| Basic Information | |
|---|---|
| Family ID | F087394 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSERRPDEPVEKPAAPPPADSGYTEEEEAEVQKRLEDLGYVE |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.71 % |
| % of genes near scaffold ends (potentially truncated) | 15.45 % |
| % of genes from short scaffolds (< 2000 bps) | 55.45 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (15.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF07683 | CobW_C | 48.18 |
| PF03721 | UDPG_MGDP_dh_N | 32.73 |
| PF01663 | Phosphodiest | 3.64 |
| PF02033 | RBFA | 0.91 |
| PF00072 | Response_reg | 0.91 |
| PF02492 | cobW | 0.91 |
| PF00535 | Glycos_transf_2 | 0.91 |
| PF00158 | Sigma54_activat | 0.91 |
| PF00884 | Sulfatase | 0.91 |
| PF14667 | Polysacc_synt_C | 0.91 |
| PF03720 | UDPG_MGDP_dh_C | 0.91 |
| PF13439 | Glyco_transf_4 | 0.91 |
| PF01351 | RNase_HII | 0.91 |
| PF01243 | Putative_PNPOx | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 48.18 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 32.73 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 32.73 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 32.73 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 32.73 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 32.73 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.91 |
| COG0858 | Ribosome-binding factor RbfA | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.73 % |
| Unclassified | root | N/A | 27.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002911|JGI25390J43892_10159269 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300004463|Ga0063356_104027749 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005167|Ga0066672_10049871 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300005175|Ga0066673_10334495 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005176|Ga0066679_10091528 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300005177|Ga0066690_10742805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300005332|Ga0066388_100550229 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300005332|Ga0066388_101234130 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300005439|Ga0070711_101251031 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005445|Ga0070708_101856650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300005467|Ga0070706_100709391 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005468|Ga0070707_100787345 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005518|Ga0070699_101440331 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005524|Ga0070737_10000385 | All Organisms → cellular organisms → Bacteria | 99384 | Open in IMG/M |
| 3300005526|Ga0073909_10014118 | All Organisms → cellular organisms → Bacteria | 2488 | Open in IMG/M |
| 3300005529|Ga0070741_10000101 | All Organisms → cellular organisms → Bacteria | 320166 | Open in IMG/M |
| 3300005529|Ga0070741_10002114 | All Organisms → cellular organisms → Bacteria | 55295 | Open in IMG/M |
| 3300005529|Ga0070741_10011438 | All Organisms → cellular organisms → Bacteria | 16394 | Open in IMG/M |
| 3300005533|Ga0070734_10000137 | All Organisms → cellular organisms → Bacteria | 201073 | Open in IMG/M |
| 3300005536|Ga0070697_100136106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2063 | Open in IMG/M |
| 3300005536|Ga0070697_100831518 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005546|Ga0070696_100442908 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005764|Ga0066903_100175155 | All Organisms → cellular organisms → Bacteria | 3149 | Open in IMG/M |
