NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F087267

Metagenome Family F087267

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087267
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 154 residues
Representative Sequence MDTRQPSARCNGSIVQETFRAAFSRNPILLKTLELIFAIKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRHVVDEALRSYASGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPAIGHLSG
Number of Associated Samples 101
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 63.55 %
% of genes near scaffold ends (potentially truncated) 97.27 %
% of genes from short scaffolds (< 2000 bps) 92.73 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.273 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(12.727 % of family members)
Environment Ontology (ENVO) Unclassified
(41.818 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(28.182 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.44%    β-sheet: 2.22%    Coil/Unstructured: 53.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00072Response_reg 1.82
PF00027cNMP_binding 1.82
PF00702Hydrolase 1.82
PF00891Methyltransf_2 0.91
PF07484Collar 0.91
PF03544TonB_C 0.91
PF04909Amidohydro_2 0.91
PF06508QueC 0.91
PF11154DUF2934 0.91
PF03951Gln-synt_N 0.91
PF13349DUF4097 0.91
PF06429Flg_bbr_C 0.91
PF00589Phage_integrase 0.91
PF01926MMR_HSR1 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.91
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 0.91
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.91
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.91
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.91
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.91
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.91
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.91
COG0780NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamilyTranslation, ribosomal structure and biogenesis [J] 0.91
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.91
COG1256Flagellar hook-associated protein FlgKCell motility [N] 0.91
COG1558Flagellar basal body rod protein FlgCCell motility [N] 0.91
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.91
COG1749Flagellar hook protein FlgECell motility [N] 0.91
COG4786Flagellar basal body rod protein FlgGCell motility [N] 0.91
COG4787Flagellar basal body rod protein FlgFCell motility [N] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.27 %
UnclassifiedrootN/A2.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101278148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii780Open in IMG/M
3300000955|JGI1027J12803_102218973All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300005329|Ga0070683_101391625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii674Open in IMG/M
3300005353|Ga0070669_101246365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii643Open in IMG/M
3300005457|Ga0070662_100736062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii836Open in IMG/M
3300005548|Ga0070665_100872477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii913Open in IMG/M
3300005614|Ga0068856_102001645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii590Open in IMG/M
3300005842|Ga0068858_100259489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1652Open in IMG/M
3300006358|Ga0068871_100282476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1452Open in IMG/M
3300009098|Ga0105245_13171060All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii510Open in IMG/M
3300009177|Ga0105248_11815900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii691Open in IMG/M
3300009519|Ga0116108_1018387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2435Open in IMG/M
3300009545|Ga0105237_10036001All Organisms → cellular organisms → Bacteria5007Open in IMG/M
3300009636|Ga0116112_1078888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii940Open in IMG/M
3300009639|Ga0116122_1263682All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii532Open in IMG/M
3300009644|Ga0116121_1170210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii689Open in IMG/M
3300009645|Ga0116106_1268745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii542Open in IMG/M
3300009792|Ga0126374_10424403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii937Open in IMG/M
3300009839|Ga0116223_10675604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii594Open in IMG/M
3300010371|Ga0134125_12288591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii588Open in IMG/M
3300010376|Ga0126381_103458428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii621Open in IMG/M
