| Basic Information | |
|---|---|
| Family ID | F087281 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MEQHGDAKLTDLLLTLAACPKARSASIHDRCKAVYGQLLP |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 22.43 % |
| % of genes near scaffold ends (potentially truncated) | 49.09 % |
| % of genes from short scaffolds (< 2000 bps) | 88.18 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.727 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.24% β-sheet: 0.00% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 3.64 |
| PF08734 | GYD | 2.73 |
| PF00891 | Methyltransf_2 | 1.82 |
| PF07750 | GcrA | 1.82 |
| PF02656 | DUF202 | 1.82 |
| PF12833 | HTH_18 | 0.91 |
| PF13683 | rve_3 | 0.91 |
| PF13358 | DDE_3 | 0.91 |
| PF02796 | HTH_7 | 0.91 |
| PF07589 | PEP-CTERM | 0.91 |
| PF13787 | HXXEE | 0.91 |
| PF00664 | ABC_membrane | 0.91 |
| PF09361 | Phasin_2 | 0.91 |
| PF13975 | gag-asp_proteas | 0.91 |
| PF13701 | DDE_Tnp_1_4 | 0.91 |
| PF13570 | PQQ_3 | 0.91 |
| PF06296 | RelE | 0.91 |
| PF00118 | Cpn60_TCP1 | 0.91 |
| PF00909 | Ammonium_transp | 0.91 |
| PF01042 | Ribonuc_L-PSP | 0.91 |
| PF13439 | Glyco_transf_4 | 0.91 |
| PF05532 | CsbD | 0.91 |
| PF00989 | PAS | 0.91 |
| PF03205 | MobB | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 2.73 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 1.82 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 1.82 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.91 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG1763 | Molybdopterin-guanine dinucleotide biosynthesis protein | Coenzyme transport and metabolism [H] | 0.91 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.91 |
| COG4737 | Uncharacterized conserved protein | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.73 % |
| All Organisms | root | All Organisms | 27.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.45% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Host-Associated | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12659J15293_100055954 | 3300001546 | Forest Soil | MAEHGDAKMTVLLQTLADRPKARSASIYDSMQAVYEGLAVR* |
| Ga0062389_1016099651 | 3300004092 | Bog Forest Soil | MAQHGDPKLTDLLKTLANCPKGRSASIHDRCKAVYSGLNLDE |
| Ga0075017_1011007553 | 3300006059 | Watersheds | NVARLMERHGDAKMTDLLQTLANCPKARSANIHDRCRAVFERLAL* |
| Ga0075017_1014274922 | 3300006059 | Watersheds | ARLMERHGDAKLTDLLQTLANCPKVRSASIHDRCRAVFESLSL* |