| 3300005764|Ga0066903_102743603 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005764|Ga0066903_107326960 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006224|Ga0079037_100246327 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300006847|Ga0075431_101248392 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300006865|Ga0073934_10010381 | All Organisms → cellular organisms → Bacteria | 11588 | Open in IMG/M |
| 3300006904|Ga0075424_100438611 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300007004|Ga0079218_10526478 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300009012|Ga0066710_102437513 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009012|Ga0066710_102833442 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300009038|Ga0099829_10614809 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300009137|Ga0066709_101141696 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300009137|Ga0066709_104651924 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009162|Ga0075423_10396799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1448 | Open in IMG/M |
| 3300010360|Ga0126372_11342710 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010391|Ga0136847_10127399 | All Organisms → cellular organisms → Bacteria | 5343 | Open in IMG/M |
| 3300010391|Ga0136847_10657524 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300012198|Ga0137364_10491514 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300012922|Ga0137394_10027158 | All Organisms → cellular organisms → Bacteria | 4630 | Open in IMG/M |
| 3300013100|Ga0157373_11295743 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300014150|Ga0134081_10048474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1265 | Open in IMG/M |
| 3300014269|Ga0075302_1172208 | Not Available | 538 | Open in IMG/M |
| 3300014885|Ga0180063_1002053 | All Organisms → cellular organisms → Bacteria | 5565 | Open in IMG/M |
| 3300015259|Ga0180085_1127985 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300015358|Ga0134089_10246535 | Not Available | 729 | Open in IMG/M |
| 3300018431|Ga0066655_10437088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300018468|Ga0066662_10454277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1149 | Open in IMG/M |
| 3300018482|Ga0066669_10024210 | All Organisms → cellular organisms → Bacteria | 3466 | Open in IMG/M |
| 3300019458|Ga0187892_10028820 | All Organisms → cellular organisms → Bacteria | 4650 | Open in IMG/M |
| 3300019458|Ga0187892_10494507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
| 3300019789|Ga0137408_1207891 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300025160|Ga0209109_10552966 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300025310|Ga0209172_10054846 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
| 3300025325|Ga0209341_10332251 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300025910|Ga0207684_10293378 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300025922|Ga0207646_10836349 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300026313|Ga0209761_1167134 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300026317|Ga0209154_1057118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1725 | Open in IMG/M |
| 3300026329|Ga0209375_1103601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1275 | Open in IMG/M |
| 3300026529|Ga0209806_1341982 | Not Available | 502 | Open in IMG/M |
| 3300027706|Ga0209581_1000777 | All Organisms → cellular organisms → Bacteria | 49273 | Open in IMG/M |
