAAYTEEEEAEVQKRLEELGYVE
Ga0209450_110696172	3300027885	Freshwater Lake Sediment	MAERRPDAPEEPKPEPPADGSAYTEDEEAEVRKRLEDLGYVE
Ga0209486_108534512	3300027886	Agricultural Soil	MSERRQDDPVEKTPATPPPADTGYTEEEEAEVQKRLEDLGYVE
Ga0209253_100056116	3300027900	Freshwater Lake Sediment	MAERRPDAPEEPKPEPPADDSAYTEDEEAEVRKRLEDLGYVE
Ga0307428_11132891	3300031280	Salt Marsh	MADRRPAPETEETPAPAPASDTAYTEEEEAEVQKRLEDLG
Ga0307469_103073753	3300031720	Hardwood Forest Soil	MAERRPDVPAPSAPEPPDDAAYTEEEEEEVRKRLEDLGYVE
Ga0307469_118000852	3300031720	Hardwood Forest Soil	MRDRRGDEPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE
Ga0307475_106583682	3300031754	Hardwood Forest Soil	MADRHRQPEPANQEPTPPPAADTAYTEEEEAEVQKRLEDLGYVE
Ga0307473_113286211	3300031820	Hardwood Forest Soil	MAERRPEAPALPAPEPAEDAAYSEEEEEEVRKRLEDLGYLE
Ga0315910_104326742	3300032144	Soil	PERRHDDPRSNEQGHAPADDEYTAEEEAEVQKRLEDLGYVE
Ga0307471_1003050032	3300032180	Hardwood Forest Soil	MAERHPEAPAPSAPKPPDDGYTEEEEEEVRKRLEDLGYVE
Ga0307471_1014247481	3300032180	Hardwood Forest Soil	MRDRRGDEPEKKPDAERPADSGYTEDEEAEVRKRL
Ga0307471_1027438131	3300032180	Hardwood Forest Soil	MAERRPDDEPSAPVPPAADDDTGYTEDEEAEVRKRLEDLGYVE
Ga0307472_1011642362	3300032205	Hardwood Forest Soil	MAERRPQDSEDIPAPPPASDSGYTEEEEAEVHKRLEDLGYVE
Ga0310896_109384772	3300032211	Soil	MSKRPEAPGDDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE
Ga0315287_100918262	3300032397	Sediment	MSERRPDEPEEQPATPPPADSGYTAEEEAEVQKRLEDLGYVE
Ga0335085_124615132	3300032770	Soil	RRPEADQPEAPPPPSQDTAYTEEEEAEVQKRLEDLGYVE
Ga0335070_109170912	3300032829	Soil	MADRRPGEPEKTPTPPPEQKPDSAYTEEEEAEVQKRLEDLGYVE
Ga0335084_103622111	3300033004	Soil	EPEKTPPPPEQKPDSAYTEEEEAEVQKRLEDLGYVE
Ga0334722_110822032	3300033233	Sediment	HRPDAPAEQPGAPPPANDAGYTEEEEAEVRKRLEDLGYVE
Ga0316604_107985762	3300033406	Soil	MAERRRDDERADEPPPPPAESGYTADEEAEVQKRLEDLGYVE
Ga0316619_113629432	3300033414	Soil	MAERRPDAPEEPKPEPPADGPAYTEDEEAEVRKRLEDLGYVE
Ga0326726_107402002	3300033433	Peat Soil	MAERRPPDDPIPAAPPAAESAYTEEEEAEVQKRLEDLGYVE
Ga0316620_100229333	3300033480	Soil	MSERRPDAPEEPKTPPPAADTAYTEDEEAEVQKRLEDLGYVE
Ga0316620_102890222	3300033480	Soil	MSERRPDEPVEKPAAPPPADSGYTEEEEAEVQKRLEDLGYVE
Ga0316630_112556941	3300033487	Soil	MSERRREDDRADEPTPPPAESGYTAEEEAEVQKRLEDLGYVE

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F087394

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign