NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087344

Metagenome Family F087344

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087344
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 48 residues
Representative Sequence LGKRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP
Number of Associated Samples 90
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.09 %
% of genes from short scaffolds (< 2000 bps) 93.64 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.182 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.000 % of family members)
Environment Ontology (ENVO) Unclassified
(39.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(66.364 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 30.26%    β-sheet: 0.00%    Coil/Unstructured: 69.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF13520AA_permease_2 69.09
PF07690MFS_1 14.55
PF06738ThrE 3.64
PF03845Spore_permease 1.82
PF06897DUF1269 0.91
PF00324AA_permease 0.91
PF12821ThrE_2 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG2966Uncharacterized membrane protein YjjP, DUF1212 familyFunction unknown [S] 3.64
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 2.73
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 2.73
COG0814Amino acid permeaseAmino acid transport and metabolism [E] 1.82
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.91
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.91
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.18 %
UnclassifiedrootN/A1.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_11452811All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300003993|Ga0055468_10038224All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300003993|Ga0055468_10204494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300004114|Ga0062593_101834325All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300004157|Ga0062590_101763464All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300004157|Ga0062590_102825053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300004463|Ga0063356_100658253All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300004480|Ga0062592_100503404All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300005093|Ga0062594_103265744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300005331|Ga0070670_101118700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08719Open in IMG/M
3300005339|Ga0070660_100919535All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005341|Ga0070691_10110672All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300005341|Ga0070691_11092776All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005345|Ga0070692_10535940All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300005354|Ga0070675_101364188All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005355|Ga0070671_101084646All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300005356|Ga0070674_100840225All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005444|Ga0070694_101641587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila546Open in IMG/M
3300005456|Ga0070678_100371325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300005457|Ga0070662_100253338All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300005457|Ga0070662_101393028All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005459|Ga0068867_101007399All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005466|Ga0070685_10882364All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300005530|Ga0070679_101950926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila536Open in IMG/M
3300005535|Ga0070684_100475294All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300005535|Ga0070684_101362743All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300005564|Ga0070664_100068439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3035Open in IMG/M
3300005564|Ga0070664_101450641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300005615|Ga0070702_100268071All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300005618|Ga0068864_101951716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08593Open in IMG/M
3300005719|Ga0068861_102447666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300005834|Ga0068851_10455924All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005937|Ga0081455_10966523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila528Open in IMG/M
3300006038|Ga0075365_10013101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4945Open in IMG/M
