| Basic Information | |
|---|---|
| Family ID | F087344 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 48 residues |
| Representative Sequence | LGKRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 93.64 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (66.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.26% β-sheet: 0.00% Coil/Unstructured: 69.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13520 | AA_permease_2 | 69.09 |
| PF07690 | MFS_1 | 14.55 |
| PF06738 | ThrE | 3.64 |
| PF03845 | Spore_permease | 1.82 |
| PF06897 | DUF1269 | 0.91 |
| PF00324 | AA_permease | 0.91 |
| PF12821 | ThrE_2 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2966 | Uncharacterized membrane protein YjjP, DUF1212 family | Function unknown [S] | 3.64 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 2.73 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 2.73 |
| COG0814 | Amino acid permease | Amino acid transport and metabolism [E] | 1.82 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.91 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.91 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.18 % |
| Unclassified | root | N/A | 1.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11452811 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300003993|Ga0055468_10038224 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300003993|Ga0055468_10204494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300004114|Ga0062593_101834325 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300004157|Ga0062590_101763464 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300004157|Ga0062590_102825053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300004463|Ga0063356_100658253 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300004480|Ga0062592_100503404 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005093|Ga0062594_103265744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300005331|Ga0070670_101118700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 719 | Open in IMG/M |
| 3300005339|Ga0070660_100919535 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005341|Ga0070691_10110672 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300005341|Ga0070691_11092776 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005345|Ga0070692_10535940 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005354|Ga0070675_101364188 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005355|Ga0070671_101084646 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005356|Ga0070674_100840225 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005444|Ga0070694_101641587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 546 | Open in IMG/M |
| 3300005456|Ga0070678_100371325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1235 | Open in IMG/M |
| 3300005457|Ga0070662_100253338 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300005457|Ga0070662_101393028 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005459|Ga0068867_101007399 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005466|Ga0070685_10882364 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005530|Ga0070679_101950926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 536 | Open in IMG/M |
| 3300005535|Ga0070684_100475294 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300005535|Ga0070684_101362743 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005564|Ga0070664_100068439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3035 | Open in IMG/M |
| 3300005564|Ga0070664_101450641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300005615|Ga0070702_100268071 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300005618|Ga0068864_101951716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 593 | Open in IMG/M |
| 3300005719|Ga0068861_102447666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300005834|Ga0068851_10455924 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005937|Ga0081455_10966523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 528 | Open in IMG/M |
