| Basic Information | |
|---|---|
| Family ID | F087342 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LRYGPSFGARYDFNDYIAFKAQLDHTVRRGEPDLNGLHLQLAFTF |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.80 % |
| % of genes near scaffold ends (potentially truncated) | 91.82 % |
| % of genes from short scaffolds (< 2000 bps) | 81.82 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.88% Coil/Unstructured: 67.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF12849 | PBP_like_2 | 13.64 |
| PF02310 | B12-binding | 8.18 |
| PF13400 | Tad | 0.91 |
| PF13545 | HTH_Crp_2 | 0.91 |
| PF05649 | Peptidase_M13_N | 0.91 |
| PF08448 | PAS_4 | 0.91 |
| PF00730 | HhH-GPD | 0.91 |
| PF01551 | Peptidase_M23 | 0.91 |
| PF00025 | Arf | 0.91 |
| PF13735 | tRNA_NucTran2_2 | 0.91 |
| PF01979 | Amidohydro_1 | 0.91 |
| PF00990 | GGDEF | 0.91 |
| PF03422 | CBM_6 | 0.91 |
| PF01148 | CTP_transf_1 | 0.91 |
| PF00378 | ECH_1 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.91 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.91 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.91 |
| COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.91 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.91 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.91 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.27 % |
| Unclassified | root | N/A | 2.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10261606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300001546|JGI12659J15293_10065944 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100221260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1785 | Open in IMG/M |
| 3300003321|soilH1_10231641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3140 | Open in IMG/M |
| 3300003351|JGI26346J50198_1009912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300004092|Ga0062389_101318762 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300004152|Ga0062386_101242773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300004152|Ga0062386_101749276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300005166|Ga0066674_10179864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300005176|Ga0066679_10071568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2051 | Open in IMG/M |
| 3300005176|Ga0066679_10865623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300005435|Ga0070714_102402549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300005439|Ga0070711_101857840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300005534|Ga0070735_10034321 | All Organisms → cellular organisms → Bacteria | 3491 | Open in IMG/M |
| 3300005591|Ga0070761_10202027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1177 | Open in IMG/M |
| 3300005591|Ga0070761_10586461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300005602|Ga0070762_10064042 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300005602|Ga0070762_10914692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300005712|Ga0070764_10079558 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300006052|Ga0075029_100618928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300006237|Ga0097621_101731042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300006800|Ga0066660_10884479 