| Ga0075021_108735551 | 3300006354 | Watersheds | MERDGDNKLTDLLHTLANCPKGRPASIHDPCRAVFERLSL* |
| Ga0116214_11380231 | 3300009520 | Peatlands Soil | ARLMDEHGDAKLTDLLLTLADCQKARAASIHDRCKAVYEQLLP* |
| Ga0116222_10980432 | 3300009521 | Peatlands Soil | MDEHGDAKLTDLLLTLAACQKARAASIHDRCKAVYEQLLP* |
| Ga0116218_13754672 | 3300009522 | Peatlands Soil | MDEHGDAKLTDLLLTLADCQKARAASIHDRCKAVYEQLLP* |
| Ga0116129_11704161 | 3300009633 | Peatland | AKHGDVGLTDLLATLADCPNARAASVHDRCKAVYEGL* |
| Ga0116217_102662713 | 3300009700 | Peatlands Soil | MAEHGDAKLTDLLLTLAACPKARSASIHDRCKAVYGQWLP* |
| Ga0123357_108797002 | 3300009784 | Termite Gut | ARALQRRLMAEHGDTKLTELLATLADCPKARSFSTYDRCKAVCEEL* |
| Ga0123356_101992103 | 3300010049 | Termite Gut | MAEHGDTKLTELLATLADCPKARSFSTYDRCKAVCEEL* |
| Ga0123356_128443151 | 3300010049 | Termite Gut | MAEHGDAKLTDLLATLADCEKARSLSIHDRCKAVYEGL* |
| Ga0126381_1041306011 | 3300010376 | Tropical Forest Soil | VDKLLAEHGDAKLTDLLVTLANREKARSRSVYDRCKAVY |
| Ga0136449_1002386175 | 3300010379 | Peatlands Soil | MERHGDAKLTDLLQMLANCPKARSASIHDRCKVVFEQLLP* |
| Ga0134126_123350691 | 3300010396 | Terrestrial Soil | AAPRGEAHGDAKLTDLLGTLAACPKADSASVYDRCRAVYEELAAR* |
| Ga0164307_114554351 | 3300012987 | Soil | MEQHGDAKLTDLLQTLANNCPKTRSASIHDRCKAVFEGLAL* |
| Ga0164306_107682241 | 3300012988 | Soil | HGDAKLTDLLWTLSDCPKARSVSIHDRYKATFGRRLP* |
| Ga0182036_105052521 | 3300016270 | Soil | MEQHGDAKLTDLLVTLAACPKARSASIHDRCKAVYEGL |
| Ga0182036_118150821 | 3300016270 | Soil | MEQHGDAKLTDLLLTLANCQKARSASIHDRCKAVHGQRLP |
| Ga0182041_113953202 | 3300016294 | Soil | VAKLMGQHGDAKLTDLLQELAACPKARSAGIHDRCKAVYGRPLP |
| Ga0182041_115040921 | 3300016294 | Soil | SVAGLLEQHGDAKLTDLLETLADCRKARSVSIHDRCDAVYSYHL |
| Ga0182041_119975762 | 3300016294 | Soil | VEQHGDAKLTDLQTLTDCPKPRSVRINDRSRAIYEGLQSKG |
| Ga0182041_122841951 | 3300016294 | Soil | VAKLMEQYGDAKLTDLLVTLAACPKARSASIHDRC |
| Ga0182035_113530221 | 3300016341 | Soil | RGRYSVAKLMEQHGDAKLTDLLQELAACPKARSASIHDRCKAVYGQLLP |
| Ga0182032_102674332 | 3300016357 | Soil | EQHGDAKLTDLLSTLADCPKERSASVHDRCKAVYGQRLP |
| Ga0182034_108190983 | 3300016371 | Soil | LIAEHGDAKMTDLLQTLAACPKAGSVSVHDRCKAVYGQRLP |
| Ga0182034_108416831 | 3300016371 | Soil | MARRMEQHGDAKLTDLLQALAACPKARSAGIHDRCKAAYGQLLP |
| Ga0182034_115005802 | 3300016371 | Soil | QHGDAKLTDLLSTLADCPKARSASVHDRCKQVYRQRLP |
| Ga0182040_117762492 | 3300016387 | Soil | MARRMEQHGDAKLTDLLLTLANCPKAHSASIYDRCKAVYDQLLP |