| 3300006038|Ga0075365_10013101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4945 | Open in IMG/M |
| 3300006038|Ga0075365_10828049 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006237|Ga0097621_101568958 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006881|Ga0068865_101938662 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300006903|Ga0075426_10543108 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300007004|Ga0079218_11272174 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009078|Ga0105106_10718137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 713 | Open in IMG/M |
| 3300009146|Ga0105091_10384331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 697 | Open in IMG/M |
| 3300009148|Ga0105243_10283847 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300009167|Ga0113563_12999932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 571 | Open in IMG/M |
| 3300009176|Ga0105242_10784344 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300009176|Ga0105242_11068474 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300009551|Ga0105238_11572313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300009553|Ga0105249_11913195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 666 | Open in IMG/M |
| 3300010037|Ga0126304_10084550 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300010373|Ga0134128_11092085 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300011119|Ga0105246_11014814 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012892|Ga0157294_10225485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300012903|Ga0157289_10252144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300012908|Ga0157286_10121504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 796 | Open in IMG/M |
| 3300012911|Ga0157301_10160405 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012914|Ga0157297_10208654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300012916|Ga0157310_10176169 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012971|Ga0126369_12418668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300012984|Ga0164309_10581604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300013297|Ga0157378_12686766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300013306|Ga0163162_10752390 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300013306|Ga0163162_12688279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 573 | Open in IMG/M |
| 3300013308|Ga0157375_11657000 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300013308|Ga0157375_12360823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 634 | Open in IMG/M |
| 3300014326|Ga0157380_12467480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 585 | Open in IMG/M |
| 3300014969|Ga0157376_12681386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 538 | Open in IMG/M |
| 3300015371|Ga0132258_12467685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1301 | Open in IMG/M |
| 3300015371|Ga0132258_12894976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1193 | Open in IMG/M |
| 3300015372|Ga0132256_100825335 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300015373|Ga0132257_100090024 | All Organisms → cellular organisms → Bacteria | 3513 | Open in IMG/M |
| 3300015373|Ga0132257_100902535 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300015374|Ga0132255_100398824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2002 | Open in IMG/M |
| 3300015374|Ga0132255_101187480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300015374|Ga0132255_103758744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 645 | Open in IMG/M |
| 3300015374|Ga0132255_104988386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 562 | Open in IMG/M |
| 3300015374|Ga0132255_105048502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 559 | Open in IMG/M |