3300006038|Ga0075365_10828049All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300006237|Ga0097621_101568958All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300006881|Ga0068865_101938662All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300006903|Ga0075426_10543108All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300007004|Ga0079218_11272174All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300009078|Ga0105106_10718137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08713Open in IMG/M
3300009146|Ga0105091_10384331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08697Open in IMG/M
3300009148|Ga0105243_10283847All Organisms → cellular organisms → Bacteria1492Open in IMG/M
3300009167|Ga0113563_12999932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila571Open in IMG/M
3300009176|Ga0105242_10784344All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300009176|Ga0105242_11068474All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300009551|Ga0105238_11572313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300009553|Ga0105249_11913195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08666Open in IMG/M
3300010037|Ga0126304_10084550All Organisms → cellular organisms → Bacteria1985Open in IMG/M
3300010373|Ga0134128_11092085All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300011119|Ga0105246_11014814All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300012892|Ga0157294_10225485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300012903|Ga0157289_10252144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300012908|Ga0157286_10121504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08796Open in IMG/M
3300012911|Ga0157301_10160405All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012914|Ga0157297_10208654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300012916|Ga0157310_10176169All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300012971|Ga0126369_12418668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300012984|Ga0164309_10581604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300013297|Ga0157378_12686766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300013306|Ga0163162_10752390All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300013306|Ga0163162_12688279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila573Open in IMG/M
3300013308|Ga0157375_11657000All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300013308|Ga0157375_12360823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08634Open in IMG/M
3300014326|Ga0157380_12467480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila585Open in IMG/M
3300014969|Ga0157376_12681386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila538Open in IMG/M
3300015371|Ga0132258_12467685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1301Open in IMG/M
3300015371|Ga0132258_12894976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1193Open in IMG/M
3300015372|Ga0132256_100825335All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300015373|Ga0132257_100090024All Organisms → cellular organisms → Bacteria3513Open in IMG/M
3300015373|Ga0132257_100902535All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300015374|Ga0132255_100398824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2002Open in IMG/M
3300015374|Ga0132255_101187480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1149Open in IMG/M
3300015374|Ga0132255_103758744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08645Open in IMG/M
3300015374|Ga0132255_104988386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila562Open in IMG/M
3300015374|Ga0132255_105048502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila559Open in IMG/M
3300018469|Ga0190270_11721196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia681Open in IMG/M
3300018481|Ga0190271_13713643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila511Open in IMG/M
3300022901|Ga0247788_1061536All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300023072|Ga0247799_1048877All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300025898|Ga0207692_11089716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300025899|Ga0207642_11115498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila510Open in IMG/M
3300025901|Ga0207688_10127559All Organisms → cellular organisms → Bacteria1489Open in IMG/M
3300025901|Ga0207688_10304730All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300025917|Ga0207660_10075302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2466Open in IMG/M
3300025919|Ga0207657_10519757All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300025920|Ga0207649_11052181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila641Open in IMG/M
