| Basic Information | |
|---|---|
| Family ID | F087290 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSYGVAESELLTEDTVLRRVQGAMSYKFRTGLDVNKEVNGNP |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.45 % |
| % of genes near scaffold ends (potentially truncated) | 22.73 % |
| % of genes from short scaffolds (< 2000 bps) | 83.64 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.364 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 48.18 |
| PF00106 | adh_short | 3.64 |
| PF00165 | HTH_AraC | 1.82 |
| PF00561 | Abhydrolase_1 | 1.82 |
| PF00072 | Response_reg | 0.91 |
| PF13561 | adh_short_C2 | 0.91 |
| PF02566 | OsmC | 0.91 |
| PF16694 | Cytochrome_P460 | 0.91 |
| PF01850 | PIN | 0.91 |
| PF12770 | CHAT | 0.91 |
| PF13577 | SnoaL_4 | 0.91 |
| PF12681 | Glyoxalase_2 | 0.91 |
| PF13517 | FG-GAP_3 | 0.91 |
| PF00174 | Oxidored_molyb | 0.91 |
| PF11453 | DUF2950 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.91 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.91 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.91 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.36 % |
| Unclassified | root | N/A | 3.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886007|SwRhRL2b_contig_1005107 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300000559|F14TC_100577850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1341 | Open in IMG/M |
| 3300000955|JGI1027J12803_100510690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300000955|JGI1027J12803_104655341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 564 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100257619 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100476766 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10003877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4340 | Open in IMG/M |
| 3300005093|Ga0062594_102750232 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005177|Ga0066690_10598029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300005293|Ga0065715_10305012 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300005332|Ga0066388_101241976 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300005336|Ga0070680_100982462 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005341|Ga0070691_11098451 | Not Available | 501 | Open in IMG/M |
| 3300005343|Ga0070687_100570815 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005406|Ga0070703_10080857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1107 | Open in IMG/M |
| 3300005444|Ga0070694_101331930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 604 | Open in IMG/M |
| 3300005445|Ga0070708_100382839 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300005459|Ga0068867_101947282 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005518|Ga0070699_100549116 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300005538|Ga0070731_10293809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1079 | Open in IMG/M |
| 3300005544|Ga0070686_100194744 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300005552|Ga0066701_10837641 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005553|Ga0066695_10608978 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005563|Ga0068855_100246366 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300005602|Ga0070762_10494733 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300005713|Ga0066905_100172552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1585 | Open in IMG/M |
| 3300005921|Ga0070766_10866154 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006050|Ga0075028_100001345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8962 | Open in IMG/M |