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300009038|Ga0099829_11637573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300009137|Ga0066709_103856213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300009522|Ga0116218_1370627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300009552|Ga0116138_1176925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300010046|Ga0126384_10872786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300010339|Ga0074046_10786916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300011270|Ga0137391_11509451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300012200|Ga0137382_10860376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300012351|Ga0137386_10777865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300012354|Ga0137366_10566872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300012356|Ga0137371_10127359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1990 | Open in IMG/M |
| 3300012361|Ga0137360_10554119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
| 3300012361|Ga0137360_11630840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300012917|Ga0137395_10517680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300012918|Ga0137396_10546657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300012925|Ga0137419_10494448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300012929|Ga0137404_11312221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300012930|Ga0137407_10073891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2849 | Open in IMG/M |
| 3300012930|Ga0137407_10719654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300012944|Ga0137410_10584256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300012975|Ga0134110_10289424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300012988|Ga0164306_11438941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300014501|Ga0182024_12930407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300015241|Ga0137418_10265208 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300015241|Ga0137418_10343709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
| 3300015245|Ga0137409_10734686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300017946|Ga0187879_10598026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300018043|Ga0187887_10030945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3368 | Open in IMG/M |
| 3300018085|Ga0187772_10172745 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300020579|Ga0210407_10114746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2056 | Open in IMG/M |
| 3300020579|Ga0210407_11250092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300020580|Ga0210403_10038188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3837 | Open in IMG/M |
| 3300020581|Ga0210399_10465700 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300020581|Ga0210399_11399511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300020582|Ga0210395_10000489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 31040 | Open in IMG/M |
| 3300020582|Ga0210395_11377282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300021401|Ga0210393_10090494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2431 | Open in IMG/M |
| 3300021402|Ga0210385_10589825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300021403|Ga0210397_10343286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300021404|Ga0210389_10559598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300021406|Ga0210386_10887311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300021420|Ga0210394_11239590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300021433|Ga0210391_10143394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1880 | Open in IMG/M |
| 3300021474|Ga0210390_11005369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300021476|Ga0187846_10005060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6742 | Open in IMG/M |
| 3300021560|Ga0126371_11786411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300022521|Ga0224541_1000822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2963 | Open in IMG/M |
| 3300022557|Ga0212123_10047129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4018 | Open in IMG/M |
| 3300024220|Ga0224568_1014764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300026217|Ga0209871_1054524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300026307|Ga0209469_1059182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300026330|Ga0209473_1221074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300026333|Ga0209158_1240486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300026524|Ga0209690_1147910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300026552|Ga0209577_10456151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300027388|Ga0208995_1092732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300027660|Ga0209736_1088966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300027853|Ga0209274_10706430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300027854|Ga0209517_10545840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300027879|Ga0209169_10177769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
| 3300027879|Ga0209169_10363479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300027894|Ga0209068_10490940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300028747|Ga0302219_10434216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300028798|Ga0302222_10001596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11238 | Open in IMG/M |
| 3300028906|Ga0308309_10108391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2164 | Open in IMG/M |
| 3300029882|Ga0311368_10570269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300029943|Ga0311340_10705681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300029951|Ga0311371_12256990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300029951|Ga0311371_12318164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300030054|Ga0302182_10397117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300030056|Ga0302181_10275248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300030399|Ga0311353_10742020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300030524|Ga0311357_11173403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300030617|Ga0311356_11009574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300030878|Ga0265770_1003491 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300031090|Ga0265760_10311895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300031233|Ga0302307_10020335 | All Organisms → cellular organisms → Bacteria | 3722 | Open in IMG/M |
| 3300031233|Ga0302307_10101124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1509 | Open in IMG/M |
| 3300031236|Ga0302324_103029449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300031720|Ga0307469_11789922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300031837|Ga0302315_10498461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300032180|Ga0307471_103697649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300033829|Ga0334854_065123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300034163|Ga0370515_0129962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300034163|Ga0370515_0402676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 13.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.18% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.18% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.64% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.82% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.91% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102616061 | 3300001356 | Peatlands Soil | AGPSFGARYDFNDYVAFKAQLDHTQRQGLPDLNGLHLQVAFTF* |