3300025932|Ga0207690_10298434All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300025935|Ga0207709_11145940All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300025938|Ga0207704_11525386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300025942|Ga0207689_11398371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila586Open in IMG/M
3300025944|Ga0207661_10520558All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300025944|Ga0207661_10713727All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300025949|Ga0207667_10560749All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300026041|Ga0207639_11149750All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300026121|Ga0207683_11382093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300026121|Ga0207683_12041134Not Available522Open in IMG/M
3300026770|Ga0207537_103513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila595Open in IMG/M
3300028379|Ga0268266_11231242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300028589|Ga0247818_10128441All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300028592|Ga0247822_11257020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08619Open in IMG/M
3300028802|Ga0307503_10595848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300028812|Ga0247825_10030286All Organisms → cellular organisms → Bacteria3566Open in IMG/M
3300028889|Ga0247827_10672136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08672Open in IMG/M
3300031942|Ga0310916_11431875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300031943|Ga0310885_10581036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300032000|Ga0310903_10034004All Organisms → cellular organisms → Bacteria1850Open in IMG/M
3300032013|Ga0310906_10287375All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300032013|Ga0310906_10315961All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300033551|Ga0247830_11375993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.18%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere8.18%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere7.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.45%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.73%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.82%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.82%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.91%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026770Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1145281113300000890SoilLGKRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTTTTTP*
Ga0055468_1003822413300003993Natural And Restored WetlandsLGKRVVDHSFQLPLQVCWVATALAGIVIVWLFFGGHTPEPPVTTTPAP*
Ga0055468_1020449413300003993Natural And Restored WetlandsVIDHSFQLPLQVCWIVTALVGIAIVWLFFGGHTPAPPAPPVTP*
Ga0062593_10183432523300004114SoilGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP*
Ga0062590_10176346423300004157SoilVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP*
Ga0062590_10282505323300004157SoilGTTTLGKRVIDHSFQIPLQICWIVTLLAGCAIVYLFFGDQTPAPPVPTTTVPTTP*
Ga0063356_10065825323300004463Arabidopsis Thaliana RhizosphereTTLGKRVVDHSFQLPLQICWVVTALTGIVIVWLFFGDQTPAPPVPAAP*
Ga0062592_10050340423300004480SoilTTGTTTLGKRVVDHSFQFPLQICWIVTALTGIAIVWLFFGGHTPAPPVPTTP*
Ga0062594_10326574413300005093SoilDHSFQLPLQIAWVVTALAGIVIVYLFFGDHTPAPPVPTTTAP*
Ga0070670_10111870023300005331Switchgrass RhizosphereVDHSFQVPLQICWIVTALAGLAIVWLFFGDQTPPPPVPAAP*
Ga0070660_10091953523300005339Corn RhizosphereTTNLGKRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP*
Ga0070691_1011067223300005341Corn, Switchgrass And Miscanthus RhizosphereDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP*
Ga0070691_1109277623300005341Corn, Switchgrass And Miscanthus RhizosphereTGTTTLGRRVVDHSFQFPLQIAWITTALVGIAIVFLFFNDHTPAAP*
Ga0070692_1053594023300005345Corn, Switchgrass And Miscanthus RhizosphereTTLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP*
Ga0070675_10136418813300005354Miscanthus RhizosphereLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP*
Ga0070671_10108464623300005355Switchgrass RhizosphereTSLGKRVVDHSFQLPLQICWVVTALAGIAIVWLFFGGHTPAPSTTPAPTTP*
Ga0070674_10084022523300005356Miscanthus RhizosphereIAAAEADETGTTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP*
Ga0070694_10164158713300005444Corn, Switchgrass And Miscanthus RhizosphereLGKRVVDHSFQLPLQICWVVTALAGIVIVWLFFGGHTPTPPAPATPTP*
Ga0070678_10037132523300005456Miscanthus RhizosphereVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPVPTTTVP*