3300010376|Ga0126381_103576857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii609Open in IMG/M
3300010379|Ga0136449_100719505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.BinA0521670Open in IMG/M
3300013105|Ga0157369_11609983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii660Open in IMG/M
3300013296|Ga0157374_12667349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii527Open in IMG/M
3300013297|Ga0157378_10188181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1945Open in IMG/M
3300013306|Ga0163162_12185568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii635Open in IMG/M
3300013307|Ga0157372_13481354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii500Open in IMG/M
3300014151|Ga0181539_1102446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1203Open in IMG/M
3300014151|Ga0181539_1138453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii981Open in IMG/M
3300014155|Ga0181524_10000200All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae72572Open in IMG/M
3300014158|Ga0181521_10228063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii998Open in IMG/M
3300014162|Ga0181538_10638854All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii554Open in IMG/M
3300014499|Ga0182012_11040421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii514Open in IMG/M
3300014638|Ga0181536_10176557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1089Open in IMG/M
3300015242|Ga0137412_10925756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii630Open in IMG/M
3300016319|Ga0182033_10430839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1121Open in IMG/M
3300016341|Ga0182035_10601481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii950Open in IMG/M
3300016371|Ga0182034_12042292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii506Open in IMG/M
3300017924|Ga0187820_1102687All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii824Open in IMG/M
3300017929|Ga0187849_1248917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii677Open in IMG/M
3300017935|Ga0187848_10391866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii573Open in IMG/M
3300017942|Ga0187808_10542096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii541Open in IMG/M
3300017972|Ga0187781_10680206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii744Open in IMG/M
3300017975|Ga0187782_10800553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii729Open in IMG/M
3300018002|Ga0187868_1309284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii520Open in IMG/M
3300018008|Ga0187888_1234828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii718Open in IMG/M
3300018009|Ga0187884_10226298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii766Open in IMG/M
3300018012|Ga0187810_10210748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii791Open in IMG/M
3300018014|Ga0187860_1173972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii902Open in IMG/M
3300018014|Ga0187860_1339442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii573Open in IMG/M
3300018026|Ga0187857_10379041All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii639Open in IMG/M
3300018033|Ga0187867_10631436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii585Open in IMG/M
3300018044|Ga0187890_10474130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii703Open in IMG/M
3300018044|Ga0187890_10597875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii622Open in IMG/M
3300018047|Ga0187859_10300610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii868Open in IMG/M
3300018085|Ga0187772_10887261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii647Open in IMG/M
3300018086|Ga0187769_11389722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii531Open in IMG/M
3300018088|Ga0187771_10481459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1049Open in IMG/M
3300018090|Ga0187770_11140663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii629Open in IMG/M
3300019082|Ga0187852_1301402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii638Open in IMG/M
3300020582|Ga0210395_11248991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii545Open in IMG/M
3300020583|Ga0210401_10805402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii799Open in IMG/M
3300021168|Ga0210406_11145537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii569Open in IMG/M
3300021444|Ga0213878_10394343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii602Open in IMG/M
3300023090|Ga0224558_1104627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii982Open in IMG/M