| 3300018469|Ga0190270_11721196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300018481|Ga0190271_13713643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 511 | Open in IMG/M |
| 3300022901|Ga0247788_1061536 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300023072|Ga0247799_1048877 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300025898|Ga0207692_11089716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300025899|Ga0207642_11115498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 510 | Open in IMG/M |
| 3300025901|Ga0207688_10127559 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300025901|Ga0207688_10304730 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300025917|Ga0207660_10075302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2466 | Open in IMG/M |
| 3300025919|Ga0207657_10519757 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300025920|Ga0207649_11052181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 641 | Open in IMG/M |
| 3300025932|Ga0207690_10298434 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300025935|Ga0207709_11145940 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300025938|Ga0207704_11525386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300025942|Ga0207689_11398371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 586 | Open in IMG/M |
| 3300025944|Ga0207661_10520558 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300025944|Ga0207661_10713727 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300025949|Ga0207667_10560749 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300026041|Ga0207639_11149750 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300026121|Ga0207683_11382093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300026121|Ga0207683_12041134 | Not Available | 522 | Open in IMG/M |
| 3300026770|Ga0207537_103513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 595 | Open in IMG/M |
| 3300028379|Ga0268266_11231242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300028589|Ga0247818_10128441 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300028592|Ga0247822_11257020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 619 | Open in IMG/M |
| 3300028802|Ga0307503_10595848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300028812|Ga0247825_10030286 | All Organisms → cellular organisms → Bacteria | 3566 | Open in IMG/M |
| 3300028889|Ga0247827_10672136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Tetrasphaera → unclassified Tetrasphaera → Tetrasphaera sp. F2B08 | 672 | Open in IMG/M |
| 3300031942|Ga0310916_11431875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300031943|Ga0310885_10581036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300032000|Ga0310903_10034004 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300032013|Ga0310906_10287375 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300032013|Ga0310906_10315961 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300033551|Ga0247830_11375993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.18% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 8.18% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.82% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026770 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_114528111 | 3300000890 | Soil | LGKRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTTTTTP* |
| Ga0055468_100382241 | 3300003993 | Natural And Restored Wetlands | LGKRVVDHSFQLPLQVCWVATALAGIVIVWLFFGGHTPEPPVTTTPAP* |
| Ga0055468_102044941 | 3300003993 | Natural And Restored Wetlands | VIDHSFQLPLQVCWIVTALVGIAIVWLFFGGHTPAPPAPPVTP* |
| Ga0062593_1018343252 | 3300004114 | Soil | GKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP* |
| Ga0062590_1017634642 | 3300004157 | Soil | VIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP* |
| Ga0062590_1028250532 | 3300004157 | Soil | GTTTLGKRVIDHSFQIPLQICWIVTLLAGCAIVYLFFGDQTPAPPVPTTTVPTTP* |