Ga0070662_10025333823300005457Corn RhizosphereKRVVDHSFQLPLQVCWVVTALTGIAIVWLFFGGHTPAPPTPTAPTTP*
Ga0070662_10139302813300005457Corn RhizosphereLGKRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP*
Ga0068867_10100739913300005459Miscanthus RhizosphereKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP*
Ga0070685_1088236423300005466Switchgrass RhizosphereSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP*
Ga0070679_10195092613300005530Corn RhizosphereDHSFQLPLQICWVVTALTGIAIVWLFFGGQTPAPPAVPTTPTP*
Ga0070684_10047529413300005535Corn RhizosphereIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP*
Ga0070684_10136274323300005535Corn RhizosphereLGKRVVDHSFQLPLQVCWVVTALTGIAIVWLFFGGHTPAPPTPTAPTTP*
Ga0070664_10006843943300005564Corn RhizosphereSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP*
Ga0070664_10145064123300005564Corn RhizosphereTTNLGKRVVDHSFQVPLQICWIVTALAGLAIVWLFFGDQTPPPPVSATP*
Ga0070702_10026807123300005615Corn, Switchgrass And Miscanthus RhizosphereVIDHSFQLPLQVCWIVTALAGIVIVKLFFGDHTPPPPIPTSPSQ*
Ga0068864_10195171613300005618Switchgrass RhizosphereDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP*
Ga0068861_10244766623300005719Switchgrass RhizosphereLGKRVIDHSFQIPLQIAWITTLIAGCVIVYLFFGGHTPSPPAPPATP*
Ga0068851_1045592423300005834Corn RhizosphereTLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP*
Ga0081455_1096652323300005937Tabebuia Heterophylla RhizosphereFQLPLQICWVVTALAGIVIVWLFFGGHTPAPPAAPTPTTP*
Ga0075365_1001310163300006038Populus EndosphereLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP*
Ga0075365_1082804923300006038Populus EndosphereRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP*
Ga0097621_10156895813300006237Miscanthus RhizosphereKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP*
Ga0068865_10193866213300006881Miscanthus RhizosphereTTTLGKRVIDHSFQIPLQIAWITTLIAGCVIVYLFFGGHTPSPPAPPATP*
Ga0075426_1054310813300006903Populus RhizosphereGTTTLGKRVFDHSFQFPLQIVWIVTALVGIFIAWAFFGGHTPSVPSPTSTTGG*
Ga0079218_1127217413300007004Agricultural SoilDHSFQLPLQICWVVTALVAIVIVWLFFGDQTPAPPTPSTPTP*
Ga0105106_1071813713300009078Freshwater SedimentQLPLQVAWIVSVLVAIVIVKLFFDDQVPAPPVPTTTVP*
Ga0105091_1038433123300009146Freshwater SedimentKRVVDHSFQLPLQICWIVTALVGILIVWLFFGDQTPAPPAPTTTPAP*
Ga0105243_1028384723300009148Miscanthus RhizosphereGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP*
Ga0113563_1299993223300009167Freshwater WetlandsIDHSFQLPLQVCWIVTALVGMAIVWLFFGDQTPAPPVPTTP*
Ga0105242_1078434423300009176Miscanthus RhizosphereKRVIDHSFQLPLQVCWIVTALAGIVIVKLFFGDHTPPPPIPTSPSQ*
Ga0105242_1106847423300009176Miscanthus RhizosphereGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP*
Ga0105238_1157231323300009551Corn RhizosphereVIDHSFQLPLQIAWVVTALVGCLIVYLFCGDHTPAPPVPTTTVP*
Ga0105249_1191319513300009553Switchgrass RhizosphereRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP*
Ga0126304_1008455013300010037Serpentine SoilKRVLDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTTTTTP*
Ga0134128_1109208513300010373Terrestrial SoilTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP*
Ga0105246_1101481413300011119Miscanthus RhizosphereGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP*
Ga0157294_1022548523300012892SoilLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP*
Ga0157289_1025214423300012903SoilDHSFQLPLQICWIVTLLAGCAIVYLFFGDHTPAPPVPAPAAP*
Ga0157286_1012150413300012908SoilKRVVDHSFQLPLQIAWVVTLLAGCAIVYLFFGDHTPVPPVPTTTTP*
Ga0157301_1016040523300012911SoilTLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTPATP*
Ga0157297_1020865413300012914SoilEADETGGTTLGKRVIDHSFQLPLQIAWVVTALAGIVIVKLFFGDHTPAPPAALPRP*
Ga0157310_1017616923300012916SoilTNLGKRVVDHSFQLPLQICWMVTAVTGIVIVWLFFGGHTPAPPVPTTTATP*
Ga0126369_1241866813300012971Tropical Forest SoilTLGKRVIDHSFQLPLQVAWIVTALTGVLIVWLFFGGHTPAPPVPTTTTP*
Ga0164309_1058160413300012984SoilTLGKRVIDHSFQLPLQIVWVVTALVGCLIVWLFFGGHTPVPSSPTTTVPVP*
Ga0157378_1268676613300013297Miscanthus RhizosphereHSFQLPLQICWVVTALAGIAIVWLFFGGHTPAPSTTPAPTTP*
Ga0163162_1075239013300013306Switchgrass RhizosphereTTNLGKRVIDHSFQVPLQICWIVTALAGIGIVWLFFGGHTPTPPAAP*
Ga0163162_1268827913300013306Switchgrass RhizosphereTTGTTSLGKRVIDHSFQVPLQICWIVTALAGIAISWLFFGSHTPSIPTASVP*
Ga0157375_1165700023300013308Miscanthus RhizosphereRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP*
Ga0157375_1236082323300013308Miscanthus RhizosphereVDHSFQLPLQICWVVTALTGIAIVWLFFGGQTPAPPAVPTTPTP*
Ga0157380_1246748013300014326Switchgrass RhizosphereIAAAEADTTGTTNLGKRVIDHSFQVPLQICWIVTALAGIGISWLFFGGHTPSVPTASVP*
Ga0157376_1268138623300014969Miscanthus RhizosphereTGMTNLGKRVIDHSFHVPLQICRMDTALAGIGIYWLFFGGHTPSVPTASVP*