| Ga0182037_104844651 | 3300016404 | Soil | VAGLLEQHGDAKLTDLLETLADCRKARSVSIHDRCDAVYSY |
| Ga0182037_111040723 | 3300016404 | Soil | KLMEEHGDAKLTDLLQELAACPKARSASIRDRCKAVYEELLP |
| Ga0187781_101054981 | 3300017972 | Tropical Peatland | RYNVAKLIERYGDAKLTDLLLTLADCQKAHSASVHDRCKAVYEGL |
| Ga0187782_103216574 | 3300017975 | Tropical Peatland | VAKLIERYGDAKLTDLLLTLADCQKAHSASVHDRCKAVYEGL |
| Ga0187788_104563271 | 3300018032 | Tropical Peatland | MAEHGDAKLTDLLVTLADCHKARSASVHDRCRAVYEGL |
| Ga0187766_103682073 | 3300018058 | Tropical Peatland | DAKLTDLLLTLAACPKAHSASVHDRCKAVYGQRLP |
| Ga0187772_109752422 | 3300018085 | Tropical Peatland | VAKLMERYGDAKLTDLLLTLADCQKAHSASVHDRCKAVYEGL |
| Ga0210405_113632121 | 3300021171 | Soil | TARALQVERLMAEHGDAKLTDLLTILADRPKARSMSVHDRCKAAYGQRLP |
| Ga0210408_100950963 | 3300021178 | Soil | MAEHGDAKLTDLLTILADRPKARSMSVHDRCKAAYGQRLP |
| Ga0210396_109615461 | 3300021180 | Soil | MEQHGDAKLTGLLQTLANCPKARSASIHDRCKAVFERLAL |
| Ga0210396_110000782 | 3300021180 | Soil | AKLTDLLQTLASCPKTRSPSIHDQCKVVYEGLMAG |
| Ga0210388_116277532 | 3300021181 | Soil | ACRGYGDAKLTDLLQTLASCPKTRSPSIHDQCKVVYEGLMAG |
| Ga0213872_103511311 | 3300021361 | Rhizosphere | DAKLTDLLQTLTDCPKARSMSVHDRCKAVYEGLTACKV |
| Ga0210393_100245266 | 3300021401 | Soil | MEQHGDAKLTDLLQTCPKARSASIHDRCKPVFEGLAV |
| Ga0210386_102255044 | 3300021406 | Soil | GDAKLTDLLQTLANWPKVRSASIHDRCKAVFEGLAV |
| Ga0210386_102676284 | 3300021406 | Soil | MAEHGDAKLTDLLTILADCPKARSMSVHDRCKAAYGQRLP |
| Ga0210386_108308251 | 3300021406 | Soil | RGAYKVARLMEQHGDAKLTDLLQTCPKARSASIHDRCKPVFEGLAV |
| Ga0210384_114728621 | 3300021432 | Soil | RTARALQVERLMAEHGDAKLTDLLTILADRPKARSMSVHDRCKAAYGQRLP |
| Ga0210391_107225691 | 3300021433 | Soil | MRTGGQYNVERLMAEHGDAKMTVLLQTLADRPKARSASIYDR |
| Ga0210390_109915391 | 3300021474 | Soil | YSVARLVEEYGDAKLTDLLQTLASCPKTRSPSIHDQCKVVYERLMAG |
| Ga0210398_112890622 | 3300021477 | Soil | KLTDLLETLANCPKARSASIHDRCKAVYSGLDLDEG |
| Ga0210410_105953204 | 3300021479 | Soil | ARLVEEHGDAKLTDLLQTLASCPKTRSLSIHDQCKVVYERLMAG |
| Ga0210410_109456791 | 3300021479 | Soil | MEQQGDAKLTDLLQTLANCPKTRAASIYDRCKAVYEKEPS |
| Ga0209693_105009282 | 3300027855 | Soil | MAEHGDAKLIDLLTTLADCPKARSVSIYDRCKAVYEGLSAR |
| Ga0209624_107083871 | 3300027895 | Forest Soil | NVARLMEQHSGDAKLTDLLQTLANCAKARSTGIHDRCEAVFEGLAV |
| Ga0209067_106444202 | 3300027898 | Watersheds | MRKLTDLLHILADCPKARSASIHDRCKAVYDWLEPA |