| 3300006354|Ga0075021_10004089 | All Organisms → cellular organisms → Bacteria | 7655 | Open in IMG/M |
| 3300006794|Ga0066658_10470257 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006797|Ga0066659_10156861 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300006797|Ga0066659_10624470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 876 | Open in IMG/M |
| 3300006844|Ga0075428_100902058 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300006847|Ga0075431_101119620 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300006852|Ga0075433_10305528 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300006852|Ga0075433_11676886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 548 | Open in IMG/M |
| 3300006893|Ga0073928_10171746 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300006904|Ga0075424_100628628 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300006969|Ga0075419_10142146 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300007788|Ga0099795_10539572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 548 | Open in IMG/M |
| 3300009094|Ga0111539_11479969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 787 | Open in IMG/M |
| 3300009147|Ga0114129_10640798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300009147|Ga0114129_10932088 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300009148|Ga0105243_11492466 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300009156|Ga0111538_10627626 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300009176|Ga0105242_12394750 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300009553|Ga0105249_10318358 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300010043|Ga0126380_10071294 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300010400|Ga0134122_10130612 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300010401|Ga0134121_10206447 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300012203|Ga0137399_11158482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 651 | Open in IMG/M |
| 3300012208|Ga0137376_11766987 | Not Available | 509 | Open in IMG/M |
| 3300012361|Ga0137360_11508357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 576 | Open in IMG/M |
| 3300012918|Ga0137396_10427413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 982 | Open in IMG/M |
| 3300012923|Ga0137359_10130762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 2231 | Open in IMG/M |
| 3300012923|Ga0137359_11650444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 528 | Open in IMG/M |
| 3300012923|Ga0137359_11730162 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012930|Ga0137407_12435785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 500 | Open in IMG/M |
| 3300012957|Ga0164303_11250770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300012977|Ga0134087_10617035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 564 | Open in IMG/M |
| 3300012985|Ga0164308_10557071 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300013297|Ga0157378_11726221 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300013308|Ga0157375_12167330 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300015374|Ga0132255_100517058 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300015374|Ga0132255_102346266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300018061|Ga0184619_10163779 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300019882|Ga0193713_1043265 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300019883|Ga0193725_1081857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 784 | Open in IMG/M |