Ga0173483_1053118713300015077SoilQICWTVTLVAGCAIVYLFFGDHTPVPTVPTTTVP*
Ga0132258_1246768523300015371Arabidopsis RhizosphereETGSTTLGKRVLDHSFQLPLQIAWVVTALVGCLIVWLFFGDHTPAPPVPTTAP*
Ga0132258_1289497613300015371Arabidopsis RhizosphereAEADETGSTTLGKRVVDHSFQLPLQIAWVTTVIAGIVIVWLFFGGHTPAPPAGTTTTP*
Ga0132256_10082533513300015372Arabidopsis RhizosphereTLGKRVIDHSFQVPLQICWIVKAITGMVVVWLFFGGHTPAPPVPTTTGP*
Ga0132257_10009002413300015373Arabidopsis RhizosphereHSFQLPLQIVWVVTALVGVLIVWLFFGGHTPAPPAPATSTP*
Ga0132257_10090253523300015373Arabidopsis RhizosphereAEADTTGTTNLGKRVVDHSFQVPLQICWIVTALAGLAIVWLFFGDQTPPPPVPATP*
Ga0132255_10039882413300015374Arabidopsis RhizosphereTLGKRVIDHSFQLPLQIVWVVTALVGVVIVWLFFGGHTPAPPAPATSTP*
Ga0132255_10118748013300015374Arabidopsis RhizosphereTLGKRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPAPTTTAP*
Ga0132255_10375874413300015374Arabidopsis RhizosphereDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTTTTTP*
Ga0132255_10498838613300015374Arabidopsis RhizosphereTTTLGKRVIDHSFQLPLQIVWVVTALVGALIVWLFFGDQTPAPPGPVTSTP*
Ga0132255_10504850213300015374Arabidopsis RhizosphereKRVVDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPTTPAPTTP*
Ga0190270_1172119613300018469SoilHSFQLPLQVVWIVSVLVGLAIVWAFFGGHTPAPPVPPVTP
Ga0190271_1371364313300018481SoilKRVVDHSFQVPLQVLWIVTALVGIGIAYLMGDQSAAPAPPAAP
Ga0247788_106153613300022901SoilRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP
Ga0247799_104887723300023072SoilKRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP
Ga0207692_1108971623300025898Corn, Switchgrass And Miscanthus RhizosphereKRVIDHSFQLPLQIVWVVTALVGCLIVWLFFGGHTPVPSVPTTVTP
Ga0207642_1111549813300025899Miscanthus RhizosphereGTTNLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP
Ga0207688_1012755923300025901Corn, Switchgrass And Miscanthus RhizosphereIAAAEADETGTTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTG
Ga0207688_1030473023300025901Corn, Switchgrass And Miscanthus RhizosphereAEADETGTTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP
Ga0207660_1007530233300025917Corn RhizosphereDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP
Ga0207657_1051975713300025919Corn RhizosphereHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP
Ga0207649_1105218123300025920Corn RhizosphereTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP
Ga0207690_1029843413300025932Corn RhizosphereDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP
Ga0207709_1114594013300025935Miscanthus RhizosphereTTLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP
Ga0207704_1152538623300025938Miscanthus RhizosphereADETGTTTLGKRVIDHSFQIPLQIAWITTLIAGCVIVYLFFGGHTPSPPAPPATP
Ga0207689_1139837113300025942Miscanthus RhizosphereVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP
Ga0207661_1052055813300025944Corn RhizosphereTGSTTLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP
Ga0207661_1071372723300025944Corn RhizosphereTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP
Ga0207667_1056074923300025949Corn RhizosphereGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP
Ga0207639_1114975013300026041Corn RhizosphereVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP
Ga0207683_1138209323300026121Miscanthus RhizosphereETGGTTLGKRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPVPTTTVP
Ga0207683_1204113413300026121Miscanthus RhizosphereSFQLPLQIAWVVSVIAGCVIVWLFFGGHTPAPPAGTGTTTTP
Ga0207537_10351313300026770SoilGTTTLGKRVIDHSFQLPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP
Ga0268266_1123124213300028379Switchgrass RhizosphereKRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPVPTTTVP
Ga0247818_1012844133300028589SoilRAGLVRLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP
Ga0247822_1125702013300028592SoilTTLGKRVVDHSFQVPLQVCWVVTALAGIVIVWLFFGGQTPAPPAPAASTP
Ga0307503_1059584823300028802SoilGKRVIDHSFQVPLQICWVVTLLAGCAIVYLFFGDHTPVPPVPTAP
Ga0247825_1003028643300028812SoilAGLVRLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP
Ga0247827_1067213613300028889SoilKRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTTTAP
Ga0310916_1143187513300031942SoilGKRVVDHSFQLPLQIVWLVTALVGILIVWLFFGGHTPAPSVPTTTTTTP
Ga0310885_1058103623300031943SoilSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPVPTTTVP
Ga0310903_1003400433300032000SoilDTTGTTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP
Ga0310906_1028737523300032013SoilGKRVLDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTVP
Ga0310906_1031596123300032013SoilKRVVDHSFQLPLQVCWVVTALTGIAIVWLFFGGHTPAPPTPTAPTTP
Ga0247830_1137599313300033551SoilKRVVDHSFQLPLQVCWIATALAGIVIAWIFFGDQAPAAPVTTTPVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.