| JGI12659J15293_100659441 | 3300001546 | Forest Soil | PSFGARYDLNDYIAFKAQLDHTVRRGEPDLNGLHLQLAFAF* |
| JGIcombinedJ26739_1002212604 | 3300002245 | Forest Soil | LRFGPSFGARYDVNDYVAFKVQLDNTVRRGLPDLNGLHLQLAFAF* |
| soilH1_102316411 | 3300003321 | Sugarcane Root And Bulk Soil | GVSFGTRYDFTEFVAFKAQLDHTLRKGQQDLNGLQLQLAFAF* |
| JGI26346J50198_10099123 | 3300003351 | Bog Forest Soil | LRYGPSFGVRYDFTDSIAFKTQLDHTVRKGEPDLNGLHMQLVFKF* |
| Ga0062389_1013187623 | 3300004092 | Bog Forest Soil | SPNSFIYGDVGLRFGPSLGARYDLNDSIAFTTQFDHTARRGQPDLNGVQLQLAFTF* |
| Ga0062386_1012427732 | 3300004152 | Bog Forest Soil | GPSFGARYDFNDSIAFKTQFDHTVIKGEPDLNGLHMQLAFKF* |
| Ga0062386_1017492761 | 3300004152 | Bog Forest Soil | YGPSFGVRYDFNGSIALKIQLDHTVRKGEPDLNGLHMQLVFKF* |
| Ga0066674_101798642 | 3300005166 | Soil | LRHGPSFGARYDFNDNIAFKTQLDHTIRKDKPDLNGLQLQLAFAF* |
| Ga0066679_100715685 | 3300005176 | Soil | VLLRHGPSFGARYDFNDNIAFKTQLDHTIRKDKPDLNGLQLQLAFAF* |
| Ga0066679_108656232 | 3300005176 | Soil | FEDVLLRHGPSFGARYDFNDNIAFKTQLDHTIRKGKPDLNGLQLQLAFAF* |
| Ga0070714_1024025492 | 3300005435 | Agricultural Soil | LHDVRLRYGPSFGTRYDFNSNVAFKLQLDHTDRRPRPDLNGIQTEISFVF* |
| Ga0070711_1018578402 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RYGPSFGARYDLNDNFALKAQLDHTLRKGKPDLNGLQLQLTFAF* |
| Ga0070735_100343217 | 3300005534 | Surface Soil | SGRNTIFNDVGLRAGPSFGARYDFNDYVAFKAQLDHTQRESLPDLNGLHLQVAFTF* |
| Ga0070761_102020271 | 3300005591 | Soil | NNLIYNDVGLRYGPSFGARYDLNDYVAFKAQLDHTLRGGAPDLNALQLQFAFTF* |
| Ga0070761_105864611 | 3300005591 | Soil | DVGSILDDLDLRYGPSFGARYDFTDSIAFKAQFDHTVRKDEPDLDGLHLQLVFKF* |
| Ga0070762_100640421 | 3300005602 | Soil | FGDVDLRYGPSFGARYDLNDFIAFKAQLDQTVRKGHADLDALHFQLAFTF* |
| Ga0070762_109146921 | 3300005602 | Soil | NLIYDDVGLRFGPSFGARYDLNDYIAFKAQLDHTVRRDEPDLNGLQFQLAFTF* |
| Ga0070764_100795581 | 3300005712 | Soil | ARYDLNDYIAFTAQLDHTVRRFQPDLNGLQLQWAFAF* |
| Ga0075029_1006189283 | 3300006052 | Watersheds | DLNNNVALKVQLDRTVRQNEPDLNGLQTQLAFTF* |
| Ga0097621_1017310422 | 3300006237 | Miscanthus Rhizosphere | FNDVGLRHGPSFGSRYDFNDNVAFKLQLDHTLRRGLPDLNGLQTQLAFTF* |
| Ga0075021_102186743 | 3300006354 | Watersheds | LGTRFDFNENVAFKTQFDHTIRKNQANLNALQVQLSFAF* |
| Ga0066660_108844793 | 3300006800 | Soil | PSFGARYDFNDNIAFKTQLDHTIRKSKPDLNGLQLQLAFAF* |
| Ga0099829_116375732 | 3300009038 | Vadose Zone Soil | GVRYDINENIAFKTQLDHTVRKGKGDLNGLHMQLAVTF* |
| Ga0066709_1038562131 | 3300009137 | Grasslands Soil | DFNDNIAFKTQLDHTIRKSKPDLNGLQLQLAFAF* |
| Ga0116218_13706272 | 3300009522 | Peatlands Soil | IFNDVGLRAGPSFGARYDFNDYVAFKAQLDHTQRQGLPDLNGLHLQVAFTF* |
| Ga0116138_11769251 | 3300009552 | Peatland | GPSFGVRYDFNDSIALKIQLDHTVRKGEPDLNGLHMQLVFKF* |
| Ga0126384_108727863 | 3300010046 | Tropical Forest Soil | VRFDFNDKIALKTQLDHTVRKGQANLNGVQSQLAFTF* |
| Ga0074046_107869161 | 3300010339 | Bog Forest Soil | LRFGPSFGARYDLNDYMAFTAQMDHTVRRGEADLNGLQLQWAFTF* |
| Ga0137391_115094511 | 3300011270 | Vadose Zone Soil | VALRHGPSFGVRYDFNDSIAFKTQFDHTLRKGKSDLNGLHTQLAFTF* |
| Ga0137382_108603762 | 3300012200 | Vadose Zone Soil | ARYDFNDNIAFKTQLDHTIRKSKPDLNGLQLQLAFAF* |
| Ga0137386_107778652 | 3300012351 | Vadose Zone Soil | FEDVLLRHGPSFGARYDFNDNIAFKTQLDHTIRKDKPDLNGLQLQLAFAF* |
| Ga0137366_105668722 | 3300012354 | Vadose Zone Soil | LRHGPSFGARYDFNDNIAFKTQLDHTIRKSKPDLNGLQLQLAFAF* |
| Ga0137371_101273595 | 3300012356 | Vadose Zone Soil | ARYDFNDNIAFKTQLDHTIRKDKLDLNGLQLQLAFAF* |
| Ga0137360_105541191 | 3300012361 | Vadose Zone Soil | SFGARYDFNESITFKTQLDHTIRKGKPDLDGLQMQVSFAF* |