| Ga0063356_1006582532 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TTLGKRVVDHSFQLPLQICWVVTALTGIVIVWLFFGDQTPAPPVPAAP* |
| Ga0062592_1005034042 | 3300004480 | Soil | TTGTTTLGKRVVDHSFQFPLQICWIVTALTGIAIVWLFFGGHTPAPPVPTTP* |
| Ga0062594_1032657441 | 3300005093 | Soil | DHSFQLPLQIAWVVTALAGIVIVYLFFGDHTPAPPVPTTTAP* |
| Ga0070670_1011187002 | 3300005331 | Switchgrass Rhizosphere | VDHSFQVPLQICWIVTALAGLAIVWLFFGDQTPPPPVPAAP* |
| Ga0070660_1009195352 | 3300005339 | Corn Rhizosphere | TTNLGKRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP* |
| Ga0070691_101106722 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | DHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP* |
| Ga0070691_110927762 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | TGTTTLGRRVVDHSFQFPLQIAWITTALVGIAIVFLFFNDHTPAAP* |
| Ga0070692_105359402 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TTLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP* |
| Ga0070675_1013641881 | 3300005354 | Miscanthus Rhizosphere | LGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP* |
| Ga0070671_1010846462 | 3300005355 | Switchgrass Rhizosphere | TSLGKRVVDHSFQLPLQICWVVTALAGIAIVWLFFGGHTPAPSTTPAPTTP* |
| Ga0070674_1008402252 | 3300005356 | Miscanthus Rhizosphere | IAAAEADETGTTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP* |
| Ga0070694_1016415871 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LGKRVVDHSFQLPLQICWVVTALAGIVIVWLFFGGHTPTPPAPATPTP* |
| Ga0070678_1003713252 | 3300005456 | Miscanthus Rhizosphere | VIDHSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPVPTTTVP* |
| Ga0070662_1002533382 | 3300005457 | Corn Rhizosphere | KRVVDHSFQLPLQVCWVVTALTGIAIVWLFFGGHTPAPPTPTAPTTP* |
| Ga0070662_1013930281 | 3300005457 | Corn Rhizosphere | LGKRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP* |
| Ga0068867_1010073991 | 3300005459 | Miscanthus Rhizosphere | KRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP* |
| Ga0070685_108823642 | 3300005466 | Switchgrass Rhizosphere | SFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP* |
| Ga0070679_1019509261 | 3300005530 | Corn Rhizosphere | DHSFQLPLQICWVVTALTGIAIVWLFFGGQTPAPPAVPTTPTP* |
| Ga0070684_1004752941 | 3300005535 | Corn Rhizosphere | IDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP* |
| Ga0070684_1013627432 | 3300005535 | Corn Rhizosphere | LGKRVVDHSFQLPLQVCWVVTALTGIAIVWLFFGGHTPAPPTPTAPTTP* |
| Ga0070664_1000684394 | 3300005564 | Corn Rhizosphere | SFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP* |
| Ga0070664_1014506412 | 3300005564 | Corn Rhizosphere | TTNLGKRVVDHSFQVPLQICWIVTALAGLAIVWLFFGDQTPPPPVSATP* |
| Ga0070702_1002680712 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDHSFQLPLQVCWIVTALAGIVIVKLFFGDHTPPPPIPTSPSQ* |
| Ga0068864_1019517161 | 3300005618 | Switchgrass Rhizosphere | DHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP* |
| Ga0068861_1024476662 | 3300005719 | Switchgrass Rhizosphere | LGKRVIDHSFQIPLQIAWITTLIAGCVIVYLFFGGHTPSPPAPPATP* |
| Ga0068851_104559242 | 3300005834 | Corn Rhizosphere | TLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP* |
| Ga0081455_109665232 | 3300005937 | Tabebuia Heterophylla Rhizosphere | FQLPLQICWVVTALAGIVIVWLFFGGHTPAPPAAPTPTTP* |
| Ga0075365_100131016 | 3300006038 | Populus Endosphere | LGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP* |
| Ga0075365_108280492 | 3300006038 | Populus Endosphere | RVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP* |
| Ga0097621_1015689581 | 3300006237 | Miscanthus Rhizosphere | KRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP* |
| Ga0068865_1019386621 | 3300006881 | Miscanthus Rhizosphere | TTTLGKRVIDHSFQIPLQIAWITTLIAGCVIVYLFFGGHTPSPPAPPATP* |
| Ga0075426_105431081 | 3300006903 | Populus Rhizosphere | GTTTLGKRVFDHSFQFPLQIVWIVTALVGIFIAWAFFGGHTPSVPSPTSTTGG* |
| Ga0079218_112721741 | 3300007004 | Agricultural Soil | DHSFQLPLQICWVVTALVAIVIVWLFFGDQTPAPPTPSTPTP* |
| Ga0105106_107181371 | 3300009078 | Freshwater Sediment | QLPLQVAWIVSVLVAIVIVKLFFDDQVPAPPVPTTTVP* |