| 3300027706|Ga0209581_1000971 | All Organisms → cellular organisms → Bacteria | 40150 | Open in IMG/M |
| 3300027821|Ga0209811_10022683 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300027826|Ga0209060_10000229 | All Organisms → cellular organisms → Bacteria | 128432 | Open in IMG/M |
| 3300027885|Ga0209450_11069617 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300027886|Ga0209486_10853451 | Not Available | 600 | Open in IMG/M |
| 3300027900|Ga0209253_10005611 | All Organisms → cellular organisms → Bacteria | 10882 | Open in IMG/M |
| 3300031280|Ga0307428_1113289 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031720|Ga0307469_11800085 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031754|Ga0307475_10658368 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300032180|Ga0307471_101424748 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300032205|Ga0307472_101164236 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300032397|Ga0315287_10091826 | All Organisms → cellular organisms → Bacteria | 3435 | Open in IMG/M |
| 3300032770|Ga0335085_12461513 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032829|Ga0335070_10917091 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300033004|Ga0335084_10362211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1496 | Open in IMG/M |
| 3300033233|Ga0334722_11082203 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300033414|Ga0316619_11362943 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300033433|Ga0326726_10740200 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300033480|Ga0316620_10022933 | All Organisms → cellular organisms → Bacteria | 3782 | Open in IMG/M |
| 3300033480|Ga0316620_10289022 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300033487|Ga0316630_11255694 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 15.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 9.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.73% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.82% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.82% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.82% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.82% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.91% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.91% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300031280 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-240 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25390J43892_101592692 | 3300002911 | Grasslands Soil | MRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE* |
| Ga0055485_100858352 | 3300004067 | Natural And Restored Wetlands | RGGLSMAERRRDDERADEPPSPPAEHGYTADEEAEVQKRLEDLGYVE* |
| Ga0063356_1022288491 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSKRPDAPGEGDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE* |
| Ga0063356_1040277492 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSERRRDEDEKPADPAAPPADGGYTAEEEAEVQKRLEDLGYVE* |
| Ga0066672_100498712 | 3300005167 | Soil | MRDRRGDDPEKKPDDERPADSGYTKDEEAEVRKRLEDLGYVE* |
| Ga0066673_103344951 | 3300005175 | Soil | MLERRENDPTPPAPEPPADDSAYSEDEEAEVRKRLEDLGYVE* |
| Ga0066679_100915282 | 3300005176 | Soil | MRDRRGDDPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE* |
| Ga0066690_107428052 | 3300005177 | Soil | MPERRPDEPPNEPPARRDDAGYTEEEEDEVRKRLEDLGYVE* |
| Ga0065707_102856242 | 3300005295 | Switchgrass Rhizosphere | MSKRPEAPGDDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE* |
| Ga0066388_1005502292 | 3300005332 | Tropical Forest Soil | MAERRPEDSEDTPAPPPATDSGYTEEEEAEVQKRLEDLGYVE* |