| 3300020140|Ga0179590_1164584 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300020579|Ga0210407_10127959 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300020580|Ga0210403_10254680 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300020581|Ga0210399_10439807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300020583|Ga0210401_10097235 | All Organisms → cellular organisms → Bacteria | 2766 | Open in IMG/M |
| 3300021168|Ga0210406_11074576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 594 | Open in IMG/M |
| 3300021170|Ga0210400_11274345 | Not Available | 590 | Open in IMG/M |
| 3300021178|Ga0210408_10875443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 700 | Open in IMG/M |
| 3300021180|Ga0210396_10004097 | All Organisms → cellular organisms → Bacteria | 14296 | Open in IMG/M |
| 3300021344|Ga0193719_10457080 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300021405|Ga0210387_10010774 | All Organisms → cellular organisms → Bacteria | 7029 | Open in IMG/M |
| 3300021405|Ga0210387_11679502 | Not Available | 538 | Open in IMG/M |
| 3300021432|Ga0210384_10031727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4930 | Open in IMG/M |
| 3300022525|Ga0242656_1020105 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300022724|Ga0242665_10298966 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300024330|Ga0137417_1416050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2333 | Open in IMG/M |
| 3300025885|Ga0207653_10200114 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300025900|Ga0207710_10122481 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300025910|Ga0207684_10107247 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
| 3300025930|Ga0207701_10638206 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300025932|Ga0207690_10678116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 846 | Open in IMG/M |
| 3300025935|Ga0207709_10286207 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300025949|Ga0207667_11206961 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300025961|Ga0207712_11407941 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300026089|Ga0207648_10631431 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300026118|Ga0207675_100048522 | All Organisms → cellular organisms → Bacteria | 3963 | Open in IMG/M |
| 3300026118|Ga0207675_100565262 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300026285|Ga0209438_1004544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 4704 | Open in IMG/M |
| 3300026555|Ga0179593_1243500 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300027681|Ga0208991_1010744 | All Organisms → cellular organisms → Bacteria | 2738 | Open in IMG/M |
| 3300027873|Ga0209814_10005044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5016 | Open in IMG/M |
| 3300027889|Ga0209380_10097211 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300031057|Ga0170834_104928000 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300031543|Ga0318516_10179635 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300031715|Ga0307476_10367645 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300031718|Ga0307474_10015173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5578 | Open in IMG/M |
| 3300031724|Ga0318500_10307127 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031782|Ga0318552_10156522 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300031890|Ga0306925_10160472 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
| 3300032179|Ga0310889_10316272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 757 | Open in IMG/M |
| 3300032180|Ga0307471_100215105 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300033290|Ga0318519_10872211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL2b_0710.00006810 | 2162886007 | Switchgrass Rhizosphere | MNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG |
| F14TC_1005778503 | 3300000559 | Soil | MSYGVAESELLTEDTVLRRVQEAMSYKLRIGLDVNKEVNGNP* |
| JGI1027J12803_1005106902 | 3300000955 | Soil | MSYGVAKSELLREGNCAEAVQEAMSYKFRTRLDVSKEVTGNG* |
| JGI1027J12803_1046553412 | 3300000955 | Soil | MNYGVTESEVSTEDTVLRRVQRAISYKVRTGLDVNKEVNGNTQG* |
| JGIcombinedJ26739_1002576193 | 3300002245 | Forest Soil | MRVRMSYGVAESELLTEDTVLRRVQEAMSCKFRTKLEVNNEVKR* |
| JGIcombinedJ26739_1004767662 | 3300002245 | Forest Soil | MSYGVAESELLTEDTVLRRVQEAMSCKFRTKLEVNNEVKR* |
| JGIcombinedJ51221_100038771 | 3300003505 | Forest Soil | MSYGLAESQLLMEGTVLRRVQGALLQIPDRGLDVSKEVNGNL |
| Ga0062594_1027502321 | 3300005093 | Soil | MSYGVAESELLTEDTVLRRVQGAMSYKFRTGLDVNKEVNGNP* |
| Ga0066690_105980292 | 3300005177 | Soil | MSRGVADSELLTDDTVLTVQGALSYKFRTGLDVNKEVNGNP* |
| Ga0065715_103050121 | 3300005293 | Miscanthus Rhizosphere | MSYGVAASEVLMEDTVLRRLQRAMSYKFRTGVDVNKEVNGNA* |
| Ga0066388_1012419762 | 3300005332 | Tropical Forest Soil | MSNGVAESELLTEDTVLRRVQGAMSYKFRTELHVYKEVNGNP* |
| Ga0070680_1009824621 | 3300005336 | Corn Rhizosphere | MSYGVAGSELLTENTVLRRVQGAMSYKFRIGLDVNKELKGNAWE* |
| Ga0070691_110984511 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYGVAESELSTENTVLRRVQGAMSYKFRTRLDVNKEVNGNS* |
| Ga0070687_1005708151 | 3300005343 | Switchgrass Rhizosphere | YGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG* |
| Ga0070703_100808572 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG* |
| Ga0070694_1013319301 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYGLAESELLTEDAVLRRVQGAMSHKFRTRLDVNKEVKGNP* |
| Ga0070708_1003828393 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RQREFRMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG* |
| Ga0068867_1019472822 | 3300005459 | Miscanthus Rhizosphere | MNYGLTESEGSTEGAVLRRVQGAISYKVPTGLDVNNVVNGNTQG* |
| Ga0070699_1005491161 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYGVAQPQLLTEDTVLRPAQGAMSYKFRTRLDVNKEVNG |
| Ga0070731_102938094 | 3300005538 | Surface Soil | MSDCVAESELLTEDKGLRLAQGALSYKLGTGLDANQQVSGNL* |
| Ga0070686_1001947441 | 3300005544 | Switchgrass Rhizosphere | MSYAVAESELLTKDKAVRRVQGAMSYKFRTGLDVNKEVNGNP* |
| Ga0066701_108376413 | 3300005552 | Soil | MSYGVAESDLLTEDTVLRRVQGALNYKFRTGLDVNKEVNGN |
| Ga0066695_106089782 | 3300005553 | Soil | MSYGVAESELFTEDRVLRGVQGAMSYKFRTRLDVNKEVNGNP* |
| Ga0068855_1002463661 | 3300005563 | Corn Rhizosphere | SEVLMEDTVLRRLQRAMSYKFRTGVDVNKEVNGNA* |
| Ga0070762_104947332 | 3300005602 | Soil | MSYGVAESDPLTEDIVLRQVQGAMSYKVRTGMDFNLHFNREVSATHES* |
| Ga0066905_1001725522 | 3300005713 | Tropical Forest Soil | MSYGVAESELLTEDTVLRRVQGAMSYKFRTELHVNKEVNGNP* |
| Ga0070766_108661541 | 3300005921 | Soil | MSYGVTESELLTEDTVLRRVQGALSYEFRTGLDVNKEVNGNP* |
| Ga0075028_1000013454 | 3300006050 | Watersheds | MSYGVAESELLAKDAVLRRMQGAMGYKFWTGVDVNNKVKGER* |
| Ga0075021_100040893 | 3300006354 | Watersheds | MSYGVAESELLAKDAVLRRMQRAMGYKFWTEVDVNNKVKGEP* |
| Ga0066658_104702572 | 3300006794 | Soil | MSYSVAESELLTGDTVLRWVQGAMSYKFRTRLDVNKEVNGNP* |
| Ga0066659_101568612 | 3300006797 | Soil | MSYGVAESELLTEDRVLRRVQGAMSYKFRTRLDVNKEVNGNP* |
| Ga0066659_106244701 | 3300006797 | Soil | MLPERESDLLTEDTVLRRVQGALNYKFRTGLDVNKEVNGNSLE* |
| Ga0075428_1009020582 | 3300006844 | Populus Rhizosphere | MSYGVAESELLTEDTVLRRVQGAMSYKFPTGLEVNKEVNGNP* |
| Ga0075431_1011196202 | 3300006847 | Populus Rhizosphere | MSYGMAESELLTEDTVLRRVRGAMSYKFRTQLDVNKEVNGNP* |
| Ga0075433_103055281 | 3300006852 | Populus Rhizosphere | LEGTATRVRMSYRVVESELLMKDTVLRRVQEAMSYKFRTRLDVNKEVNGNP* |
| Ga0075433_116768861 | 3300006852 | Populus Rhizosphere | MSYGVAESELSTEDTVLRRMRGAMSYKFRTELDVNKEVNG |
| Ga0073928_101717462 | 3300006893 | Iron-Sulfur Acid Spring | MSYGEAESELLTEDPVLRRVRGAMSYKFRTGLDVNKEVNGNP* |