| Ga0137360_116308401 | 3300012361 | Vadose Zone Soil | RHGPSFGVRYEINENMAFKTQFDHTLRKGQGDLNGLHMQVAVTF* |
| Ga0137395_105176801 | 3300012917 | Vadose Zone Soil | FLEEFVLHHGPSFGVRFDFNDSVAFKTQLDHTSRKGEPDLNGLHLQLAYTF* |
| Ga0137396_105466573 | 3300012918 | Vadose Zone Soil | HGPSFGARYDLNDYIAFKAQLDHTLRRGQPNLNGLHLQLAFTF* |
| Ga0137419_104944481 | 3300012925 | Vadose Zone Soil | ELNENIAFKAQVDHTVRKNKPNLNGLQLQLAFTF* |
| Ga0137404_113122211 | 3300012929 | Vadose Zone Soil | SRYDFNDNIAFKLQLDHTLRKGLPDLNGLQTQLAFTF* |
| Ga0137407_100738915 | 3300012930 | Vadose Zone Soil | HSDVLLGHGPSFGARFDFNESIAFKAQLDHTIRKGKPDLDGLQMQVSFAF* |
| Ga0137407_107196541 | 3300012930 | Vadose Zone Soil | GPSFGVRYEINENMAFKTQVDHTLRKGKGDLNGLHMQLAVTF* |
| Ga0137410_105842563 | 3300012944 | Vadose Zone Soil | FEDVLLRHGPSFGIRYDFNENMALKTQLDHTLRKGQADLNGLQMQLAVTF* |
| Ga0134110_102894241 | 3300012975 | Grasslands Soil | TNPRSIFEDVLLRHGPSFGARYDFNDNIAFKTQLDHTIRKSKPDLNGLQLQLAFAF* |
| Ga0164306_114389411 | 3300012988 | Soil | RYDFNANIGFKAQLDHTLRKNLPDLNGLHLQLVFAF* |
| Ga0182024_129304072 | 3300014501 | Permafrost | QNRILGDVALRYGPSFGARYDFSDFIAFKVQLDHTLRKGQPDLNGMHLQLAYTF* |
| Ga0137418_102652081 | 3300015241 | Vadose Zone Soil | GLRYGPSFGARYDFTEDVAFKAQLDHTVRRDQPDLNGLQMQVAFTF* |
| Ga0137418_103437093 | 3300015241 | Vadose Zone Soil | LLRHGPSFGARYDFNDFIAIKAQLDHTLRKGQPDLNGLHMQLAFRF* |
| Ga0137409_107346863 | 3300015245 | Vadose Zone Soil | HGPSFGARYDFTESIGFKTQLDHTIRKGKPDLNGLQMQLVFAF* |
| Ga0187879_105980262 | 3300017946 | Peatland | RYGPSFGARYDFNDFIAFKAQLDQTMRKGQADLDGLHFQLAFTF |
| Ga0187887_100309457 | 3300018043 | Peatland | GLRAGPSFGARYDFNDWIAFKAQLDHTQREGLPDLDGLHLQVSFTF |
| Ga0187772_101727454 | 3300018085 | Tropical Peatland | RYDLNDFLAFKAQLDHTVRRGLPDLNGLHLQLSGAF |
| Ga0210407_101147461 | 3300020579 | Soil | SGRNTIFNDVGLRAGPSFGARFDFNDYIAFKAQLDHTQRESLPDLNGLHLQVAFTF |
| Ga0210407_112500922 | 3300020579 | Soil | DAIFEDVGLRYGPSFGARYDFNDNIALKAQLDHTLRKGQPDLNGLNLQLVFNF |
| Ga0210403_100381881 | 3300020580 | Soil | SFGARFDFTDSIAFKGQLDHTVRKDQPDLNGLQMQVAFAF |
| Ga0210399_104657001 | 3300020581 | Soil | YDFNDVIAFTAQLDHTMRKGQPDLNGLQLQFAFTF |
| Ga0210399_113995111 | 3300020581 | Soil | GPSFGARYDLNSYIAFTAQLDHTVRRGEPDLNGLQLQLAFTF |
| Ga0210395_100004891 | 3300020582 | Soil | SFGARYDFNDWIAFKAQLDHTQRDDLPDLDGLHLQVAFTF |
| Ga0210395_113772821 | 3300020582 | Soil | NDIGLRAGPSFGARYDFNDWIAFKVQLDHTQRDDLPDLNGLHLQVAFTF |
| Ga0210393_100904941 | 3300021401 | Soil | PESLLKDISLRRGPSFGMRYDFNENFAFKTQFDHTVRRDQPDLNSLHLQLAFTF |
| Ga0210393_104686151 | 3300021401 | Soil | RGPSFGMRYDFNENFAFKTQFDHTARRNQPDLNSLHLQLAFTF |
| Ga0210385_105898251 | 3300021402 | Soil | ASPNDSIYNDVGLRFGPSFGARYDLNDYIAFKAQLDHTVRRDEPDLNGLQLQWAFTF |
| Ga0210397_103432861 | 3300021403 | Soil | YDLNDYMAFTAQLDHTVRRDLPDLNGLQLQWAFTF |
| Ga0210389_105595983 | 3300021404 | Soil | FEDVALRYGPSFGARFDFTDSIAFKGQLDHTVRKDQPDLNGLQMQVAFAF |
| Ga0210386_108873111 | 3300021406 | Soil | NDSIYNDVGLRFGPSFGARYDLNDYIAFKAQLDHTVRRGEPDLNGLHLQLAFAF |
| Ga0210394_109077031 | 3300021420 | Soil | PSVGMRYDFNENFAFKTQFDHTARKGQPDLNALHLQLAFTF |
| Ga0210394_112395901 | 3300021420 | Soil | NTLFNDVGLRAGPSFGARYDFNDYIAFKAQIDHTQRDELPDLDGLHLQVSFTF |
| Ga0210391_101433941 | 3300021433 | Soil | SSLFGDVDLRYGPSFGARYDFNDFIAFKAQLDQTMRKGQADLDGLHFQLAFTF |
| Ga0210390_110053691 | 3300021474 | Soil | YDLNDFVAFKAQLDHTVRRGQPDLNGLQLQFAFTF |
| Ga0187846_100050606 | 3300021476 | Biofilm | LRHGPSFGARYDLNEYVAFMAQLDHTVRKDQPDLNGLQVQFAFTF |
| Ga0126371_117864111 | 3300021560 | Tropical Forest Soil | ARYDLTDSIAFKTQLDHTIRKGKPDLNGLQMQLAFAF |
| Ga0224541_10008221 | 3300022521 | Soil | DMGGILNDVNLRYGPSFGVRYDFNDSIAFKTQLDHTVRKGEPDLNGLHMQLVFKF |