| Ga0066388_1012341302 | 3300005332 | Tropical Forest Soil | MSERRPEAPPPANEPAPSDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0070711_1012510312 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLERRPEAPLPTNEPAPSDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0070700_1000849022 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKRPDAPGDGDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE* |
| Ga0070708_1000873302 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERRPDTPEPPAPPAERDDTAYSEEEEAEVRKRLEDLGYVE* |
| Ga0070708_1018566502 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERRPDEPPNEPPRGGDDAGYTEEEEDEVRKRLEDLGYVE* |
| Ga0070706_1007093912 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERRPADETDPPAPPAEDSSYTEEEEAEVQKRLEDLGYVE* |
| Ga0070707_1007873452 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDRRRDEPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE* |
| Ga0070698_1004083781 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKRRTETPEPPAPPAERDGTAYSEEEEAEVRKRLEDLGYVE* |
| Ga0070699_1014403312 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | STTMLERRPEAPLPTNEPAPSDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0070737_1000038512 | 3300005524 | Surface Soil | MVERDPDPAEKAPASPPAADPAYTEEEEAEVQKRLEELGYVE* |
| Ga0073909_100141184 | 3300005526 | Surface Soil | MSERRPEAPPPTADPAPSDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0070741_10000101136 | 3300005529 | Surface Soil | MVERDPDPAEKTPASPPPADAAYTEEEEAEVQKRLEELGYVE* |
| Ga0070741_1000211410 | 3300005529 | Surface Soil | MSDRRPEAPPPPEEPKDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0070741_100114385 | 3300005529 | Surface Soil | MADRHPQPSPAENEEPKPPTATDTAYTEEEEAEVHKRLEDLGYVE* |
| Ga0070734_1000013741 | 3300005533 | Surface Soil | MAERDPHPPEKQPTPTSPADAAYTEEEEAEVQKRLEELGYVE* |
| Ga0070697_1001361062 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERRPDEPPNEPPARRDDAGYTEEEEDEVRKRLEDLGYVE* |
| Ga0070697_1002414102 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDRRREQPQAPEPPKPADDAGYTDEEAAEVQKRLEELGYVE* |
| Ga0070697_1008315181 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERRPDSPSPEQPPKRPGDGYTEEEEAEVRKRLEDLGYVE* |
| Ga0070696_1004429082 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PPARPTKGSTTMLERRPEAPLPTNEPAPSDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0066905_1002792472 | 3300005713 | Tropical Forest Soil | MSDRHPDAPREQPAAPPPAEADDAGYTEDEEAEVRKRLEDLGYVE* |
| Ga0066903_1001751553 | 3300005764 | Tropical Forest Soil | MPERRPPAESEQPPAPSTPATDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0066903_1027436032 | 3300005764 | Tropical Forest Soil | MAERRPDPSEPPVAPTPADSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0066903_1073269601 | 3300005764 | Tropical Forest Soil | MDERRRDDVPSSPPPPQPKDDAGYTEDEEAEVRKRLEDLGYVE* |
| Ga0079037_1002463272 | 3300006224 | Freshwater Wetlands | MAERRPDAPEEPKPEPPADGSAYTEDEEAEVRKRLEDLGYVE* |
| Ga0075431_1012483921 | 3300006847 | Populus Rhizosphere | PTMPDRRPNEEQPTKPVPPAGNDDAAYTEEEEAEVQKRLEDLGYVE* |
| Ga0073934_100103814 | 3300006865 | Hot Spring Sediment | MADRHPKKDDQEPTKPAAPEDSAYTEDEEAEVQKRLEDLGYVE* |
| Ga0075424_1004386112 | 3300006904 | Populus Rhizosphere | MPERRPEAPPPANEPAPSDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0075436_1007499902 | 3300006914 | Populus Rhizosphere | MPDRRPESPQPPASEPPTQDESGYSEEEEAEVRKRLEDLGYVE* |
| Ga0079218_105264782 | 3300007004 | Agricultural Soil | MSERRQDDPVEKTPATPPPADTGYTEEEEAEVQKRLEDLGYVE* |
| Ga0066710_1024375131 | 3300009012 | Grasslands Soil | MADRRPANETDPPAPPAEDSSYTEEEEAEVQKRLEDLGYVE |