| Ga0209006_101097051 | 3300027908 | Forest Soil | VARFMEEHGDAELTDLFQTLANCAEARSTSIDDRCKAVFEGLATRQR |
| Ga0209006_102569573 | 3300027908 | Forest Soil | MARLMEEHGDAKLTDLFQTLANCAEARSTSIHDRCKAV |
| Ga0209006_104122281 | 3300027908 | Forest Soil | VARLMEQHGDAKLTDLLQTLANCPQARSASIHDRCKAVFEGLAV |
| Ga0209006_108505041 | 3300027908 | Forest Soil | RLMEQHGDAKLTDLLQTLANCPKVRSASIHDRCKAVFEGLAV |
| Ga0209698_112201392 | 3300027911 | Watersheds | NVARLMERHGNAKMTDLQQTLANCPKARSANIHDRCRAVFERLAL |
| Ga0316363_100214491 | 3300030659 | Peatlands Soil | NVARLMERHGDAKLPELLQTLTNCPKAHSANIHERCKAVYSGLRF |
| Ga0170824_1026112423 | 3300031231 | Forest Soil | FSHEQHGDAKLTDLLQTLANCPKARSASIHDRCKAVFEGLAV |
| Ga0170824_1173643781 | 3300031231 | Forest Soil | MERHGDAKMIDLLQTLANCPRARSANIHDRCRAVFERLAL |
| Ga0170820_107057381 | 3300031446 | Forest Soil | MERHGDAKLTDLLQTLANCPKARSASIHDCCKAVFGQRLP |
| Ga0170818_1085531342 | 3300031474 | Forest Soil | MEQHGDAKLTDLLQTLANCPKARSARIHDRCKAVFQGLFV |
| Ga0318534_107453632 | 3300031544 | Soil | VAKLMEQHGDAKLTDLLQELAACPKARSASIHDRCK |
| Ga0318541_107053912 | 3300031545 | Soil | VERLIAEHGDAKLTDLLATLADCEKARAISVHDRCKAAWLTH |
| Ga0318528_107939161 | 3300031561 | Soil | MELHGDAKLTDLLLTLADCQKARSASIHDRCKAVYGQPLP |
| Ga0310686_1150529314 | 3300031708 | Soil | RLIAAHGDAKLTDLPTTLADCDKARSFSIYDRCKAVYEGLRCGLKSVSAR |
| Ga0307474_116588481 | 3300031718 | Hardwood Forest Soil | MAEHDDAKLTDLLATLADCPKTRSVSIRERCKARCECYEGR |
| Ga0306917_103730142 | 3300031719 | Soil | MEQHGDAKLTDLLVTLAACPKARSASIHDRCKAVHGQRLP |
| Ga0306918_103002992 | 3300031744 | Soil | MGQHGDAKLTDLLQELAACPKARSAGIHDRCKAVYGRPLP |
| Ga0318546_109926151 | 3300031771 | Soil | MEQHGDAKLTDLLQALAACEKARSASVHDRCKAVYGQLLP |
| Ga0318523_105717092 | 3300031798 | Soil | VEQRGDAKLTDPLVEGPKARSASIDDWCKAVYEGLRLS |
| Ga0318564_105193321 | 3300031831 | Soil | MEQHADAKLTDLLLTLAACPKARSASIHDRCKAVYGQLLP |
| Ga0306925_104660184 | 3300031890 | Soil | RLIEQHGVDVKLTDLLVTLADCHKVRTASAHERCKAVYDRLNV |
| Ga0306925_108703561 | 3300031890 | Soil | AAWLMEQYGDAKLTDLLSALADCPKARSASVHDRCKQVYRQRLP |
| Ga0306925_111820771 | 3300031890 | Soil | MAEHGDAKLTDLLVALADCQKMGLASVHDRRCKVVHEGLSAG |
| Ga0318520_111111072 | 3300031897 | Soil | MEQHGDAKLTDLLQELAACPKARSASIHDRCKAVYKGL |
| Ga0306923_110857521 | 3300031910 | Soil | MEQHGDAKLTDLLLTLAACPKARSASIHDRCKVVYGQLLP |
| Ga0306923_117014401 | 3300031910 | Soil | DAKLTDLLGTLADCQKARSASIHDRCKVVYGSPLP |
| Ga0306923_118433913 | 3300031910 | Soil | GDAKLTYLLLTLGACPKARSASIHDQCKSVYGQPLP |