| Ga0212123_100471295 | 3300022557 | Iron-Sulfur Acid Spring | LRYGSSFGARFDFNESIAVQAQLGHTVREDQPDLNGLPLQVAFAF |
| Ga0224568_10147641 | 3300024220 | Plant Litter | FGARYDLNDYAAFTAQLDHTIRRGEPDLNGLQLQFAFTF |
| Ga0209871_10545241 | 3300026217 | Permafrost Soil | WDFNDNIAFKTQLDHTLRKGQPDLNGLHLQLAFTF |
| Ga0209469_10591823 | 3300026307 | Soil | LRHGPSFGARYDFNDNIAFKTQLDHTIRKDKPDLNGLQLQLAFAF |
| Ga0209473_12210742 | 3300026330 | Soil | IFEDVLLRHGPSFGARYDFNDNIAFKTQLDHRIRKSKPDLNGLQLQLAFAF |
| Ga0209158_12404862 | 3300026333 | Soil | YVNADREDTIFEDAGLRHGPSFGARYDFSDSIAFKAQLDHTVRKALPDLNGLQMQVVFTF |
| Ga0209690_11479103 | 3300026524 | Soil | WPARYDFNDNIAFKTQLDHTIRKDKLDLNGLQLQLAFAF |
| Ga0209577_104561511 | 3300026552 | Soil | GGFLEEFVLRHGPSFGVRFDFNDCIAFKTQLDHTMRKGQPDLNGLHLQLAYTF |
| Ga0208995_10927321 | 3300027388 | Forest Soil | LRYGPSFGARYDFNENIAFKAQLDHTVRENMPDLNGLQMQTAFTF |
| Ga0209736_10889663 | 3300027660 | Forest Soil | TNKESTIFEDVGLRYGPSFGARYDFNESIAFKAQLDHTARQDQPDLNGLQLQVAFAF |
| Ga0209274_107064301 | 3300027853 | Soil | SFGARYDFNDFLAFKAQLDQTMRKGQADLDGLHFQLAFTF |
| Ga0209517_105458402 | 3300027854 | Peatlands Soil | RYDLNDWFAFKAQLDHTVRRGLPDLNGLHLQLSGTF |
| Ga0209169_101777691 | 3300027879 | Soil | FGPSFGIRYDLNEYMAFKAQLDHTVRRDEPDLNGLQLQWAFTF |
| Ga0209169_103634791 | 3300027879 | Soil | ARYDLNDYIAFTAQLDHTVRRFQPDLNGLQLQWAFAF |
| Ga0209068_104909401 | 3300027894 | Watersheds | TFGSRYDFNDYIAFTAQLDHTLRKGQPDLNGLQLQFAFTF |
| Ga0302219_104342161 | 3300028747 | Palsa | GLRYGPSFGLRYDANDYIALKAQLDHTVRRGLPDLNGLHLQLAGTF |
| Ga0302222_100015961 | 3300028798 | Palsa | ASPNNGIYDDVGLRFGPSFGARYDLNDYIAFKAQFDHTVRRGERDLNGLHLQFAFTF |
| Ga0308309_101083911 | 3300028906 | Soil | EQNTLFNDIGLRAGPSFGARYDFNDWIAFKVQLDHTQRDDLPDLNGLHLQVAFTF |
| Ga0311368_105702692 | 3300029882 | Palsa | LRYGPSFGARYDLNDYAGFTAQLDHTIRRGEPDLNGLQLQFAFTF |
| Ga0311340_107056811 | 3300029943 | Palsa | GPSFGVRYDFNDSIAFKTQLDHTVRKGEPDLNGLHMQLVFKF |
| Ga0311371_122569901 | 3300029951 | Palsa | RYGPSFGVRYDPNNYIALKAQLDHTAREGQPDLNGLQLQFAFTF |
| Ga0311371_123181642 | 3300029951 | Palsa | PSFGVRYDFTDSIAFKTQFDHTVRKDEPDLDGLHTQLVFKF |
| Ga0302182_103971172 | 3300030054 | Palsa | RYGPSFGARFDLNNYIAFKAQLDHTARAGEPDLNGLQLQFAFTF |
| Ga0302181_102752481 | 3300030056 | Palsa | LRFGPSFGARYDLNDYMAFTAQLDHTVRRGEPDLNGLQLQWAFTF |
| Ga0311353_107420202 | 3300030399 | Palsa | SNPNSIFDDVGLRYGPSFGVRYDPNNYIALKAQLDHTAREGQPDLNGLQLQFAFTF |
| Ga0311357_111734032 | 3300030524 | Palsa | SFGARYDLNDYIAFKAQFDHTVRRGERDLNGLHLQFAFTF |
| Ga0311356_110095741 | 3300030617 | Palsa | GILDDVDLRYGPSFGVRYDFNDSIAFKTQLDHTVRKGEPDLNGLHMQLVFKF |
| Ga0265770_10034914 | 3300030878 | Soil | ARYDLNDYAAFTAQLDHTIRRGEPDLNGLQLQFAFTF |
| Ga0265760_103118952 | 3300031090 | Soil | LRYGPSFGARYDFNDYIAFKAQLDHTVRRGEPDLNGLHLQLAFTF |
| Ga0302307_100203351 | 3300031233 | Palsa | RYDLNDYMAFTAQLDHTVRRGEPDLNGLQLQWAFTF |
| Ga0302307_101011241 | 3300031233 | Palsa | NSNAILDDVGLRYGPSFGARFDLNNYIAFKAQLDHTARAGEPDLNGLQLQFAFTF |
| Ga0302324_1030294491 | 3300031236 | Palsa | ANPSSLFGDVDLRYGPSFGARYDFNDFIAFKAQLDQTMRKGQADLDGLHFQLAFTF |
| Ga0307469_117899222 | 3300031720 | Hardwood Forest Soil | SFGARYDFNDNVAFKAQLDHTVRKAQPDLNGLQTQVAFTF |
| Ga0302315_104984612 | 3300031837 | Palsa | YGPSFGVRYDFTDSIAFKTQFDHTVRKDEPDLDGLHTQLVFKF |
| Ga0307471_1036976492 | 3300032180 | Hardwood Forest Soil | RYEISENMAFKTQLDHTFRKGKGDLNGLHMQLAVTF |
| Ga0334854_065123_632_745 | 3300033829 | Soil | MRYDFSDSIAFKTQFDHTVRKGEPDLDGLHMQLVFKF |
| Ga0370515_0129962_1_138 | 3300034163 | Untreated Peat Soil | LRYGPSFGARYDFNDYIAFKAQLDHTVRRGEPDLNGLQLQFAFTF |
| Ga0370515_0402676_1_171 | 3300034163 | Untreated Peat Soil | SSPNSIFDDIGLRYGPSFGARYDLNDYMAVKAQLDHTVRRGEPDLDGLQLQWAFTF |
| ⦗Top⦘ |