| Ga0075424_1006286282 | 3300006904 | Populus Rhizosphere | MSYGVAESELSTEDTVLRRMRGAMSYKFRTELDVNKEVNGNS* |
| Ga0075419_101421464 | 3300006969 | Populus Rhizosphere | MSYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG* |
| Ga0099795_105395722 | 3300007788 | Vadose Zone Soil | MSYGVAESELLTDDTVLRRVQGAMSYKFRTRLDVNKEVNGNP* |
| Ga0111539_114799692 | 3300009094 | Populus Rhizosphere | MSCGVAESELLTEDTVLRRVRGAMSYKFRTQLDVNKEVNGNP* |
| Ga0114129_106407984 | 3300009147 | Populus Rhizosphere | MNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVV |
| Ga0114129_109320883 | 3300009147 | Populus Rhizosphere | FRMNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG* |
| Ga0105243_114924661 | 3300009148 | Miscanthus Rhizosphere | NYGLTESEVSTECVVLRRVQGAISYKVLTGLDVNNVVNGNTQG* |
| Ga0111538_106276261 | 3300009156 | Populus Rhizosphere | STKGAVLRRVQEAISYKVLTGLDVNHVVNGNTQG* |
| Ga0105242_123947502 | 3300009176 | Miscanthus Rhizosphere | MSYGVEESELLAEDTVLRWVQGAMSYKFRTRLDIKKEVNGNS* |
| Ga0105249_103183584 | 3300009553 | Switchgrass Rhizosphere | MNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTRG* |
| Ga0126380_100712944 | 3300010043 | Tropical Forest Soil | MSYGVAESELLTENTVLRRVQGAMSYKFRTELHVNKEVNGNP* |
| Ga0134122_101306124 | 3300010400 | Terrestrial Soil | MNDGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNGNTQG* |
| Ga0134121_102064473 | 3300010401 | Terrestrial Soil | MNYGLTESEVSTEGAVLRRVQEAISYKVLTGLDVNNVVNGNTQG* |
| Ga0137399_111584822 | 3300012203 | Vadose Zone Soil | MSYGVAESELLTEDTLLRRVQGAMSYKFRTGMDVNNEVKGEP* |
| Ga0137376_117669872 | 3300012208 | Vadose Zone Soil | MGYDVAASELLTEDTVLRRVQGAMSYKSRTRLDVNKEVNGNP* |
| Ga0137360_115083572 | 3300012361 | Vadose Zone Soil | MSYGVAESELLTEDTVLMRVQGAMSYKFRTRLDVNKEVNGNP* |
| Ga0137396_104274133 | 3300012918 | Vadose Zone Soil | MSYGVAESELLTGETVLRRVQGAMSYKFRTRLDVN |
| Ga0137359_101307624 | 3300012923 | Vadose Zone Soil | MSYSVAESELLTGDTVLRWVQGAMSYKFRTWLDVNKEVNGIP* |
| Ga0137359_116504441 | 3300012923 | Vadose Zone Soil | MSYGAAESELLTEDTALRRVQGAMSYKFRTRLDVNKEVNGNP* |
| Ga0137359_117301621 | 3300012923 | Vadose Zone Soil | MSYGVAESELLTEETVLRRVQGAISYECRTELDFNNELKGDR* |
| Ga0137407_124357851 | 3300012930 | Vadose Zone Soil | MSNGVAESELLTEDTVLRRVQGAMSYKFRTRLDVNKEVSGNP* |
| Ga0164303_112507702 | 3300012957 | Soil | MSYGVAESELLTEDTVLRRVQEAMSYKFPTGLDVNREVNGNP* |
| Ga0134087_106170352 | 3300012977 | Grasslands Soil | MSYGVAESELLTEDRVLRRVQGAMSYKFRTRLDVNKEVNG |
| Ga0164308_105570712 | 3300012985 | Soil | MNYGLTESEVSTEGAVLKRVQGAIRYKVLTGLDVNNVVNGNTQE* |
| Ga0157378_117262212 | 3300013297 | Miscanthus Rhizosphere | MNYGVTESEVSTEGAVLRWVQGAISYKVLTGLDVNNVVNGNTQG* |
| Ga0157375_121673301 | 3300013308 | Miscanthus Rhizosphere | MSYGVAASEVLMEDTVLRRPQRAMSYKFRTGVDVNKEVNGNA* |
| Ga0132255_1005170584 | 3300015374 | Arabidopsis Rhizosphere | MNYGVTESEVSTEGAVLRRVQGAISCKILTGLDVNNVVNGNTQG* |
| Ga0132255_1023462661 | 3300015374 | Arabidopsis Rhizosphere | MNYGLTESEVSTEGAVLRRVQGAVSYKVLTGLDVNNVVNGNTQG* |
| Ga0184619_101637792 | 3300018061 | Groundwater Sediment | MSYGVAESELLTEDTVMRRVQGAMSYKFRTRLDVNKEVNGNP |
| Ga0193713_10432651 | 3300019882 | Soil | VYNRVRMSYGVAESELLTEDTVLRRVQGAMSYKFRTRLEVNKEVNGNP |
| Ga0193725_10818572 | 3300019883 | Soil | MRVRMTYGVAESELLTEDTVLRRVQGAMSYKFRTRLDVNKEVNGNP |
| Ga0179590_11645842 | 3300020140 | Vadose Zone Soil | MSYGVAESELLAEDTVLRRVQGAMSYKFRTRLDVNKEVNGNP |
| Ga0210407_101279592 | 3300020579 | Soil | MSYGVAESELLTENTVLRRVQGAMSYKFRIGLDVNKEVYGNA |
| Ga0210403_102546803 | 3300020580 | Soil | MSYGVAKSEWLTEDTVLRRMQGAMSYKFRIELDANNEVKGNS |
| Ga0210399_104398073 | 3300020581 | Soil | MSYGVAESELLAKDAVLRRMQRAMGYKFWTEVDVNNKVKGEP |