| Ga0306923_123948952 | 3300031910 | Soil | AEHDDAKLTDLLVTLAECRKTGSASVHDRCRALFERLS |
| Ga0306921_122921112 | 3300031912 | Soil | ELMAEHGDAKLTYLLLTLGACPKARSASIHDQCKSVYGQPLP |
| Ga0310912_109393221 | 3300031941 | Soil | RYSVAKLMEEHGDAKLTDLLQTLADCQKARSASIHDRCKAVYEGL |
| Ga0310916_111280732 | 3300031942 | Soil | MEQHGDAKLTDLLLTLAACPKARSASIHDRCKAVHGQRLP |
| Ga0310916_112097412 | 3300031942 | Soil | MELHGDAKLTDLLLTLADCQKARSASIHDRCKAVYG |
| Ga0310910_113781082 | 3300031946 | Soil | MAEHGDAKLTDLLATLADCEKARSVSAHDRCQARYSRYHGW |
| Ga0306926_111312151 | 3300031954 | Soil | MEQYGDAKLTDLLVTLAACPKARSASIHDRCKAVYGQLLP |
| Ga0306926_127358642 | 3300031954 | Soil | RGPDAKLPDLVLTLANCPKARSASIPDQCKAVYEQLVP |
| Ga0318530_104571682 | 3300031959 | Soil | MEQHGDAKLTDLLQELAACPKARSASIHDRCKAVYGQLLP |
| Ga0318562_106116641 | 3300032008 | Soil | VAKLMEQHGDAKLTDLLLTLAACPKARSASIHDRCKAVYGQLLP |
| Ga0318563_102651982 | 3300032009 | Soil | MEQHGDAKLTDLLVTLAACPKARSASIHDRCKAVYGQLLP |
| Ga0318563_104403601 | 3300032009 | Soil | MEEHGDAKLTDLLRTLADYQKARSASIHDRCKAVYEGL |
| Ga0318563_106762051 | 3300032009 | Soil | LMEQHGDAKLTDLLQDLANCQKARSASIHDRCKAG |
| Ga0318559_101879062 | 3300032039 | Soil | MARRMEQHGDAKLTDLLQALAACEKARSASVHDRCKAVYGQLLP |
| Ga0318524_100907394 | 3300032067 | Soil | VDWLMEQHGDAKLIDLFSMLADCPKACSASVHDRCETVYGQRLP |
| Ga0318524_101243901 | 3300032067 | Soil | LMEQYGDAKLTDLLVTLAACPKARSASIHDRCKAVYGQLLP |
| Ga0311301_1002274722 | 3300032160 | Peatlands Soil | MERHGDAKLTDLLQMLANCPKARSASIHDRCKVVFEQLLP |
| Ga0306920_1004937545 | 3300032261 | Soil | MAEHGDAKLTNLLATLADCEKARSLSVYDRCKAVYGQRLP |
| Ga0306920_1013456252 | 3300032261 | Soil | MARRMEQHGDAKLTDLLVTLAACLKARSASIYDRCKAVYGQLLP |
| Ga0306920_1026258852 | 3300032261 | Soil | VHGADAKLTDLLATLANCEKTRSFSIYDRCKARYARYYGQ |
| Ga0306920_1030325101 | 3300032261 | Soil | MAEHGDAKLTDLLTTLADCEKARSVSAHDRCQARYSRYHGW |
| Ga0335074_100444105 | 3300032895 | Soil | MSAHGDAHLTDLLPTLADCPKARAVSVHDRWKAVYEGL |
| Ga0335074_103288332 | 3300032895 | Soil | MSAHGDAHLTDLPPTLADCPKARAVSVHDRWKAVYERL |
| Ga0335074_112851832 | 3300032895 | Soil | MSAHGDAHLTGLPPTLADCPKARAVSVHDRWKAVYEGL |
| Ga0335072_100842015 | 3300032898 | Soil | MSAHGDAHLTDSLPTLADCPKARAVSVHDRWKAVYERL |
| Ga0318519_104960572 | 3300033290 | Soil | MEQHGDAKLTDLLLTLAACPKARSASIHDRCKAVYGQLLP |
| Ga0314862_0136688_393_509 | 3300033803 | Peatland | MAEHGDAKLTDLLAKLADCPKARSVSVRDRCKAVYEGL |
| ⦗Top⦘ |