| Ga0105091_103843312 | 3300009146 | Freshwater Sediment | KRVVDHSFQLPLQICWIVTALVGILIVWLFFGDQTPAPPAPTTTPAP* |
| Ga0105243_102838472 | 3300009148 | Miscanthus Rhizosphere | GKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP* |
| Ga0113563_129999322 | 3300009167 | Freshwater Wetlands | IDHSFQLPLQVCWIVTALVGMAIVWLFFGDQTPAPPVPTTP* |
| Ga0105242_107843442 | 3300009176 | Miscanthus Rhizosphere | KRVIDHSFQLPLQVCWIVTALAGIVIVKLFFGDHTPPPPIPTSPSQ* |
| Ga0105242_110684742 | 3300009176 | Miscanthus Rhizosphere | GKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP* |
| Ga0105238_115723132 | 3300009551 | Corn Rhizosphere | VIDHSFQLPLQIAWVVTALVGCLIVYLFCGDHTPAPPVPTTTVP* |
| Ga0105249_119131951 | 3300009553 | Switchgrass Rhizosphere | RVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP* |
| Ga0126304_100845501 | 3300010037 | Serpentine Soil | KRVLDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTTTTTP* |
| Ga0134128_110920851 | 3300010373 | Terrestrial Soil | TLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP* |
| Ga0105246_110148141 | 3300011119 | Miscanthus Rhizosphere | GKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP* |
| Ga0157294_102254852 | 3300012892 | Soil | LGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP* |
| Ga0157289_102521442 | 3300012903 | Soil | DHSFQLPLQICWIVTLLAGCAIVYLFFGDHTPAPPVPAPAAP* |
| Ga0157286_101215041 | 3300012908 | Soil | KRVVDHSFQLPLQIAWVVTLLAGCAIVYLFFGDHTPVPPVPTTTTP* |
| Ga0157301_101604052 | 3300012911 | Soil | TLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTPATP* |
| Ga0157297_102086541 | 3300012914 | Soil | EADETGGTTLGKRVIDHSFQLPLQIAWVVTALAGIVIVKLFFGDHTPAPPAALPRP* |
| Ga0157310_101761692 | 3300012916 | Soil | TNLGKRVVDHSFQLPLQICWMVTAVTGIVIVWLFFGGHTPAPPVPTTTATP* |
| Ga0126369_124186681 | 3300012971 | Tropical Forest Soil | TLGKRVIDHSFQLPLQVAWIVTALTGVLIVWLFFGGHTPAPPVPTTTTP* |
| Ga0164309_105816041 | 3300012984 | Soil | TLGKRVIDHSFQLPLQIVWVVTALVGCLIVWLFFGGHTPVPSSPTTTVPVP* |
| Ga0157378_126867661 | 3300013297 | Miscanthus Rhizosphere | HSFQLPLQICWVVTALAGIAIVWLFFGGHTPAPSTTPAPTTP* |
| Ga0163162_107523901 | 3300013306 | Switchgrass Rhizosphere | TTNLGKRVIDHSFQVPLQICWIVTALAGIGIVWLFFGGHTPTPPAAP* |
| Ga0163162_126882791 | 3300013306 | Switchgrass Rhizosphere | TTGTTSLGKRVIDHSFQVPLQICWIVTALAGIAISWLFFGSHTPSIPTASVP* |
| Ga0157375_116570002 | 3300013308 | Miscanthus Rhizosphere | RVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP* |
| Ga0157375_123608232 | 3300013308 | Miscanthus Rhizosphere | VDHSFQLPLQICWVVTALTGIAIVWLFFGGQTPAPPAVPTTPTP* |
| Ga0157380_124674801 | 3300014326 | Switchgrass Rhizosphere | IAAAEADTTGTTNLGKRVIDHSFQVPLQICWIVTALAGIGISWLFFGGHTPSVPTASVP* |
| Ga0157376_126813862 | 3300014969 | Miscanthus Rhizosphere | TGMTNLGKRVIDHSFHVPLQICRMDTALAGIGIYWLFFGGHTPSVPTASVP* |
| Ga0173483_105311871 | 3300015077 | Soil | QICWTVTLVAGCAIVYLFFGDHTPVPTVPTTTVP* |
| Ga0132258_124676852 | 3300015371 | Arabidopsis Rhizosphere | ETGSTTLGKRVLDHSFQLPLQIAWVVTALVGCLIVWLFFGDHTPAPPVPTTAP* |
| Ga0132258_128949761 | 3300015371 | Arabidopsis Rhizosphere | AEADETGSTTLGKRVVDHSFQLPLQIAWVTTVIAGIVIVWLFFGGHTPAPPAGTTTTP* |
| Ga0132256_1008253351 | 3300015372 | Arabidopsis Rhizosphere | TLGKRVIDHSFQVPLQICWIVKAITGMVVVWLFFGGHTPAPPVPTTTGP* |
| Ga0132257_1000900241 | 3300015373 | Arabidopsis Rhizosphere | HSFQLPLQIVWVVTALVGVLIVWLFFGGHTPAPPAPATSTP* |
| Ga0132257_1009025352 | 3300015373 | Arabidopsis Rhizosphere | AEADTTGTTNLGKRVVDHSFQVPLQICWIVTALAGLAIVWLFFGDQTPPPPVPATP* |
| Ga0132255_1003988241 | 3300015374 | Arabidopsis Rhizosphere | TLGKRVIDHSFQLPLQIVWVVTALVGVVIVWLFFGGHTPAPPAPATSTP* |
| Ga0132255_1011874801 | 3300015374 | Arabidopsis Rhizosphere | TLGKRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPAPTTTAP* |
| Ga0132255_1037587441 | 3300015374 | Arabidopsis Rhizosphere | DHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTTTTTP* |
| Ga0132255_1049883861 | 3300015374 | Arabidopsis Rhizosphere | TTTLGKRVIDHSFQLPLQIVWVVTALVGALIVWLFFGDQTPAPPGPVTSTP* |