| Ga0066710_1028334421 | 3300009012 | Grasslands Soil | MSDRHPDAPREQPVAPPPADDAGYTEDEEAEVRKRLEDLGYVE |
| Ga0099829_106148092 | 3300009038 | Vadose Zone Soil | MDERRTETHEPPAPPAERDGTAYSEEEEAEVRKRLEDLGYVE* |
| Ga0066709_1011416962 | 3300009137 | Grasslands Soil | MVERRRDDVPDTPPAPPKDDAGYTDEEEAEVRKRLEDLGYVE* |
| Ga0066709_1019135772 | 3300009137 | Grasslands Soil | SASAGGARAGAPGSPPPEHPEDASYSEEEEAEVRKRLEDLGYVK* |
| Ga0066709_1046519241 | 3300009137 | Grasslands Soil | MAERRRDDVPEMPPAAPPKDNAGYTEEEEAEVRKRLEDLGYVE* |
| Ga0111538_120199581 | 3300009156 | Populus Rhizosphere | MSKRPDSPGDGDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE* |
| Ga0075423_103967992 | 3300009162 | Populus Rhizosphere | MSERRPDAPPPVDPAEPRDSAYTEEEEAEVQKRLEDLGYVE* |
| Ga0126382_109836232 | 3300010047 | Tropical Forest Soil | MSDRHPDAPREQPAAPPPADDAGYTEDEEAEVRKRLEDLGYVE* |
| Ga0126372_113427102 | 3300010360 | Tropical Forest Soil | MSERRPDDPVEKPTTPPPADTGYTEEEEAEVQKRLEDLGYVE* |
| Ga0136847_100119443 | 3300010391 | Freshwater Sediment | MSKRPEVPSGDEQRPYAPPPDNTGYTDEEEAEVKKRLEDLGYVE* |
| Ga0136847_101273994 | 3300010391 | Freshwater Sediment | MPDGRPDVPAEQPAAPPPADDAGYTEEEEAEVRKRLEDLGYVE* |
| Ga0136847_106575242 | 3300010391 | Freshwater Sediment | MAERRSPDDPTPAAPPAPATESAYTEEEEAEVQKRLEDLGYVE* |
| Ga0134124_130173452 | 3300010397 | Terrestrial Soil | MPERRQDDPRRDEQGRPADDGYTPEEEAEVQKRLEDLGYVE* |
| Ga0134122_102734962 | 3300010400 | Terrestrial Soil | MSKRPEAPRREEERPYAPPPPDNSGYTDEEEAEVRKRLEDLGYLE* |
| Ga0137364_104915141 | 3300012198 | Vadose Zone Soil | MRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGY |
| Ga0137394_100271582 | 3300012922 | Vadose Zone Soil | MRKPDPDSPPPDKPEDTAYTDEEEAEVQKRLEDLGYVE* |
| Ga0157373_112957431 | 3300013100 | Corn Rhizosphere | MSERRPDDPVEKPASPPPADTGYTEEEEAEVQKRLEDLGYVE* |
| Ga0134081_100484741 | 3300014150 | Grasslands Soil | VMRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE* |
| Ga0075302_11722082 | 3300014269 | Natural And Restored Wetlands | MPDQQEAEQQPTAPPPADDAGYTDDEEAEVRKRLEDLGYVE* |
| Ga0180063_10020534 | 3300014885 | Soil | MPERRPDQPAEQPAAPPPADTGYTEEEEAEVQKRLEDLGYVE* |
| Ga0180085_11279851 | 3300015259 | Soil | QPAEQPAAPPPADTGYTEEEEAEVQKRLEDLGYVE* |
| Ga0134089_102465352 | 3300015358 | Grasslands Soil | MLERRQPDEDVDPPPAPEAPKDDSAYSEDEEAEVRKRLEDLGYVE* |
| Ga0134112_100707761 | 3300017656 | Grasslands Soil | PEAPAPPAPEPAEDAAYSEEEEAEVRKRLEDLGYVE |
| Ga0066655_104370882 | 3300018431 | Grasslands Soil | MRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE |
| Ga0066662_104542772 | 3300018468 | Grasslands Soil | MPERRPDEPPNEPPARRDDAGYTEEEEDEVRKRLEDLGYVE |
| Ga0066669_100242104 | 3300018482 | Grasslands Soil | MHDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE |
| Ga0187892_100288203 | 3300019458 | Bio-Ooze | MSERRRDDEEKPAEPAAPPADGGYTAEEEAEVQKRLEDLGYVE |
| Ga0187892_104945072 | 3300019458 | Bio-Ooze | MSDRRPEEPKDRETPPPASDAAYTEEEEAEVQKRLEDLGYVE |
| Ga0137408_12078911 | 3300019789 | Vadose Zone Soil | MRDRRGDDPEKKPDAERPADSGYTEDEEAEVRKRLE |
| Ga0209109_105529661 | 3300025160 | Soil | MAERRREQPEDAPPAPPASDAAYTEEEEAEVQKRLEDLGY |
| Ga0209172_100548461 | 3300025310 | Hot Spring Sediment | MADRHPKKDDQEPTKPAAPEDSAYTEDEEAEVQKRLEDLGYVE |
| Ga0209341_103322512 | 3300025325 | Soil | MAERRREQPEDVPPAPPASDAAYTEEEEAEVQKRLEDLGYVE |
| Ga0207684_102933781 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERRPADETDPPAPPAEDSSYTEEEEAEVQKRLEDLGYVE |
| Ga0207684_110465821 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERRPDTPEPPAPPAERDDTAYSEEEEAEVRKRL |