| Ga0210401_100972352 | 3300020583 | Soil | MSYGVTELELLTEDAVLRRVQGVVMSYKFRTGLDANNELKGSQ |
| Ga0210406_110745762 | 3300021168 | Soil | MSYGVAESELLAKDAVLRRMQGAMGYKFWTGVDINNKVKGEP |
| Ga0210400_112743452 | 3300021170 | Soil | MSYGVAESELLAKDAVLRRMQGAMGYKFWTGVDVNNKVKGEP |
| Ga0210408_108754431 | 3300021178 | Soil | MIYGVAESDLLTEDTVLRRVQGAMSYKVRTGMDFNLYFNRKVNGNP |
| Ga0210396_100040974 | 3300021180 | Soil | MSYGVAESELLTEDTVLRRVQRAMSYKFRTGLDVNKEVNSNP |
| Ga0193719_104570802 | 3300021344 | Soil | MSYGVAESELLTEDTVMRRVQGTMSYKLRTRPDVNKEVNGNP |
| Ga0210387_100107745 | 3300021405 | Soil | MSYGAAESELLTDNTTLKRVQGAMSYKFRRGLDVNKEVNGKS |
| Ga0210387_116795021 | 3300021405 | Soil | MSHGVAESELSTGDRVPRRVQGAIIYKFRAGLEVNKEVNGNP |
| Ga0210384_100317276 | 3300021432 | Soil | MSYGIAESESLTEDTVLRRMQGAMSYKFRTRPDVDNELGINQ |
| Ga0242656_10201052 | 3300022525 | Soil | SELLIEAIVLRRMQGAMSYKFRTGLDVNNELKGNQ |
| Ga0242665_102989661 | 3300022724 | Soil | SELLTENTVLRRVQGAMSYKFRIGLDVNKEVYGNA |
| Ga0137417_14160505 | 3300024330 | Vadose Zone Soil | MSYGVAESELFTEDTVLRRMQERMSHKFRTRPDVNKEVNGSP |
| Ga0207653_102001142 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYGLTESEVSTEGAVLRRVQEAIGYKVLTGLDVNNVVNGNTQG |
| Ga0207710_101224812 | 3300025900 | Switchgrass Rhizosphere | MSYGVAASEVLMEDTVLRRLQRAMSYKFRTGVDVNKEVNGNA |
| Ga0207684_101072472 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYGVAESELLTEDRVLRRVQGAMSYKFRTRLDVNKEVNGNP |
| Ga0207701_106382062 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYGVAESELLTEDTVLRRVQGAMSYKFRTGLDVNKEVNGNP |
| Ga0207690_106781162 | 3300025932 | Corn Rhizosphere | MSYGVAASEVLMEDTVLRRLQRAMSYKFRTGLDVNKEVSGNS |
| Ga0207709_102862073 | 3300025935 | Miscanthus Rhizosphere | ESEVSTECVVLRRVQGAISYKVLTGLDVNNVVNGNTQG |
| Ga0207667_112069612 | 3300025949 | Corn Rhizosphere | VAASEVLMEDTVLRRLQRAMSYKFRTGVDVNKEVNGNA |
| Ga0207712_114079411 | 3300025961 | Switchgrass Rhizosphere | MNYGLTESEVSTEGAVLKRVQGAICYKVLTGLDVNNVVNGNTRG |
| Ga0207648_106314312 | 3300026089 | Miscanthus Rhizosphere | MSYGVIESELLTEDTVLRRVQGAISYKVPTGLDVNNVVNGNTQG |
| Ga0207675_1000485223 | 3300026118 | Switchgrass Rhizosphere | MSYGVGESEWLTEDTVLRRVQGAMSYKFRRRLEVNKEVNGNPWE |
| Ga0207675_1005652622 | 3300026118 | Switchgrass Rhizosphere | MNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVNNVVNANTQG |
| Ga0209438_10045447 | 3300026285 | Grasslands Soil | MSYGVAGSELLTEDIVLRRVQGAMSYKFRTRLDVNKEVNGNP |
| Ga0179593_12435002 | 3300026555 | Vadose Zone Soil | MSYGVAESELLAKDAVLRRMQGAMGYKFWTEVDVNNKVKGEP |
| Ga0208991_10107443 | 3300027681 | Forest Soil | MSYGVAESELLTEGTVLRRVQEAMSYKFRRRLDVNKEVNGNP |
| Ga0209814_100050441 | 3300027873 | Populus Rhizosphere | MNYGLTESEVSTEGAVLRRVQGAISYKVLTGLDVKNVVNGNTQG |
| Ga0209380_100972112 | 3300027889 | Soil | MSYGLAESELLTEDTVLRRVQGALSYEFRTGLDVNKEVNGNP |
| Ga0170834_1049280002 | 3300031057 | Forest Soil | MSYRVAESKLLMEDTVQRRVPGALSYKFLTGPDVNKEVSGNL |
| Ga0318516_101796353 | 3300031543 | Soil | MSYGMAESELPTEDTALRRVQGAMSYRFRTRLDVNKEVNGNP |
| Ga0307476_103676452 | 3300031715 | Hardwood Forest Soil | MSCGAAEPELLTEDSALRRVRGAMSYKFPTGADSNKEVSGNP |
| Ga0307474_100151733 | 3300031718 | Hardwood Forest Soil | MNYGVAESELLTEDAVLRRVQGAMSYKFPTGLDVNKEVNGNP |
| Ga0318500_103071271 | 3300031724 | Soil | MSYGVAESELLTEDTVLRRVRGGMSYKFRTLLDVNEEVNGNP |
| Ga0318552_101565221 | 3300031782 | Soil | LEGTTTRVGMSYGMAESELPTEDTALRRVQGAMSYRFRTRLDVNKEVNGNP |
| Ga0306925_101604724 | 3300031890 | Soil | SELPTEDTALRRVQGAMSYRFRTRLDVNKEVNGNP |
| Ga0310889_103162723 | 3300032179 | Soil | MNYGVTDSEVSTEATVLRRVQGASSYKVRTGLDVKKD |
| Ga0307471_1002151053 | 3300032180 | Hardwood Forest Soil | MSYGVAGSELLTENTVLRRVQGAMSYKFRIGLDVNKEVNGNA |
| Ga0318519_108722111 | 3300033290 | Soil | AESELLTEDTVLRRVRGGMSYKFRTLLDVNEEVNGNP |
| ⦗Top⦘ |