| Ga0132255_1050485021 | 3300015374 | Arabidopsis Rhizosphere | KRVVDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPTTPAPTTP* |
| Ga0190270_117211961 | 3300018469 | Soil | HSFQLPLQVVWIVSVLVGLAIVWAFFGGHTPAPPVPPVTP |
| Ga0190271_137136431 | 3300018481 | Soil | KRVVDHSFQVPLQVLWIVTALVGIGIAYLMGDQSAAPAPPAAP |
| Ga0247788_10615361 | 3300022901 | Soil | RVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP |
| Ga0247799_10488772 | 3300023072 | Soil | KRVVDHSFQVPLQICWVVTALAGIVIVWLFFGGHTPAPPVPTTTGP |
| Ga0207692_110897162 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KRVIDHSFQLPLQIVWVVTALVGCLIVWLFFGGHTPVPSVPTTVTP |
| Ga0207642_111154981 | 3300025899 | Miscanthus Rhizosphere | GTTNLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP |
| Ga0207688_101275592 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAAEADETGTTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTG |
| Ga0207688_103047302 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | AEADETGTTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP |
| Ga0207660_100753023 | 3300025917 | Corn Rhizosphere | DHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP |
| Ga0207657_105197571 | 3300025919 | Corn Rhizosphere | HSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP |
| Ga0207649_110521812 | 3300025920 | Corn Rhizosphere | TTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP |
| Ga0207690_102984341 | 3300025932 | Corn Rhizosphere | DHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPVPTTTGP |
| Ga0207709_111459401 | 3300025935 | Miscanthus Rhizosphere | TTLGKRVVDHSFQLPLQVCWIVTALVGMVIVWLFFGGHTPAPPTPTTAATP |
| Ga0207704_115253862 | 3300025938 | Miscanthus Rhizosphere | ADETGTTTLGKRVIDHSFQIPLQIAWITTLIAGCVIVYLFFGGHTPSPPAPPATP |
| Ga0207689_113983711 | 3300025942 | Miscanthus Rhizosphere | VIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP |
| Ga0207661_105205581 | 3300025944 | Corn Rhizosphere | TGSTTLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP |
| Ga0207661_107137272 | 3300025944 | Corn Rhizosphere | TTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPAPTTTGP |
| Ga0207667_105607492 | 3300025949 | Corn Rhizosphere | GKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP |
| Ga0207639_111497501 | 3300026041 | Corn Rhizosphere | VIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP |
| Ga0207683_113820932 | 3300026121 | Miscanthus Rhizosphere | ETGGTTLGKRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPVPTTTVP |
| Ga0207683_120411341 | 3300026121 | Miscanthus Rhizosphere | SFQLPLQIAWVVSVIAGCVIVWLFFGGHTPAPPAGTGTTTTP |
| Ga0207537_1035131 | 3300026770 | Soil | GTTTLGKRVIDHSFQLPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP |
| Ga0268266_112312421 | 3300028379 | Switchgrass Rhizosphere | KRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPVPTTTVP |
| Ga0247818_101284413 | 3300028589 | Soil | RAGLVRLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP |
| Ga0247822_112570201 | 3300028592 | Soil | TTLGKRVVDHSFQVPLQVCWVVTALAGIVIVWLFFGGQTPAPPAPAASTP |
| Ga0307503_105958482 | 3300028802 | Soil | GKRVIDHSFQVPLQICWVVTLLAGCAIVYLFFGDHTPVPPVPTAP |
| Ga0247825_100302864 | 3300028812 | Soil | AGLVRLGKRVIDHSFQLPLQICWVVTALTGIAIVWLFFGGHTPAPPAVPTTPTP |
| Ga0247827_106721361 | 3300028889 | Soil | KRVIDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTTTAP |
| Ga0310916_114318751 | 3300031942 | Soil | GKRVVDHSFQLPLQIVWLVTALVGILIVWLFFGGHTPAPSVPTTTTTTP |
| Ga0310885_105810362 | 3300031943 | Soil | SFQLPLQIAWVVTALVGCLIVYLFFGDQTPAPPVPTTTVP |
| Ga0310903_100340043 | 3300032000 | Soil | DTTGTTTLGKRVIDHSFQVPLQICWIVTAITGMVVVWLFFGGHTPAPPVPTTTGP |
| Ga0310906_102873752 | 3300032013 | Soil | GKRVLDHSFQLPLQIAWVVTALVGCLIVYLFFGDHTPAPPVPTVP |
| Ga0310906_103159612 | 3300032013 | Soil | KRVVDHSFQLPLQVCWVVTALTGIAIVWLFFGGHTPAPPTPTAPTTP |
| Ga0247830_113759931 | 3300033551 | Soil | KRVVDHSFQLPLQVCWIATALAGIVIAWIFFGDQAPAAPVTTTPVP |
| ⦗Top⦘ |