| Ga0207646_100807572 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERRPDTPEPPAPPAERDDTAYSEEEEAEVRKRLEDLGYVE |
| Ga0207646_108363492 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDRRRDEPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE |
| Ga0207708_101125612 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKRPDAPGDGDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE |
| Ga0209761_11671341 | 3300026313 | Grasslands Soil | MRDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRL |
| Ga0209154_10571182 | 3300026317 | Soil | MRDRRGDDPEKKPDDERPADSGYTKDEEAEVRKRLEDLGYVE |
| Ga0209375_11036012 | 3300026329 | Soil | RSTRRGEPVMHDRRGDDPEKKPDDERPADSGYTEDEEAEVRKRLEDLGYVE |
| Ga0209806_13419821 | 3300026529 | Soil | RGEPVMRDRRGDDPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE |
| Ga0209581_100077719 | 3300027706 | Surface Soil | MVERDPDPAEKAPASPPAADPAYTEEEEAEVQKRLEELGYVE |
| Ga0209581_100097118 | 3300027706 | Surface Soil | MVERDPDPAEKTPASPPPADAAYTEEEEAEVQKRLEELGYVE |
| Ga0209811_100226833 | 3300027821 | Surface Soil | MSERRPEAPPPTADPAPSDSAYTEEEEAEVQKRLEDLGYVE |
| Ga0209060_1000022991 | 3300027826 | Surface Soil | MAERDPHPPEKQPTPTSPADAAYTEEEEAEVQKRLEELGYVE |
| Ga0209450_110696172 | 3300027885 | Freshwater Lake Sediment | MAERRPDAPEEPKPEPPADGSAYTEDEEAEVRKRLEDLGYVE |
| Ga0209486_108534512 | 3300027886 | Agricultural Soil | MSERRQDDPVEKTPATPPPADTGYTEEEEAEVQKRLEDLGYVE |
| Ga0209253_100056116 | 3300027900 | Freshwater Lake Sediment | MAERRPDAPEEPKPEPPADDSAYTEDEEAEVRKRLEDLGYVE |
| Ga0307428_11132891 | 3300031280 | Salt Marsh | MADRRPAPETEETPAPAPASDTAYTEEEEAEVQKRLEDLG |
| Ga0307469_103073753 | 3300031720 | Hardwood Forest Soil | MAERRPDVPAPSAPEPPDDAAYTEEEEEEVRKRLEDLGYVE |
| Ga0307469_118000852 | 3300031720 | Hardwood Forest Soil | MRDRRGDEPEKKPDAERPADSGYTEDEEAEVRKRLEDLGYVE |
| Ga0307475_106583682 | 3300031754 | Hardwood Forest Soil | MADRHRQPEPANQEPTPPPAADTAYTEEEEAEVQKRLEDLGYVE |
| Ga0307473_113286211 | 3300031820 | Hardwood Forest Soil | MAERRPEAPALPAPEPAEDAAYSEEEEEEVRKRLEDLGYLE |
| Ga0315910_104326742 | 3300032144 | Soil | PERRHDDPRSNEQGHAPADDEYTAEEEAEVQKRLEDLGYVE |
| Ga0307471_1003050032 | 3300032180 | Hardwood Forest Soil | MAERHPEAPAPSAPKPPDDGYTEEEEEEVRKRLEDLGYVE |
| Ga0307471_1014247481 | 3300032180 | Hardwood Forest Soil | MRDRRGDEPEKKPDAERPADSGYTEDEEAEVRKRL |
| Ga0307471_1027438131 | 3300032180 | Hardwood Forest Soil | MAERRPDDEPSAPVPPAADDDTGYTEDEEAEVRKRLEDLGYVE |
| Ga0307472_1011642362 | 3300032205 | Hardwood Forest Soil | MAERRPQDSEDIPAPPPASDSGYTEEEEAEVHKRLEDLGYVE |
| Ga0310896_109384772 | 3300032211 | Soil | MSKRPEAPGDDDRPVAPPPDDSGYTDEEEAEVRKRLEDLGYVE |
| Ga0315287_100918262 | 3300032397 | Sediment | MSERRPDEPEEQPATPPPADSGYTAEEEAEVQKRLEDLGYVE |
| Ga0335085_124615132 | 3300032770 | Soil | RRPEADQPEAPPPPSQDTAYTEEEEAEVQKRLEDLGYVE |
| Ga0335070_109170912 | 3300032829 | Soil | MADRRPGEPEKTPTPPPEQKPDSAYTEEEEAEVQKRLEDLGYVE |
| Ga0335084_103622111 | 3300033004 | Soil | EPEKTPPPPEQKPDSAYTEEEEAEVQKRLEDLGYVE |
| Ga0334722_110822032 | 3300033233 | Sediment | HRPDAPAEQPGAPPPANDAGYTEEEEAEVRKRLEDLGYVE |
| Ga0316604_107985762 | 3300033406 | Soil | MAERRRDDERADEPPPPPAESGYTADEEAEVQKRLEDLGYVE |
| Ga0316619_113629432 | 3300033414 | Soil | MAERRPDAPEEPKPEPPADGPAYTEDEEAEVRKRLEDLGYVE |
| Ga0326726_107402002 | 3300033433 | Peat Soil | MAERRPPDDPIPAAPPAAESAYTEEEEAEVQKRLEDLGYVE |
| Ga0316620_100229333 | 3300033480 | Soil | MSERRPDAPEEPKTPPPAADTAYTEDEEAEVQKRLEDLGYVE |
| Ga0316620_102890222 | 3300033480 | Soil | MSERRPDEPVEKPAAPPPADSGYTEEEEAEVQKRLEDLGYVE |
| Ga0316630_112556941 | 3300033487 | Soil | MSERRREDDRADEPTPPPAESGYTAEEEAEVQKRLEDLGYVE |
| ⦗Top⦘ |