3300023090|Ga0224558_1191953All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii623Open in IMG/M
3300025446|Ga0208038_1005005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4918Open in IMG/M
3300025459|Ga0208689_1073235All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii646Open in IMG/M
3300025576|Ga0208820_1138759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii557Open in IMG/M
3300025914|Ga0207671_10979800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii667Open in IMG/M
3300025914|Ga0207671_11171950All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii602Open in IMG/M
3300025944|Ga0207661_10548392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1059Open in IMG/M
3300025981|Ga0207640_10390320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1131Open in IMG/M
3300025986|Ga0207658_11952630All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii534Open in IMG/M
3300026041|Ga0207639_11446931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii645Open in IMG/M
3300026142|Ga0207698_10576425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1106Open in IMG/M
3300027548|Ga0209523_1117990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii549Open in IMG/M
3300027641|Ga0208827_1139832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii681Open in IMG/M
3300028381|Ga0268264_10710518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii999Open in IMG/M
3300029817|Ga0247275_1068603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii975Open in IMG/M
3300031231|Ga0170824_107677105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii539Open in IMG/M
3300031564|Ga0318573_10759287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii521Open in IMG/M
3300031573|Ga0310915_10853651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii639Open in IMG/M
3300031715|Ga0307476_10864889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii668Open in IMG/M
3300031754|Ga0307475_10774765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii762Open in IMG/M
3300031821|Ga0318567_10112305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1483Open in IMG/M
3300031823|Ga0307478_10795200All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii792Open in IMG/M
3300031823|Ga0307478_11641087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii530Open in IMG/M
3300031912|Ga0306921_10431010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1538Open in IMG/M
3300031941|Ga0310912_10711763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii778Open in IMG/M
3300031954|Ga0306926_12115908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii629Open in IMG/M
3300032001|Ga0306922_11023604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii851Open in IMG/M
3300032008|Ga0318562_10670469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii597Open in IMG/M
3300032059|Ga0318533_10990260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii616Open in IMG/M
3300032261|Ga0306920_100995862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1221Open in IMG/M
3300032261|Ga0306920_102931898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii646Open in IMG/M
3300032805|Ga0335078_11833119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii658Open in IMG/M
3300032828|Ga0335080_12399348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii503Open in IMG/M
3300032829|Ga0335070_10704306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii944Open in IMG/M
3300032954|Ga0335083_10760644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii781Open in IMG/M
3300033402|Ga0326728_10365883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1258Open in IMG/M
3300033405|Ga0326727_10112514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3480Open in IMG/M
3300033405|Ga0326727_10792084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii733Open in IMG/M
3300033977|Ga0314861_0508702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii516Open in IMG/M
3300033982|Ga0371487_0158719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1119Open in IMG/M
3300033983|Ga0371488_0288550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii790Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland12.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.27%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.45%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.45%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.64%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.73%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.82%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.82%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.91%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10127814813300000364SoilMVTRRPFAKRNRSIVQEIVHAAFSRDPTLLKALEWLLPSAPGSLSAMRLRIQPFIATHRNLVGEGPFLLPRERSDGSQDVPLVPLVRRVVDEALRAYARGSPHLLDHVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHHSGFKAELERTLTQELHK
JGI1027J12803_10221897343300000955SoilVQETVRAAFSRNPIRLEALELICPNAAESLSVPGLRIQPFIAAHRNLVSEEPFLLPKERFGASQDIAMVPLVRHVVDEALRSYARGSPHLSEYVGETPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLP
Ga0070683_10139162513300005329Corn RhizosphereMDTRQPSARCNGSIVQETFRAAFSRNPILLKTLELIFAIKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRYVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELHKYKLYPLLFGKDAQ
Ga0070669_10124636513300005353Switchgrass RhizosphereMDTRQPSARCNGSIVQETFRAAFSRNPILLKTLELIFAIKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRYVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYI
Ga0070662_10073606223300005457Corn RhizosphereMVTRQPSTRCNGSIVQDIVRGAFSQNPILLKTLELIFPNKAESLSLKGLRLQPFIAAHRNLVSVEPFLLPKERFGGSQDVELVPLVRHVVDEALRSYASGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELHKYRLY
Ga0070665_10087247713300005548Switchgrass RhizosphereMVTRQPSTRCNGSIVQDIVRGAFSQNPILLKTLELIFPNKAESLSLKGLRLQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRHVVDEALLSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPAIGHLSGFKSELERNLTQELHKY
Ga0068856_10200164513300005614Corn RhizosphereMVTRQPSTRCNGSIVQDIVRGAFSQNPILLKTLELIFPNKAESLSLKGLRLQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRHVVDEALRSYASGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPP
Ga0068858_10025948933300005842Switchgrass RhizosphereMDTRQPSARCNGSIVQETFRAAFSRNPILLKTLELIFAIKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRHVVDEALRSYASGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPAIGHLSG
Ga0068871_10028247633300006358Miscanthus RhizosphereMVTRQPSTRCNGSIVQDIVRGAFSQNPILLKTLELIFPNKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRYVVDETLRSHALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELHK
Ga0105245_1317106013300009098Miscanthus RhizosphereGPLVQEIARAAFSRNPIVPEALELIFHNAAESLSFRDLQIHPFIAAHRNLASEEPFLLPKERFGGIQDVALVPLVRHVVDEALQACARGSPHLLEYVGKSPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELHKYKLYPLLFGKDAQG
Ga0105248_1181590013300009177Switchgrass RhizosphereMRAAFSRNPILLKTLELIFSNKAESLSLKGLRLQPFIAVHRNLIGVEPFLLPKERFGGAQDVELVPLVRHVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELHKYRLYPL
Ga0116108_101838713300009519PeatlandMKQPPGKQAMVTRRPSVKSNGSIAQDTLRAVFSRNPAVPGALKFLFPNAAEGLSFQGLRIQPHVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDEALRAYAHTSPHLLDYVGKTPISPYGSLGLSVSRWGQVDWDYVRDLDWRIFLPPEIGHVSGFKSYLEQNLTEKLHE
Ga0105237_1003600113300009545Corn RhizosphereVRAAFCRNPIFLKALELIFPNKAESLCLQGLRFQPFIAVHRNLIGVEPFLLPKERFGGSQDVELVPLVRNVVDEAIRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRIFLPPEIG
Ga0116112_107888823300009636PeatlandMGRRQPSAKSNGSLVEQALRAFSSRNPNLAAALKFLFTNAAESLSFQDLRIQPLVAAHRNAFGEEPLFLPRERFGGTQDLAMVPLIRTVVDETLRAFASTSPHLLEQVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRVFLPAEIGHLSGFKSQMERNLREELHKYELYPVLFGKD
Ga0116122_126368213300009639PeatlandMVTRPPSARSNASIEQQTLRALCSRNPHIAGALNFLFANAAESPSFQELRVQPRVGAHRNLVSDEPFLMPKERSGGSQDIALIPFMRTVVDETLRAYSATSPHLLEFVGKTPISPYGSLGLSVNRWGQVDWDYIRDLDW
Ga0116126_117336913300009640PeatlandMKQPPGKKAMVTRRPSVESNGPTVQDTLRAVLSRNPSALGALKFLFPNAAESMSFQGLRIQPLVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDEALRAYAHTSPHLLDYVGKT
Ga0116121_117021013300009644PeatlandMKQPPGKKAMVTRRPSVESNGPTVQDTLRAVLSRNPSALGALKFLFPNAAESMSFQGLRIQPLVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDEALRAYAHTSPHLLDYVGKTPISPYGSLGLSVSR
Ga0116106_126874513300009645PeatlandMKQPPGKQAMVTRRPSVKSNGSIAQDTLRAVFSRNPAVPGALKFLFPNAAEGLSFQGLRIQPHVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDETLRAYAHTSPHLLDYVGKTPISPYGSLGLSVSRWGQVDWDYVRDLDWRIFL
Ga0126374_1042440313300009792Tropical Forest SoilVFRNRGACPSFQDLRVPPIVGSHLNIIKEKPFILPKERFGGSEDVPLVPLIRKVVDEALRAYASTTPQLFESVGKTPISPYGSMGLSVSRWGYVDWDYVRDLDWRIFLPQQIGHLSGFKSELDRTLTKELQKYGLDPVLFGKDEW
Ga0116223_1067560413300009839Peatlands SoilMGRRQPSAKSNGSLVEQALRAFSSRNPNLAAALKFLFTNAAESLSFQDLRIQPLVAAHRNAFGEEPLFLPRERFGGTQDLAMVPLIRTVVDETLRAFASTSPHLLEQVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRVFLPAEIGHLSGFKSQMERNLREELHKYELYPVLFGKDAE
Ga0134125_1228859113300010371Terrestrial SoilMDMVTRQPSAKCNGPLVQEIARAAFSRNPIVPEALELIFHNAAESLSFRDLQIHPFIAAHRNLASEEPFLLPKERFGGIQDVALVPLVRHVVDEALQACARGSPHLLEYVGKSPISPYGSMGLSVSRWGQVDWDYIR
Ga0126381_10345842813300010376Tropical Forest SoilMVTRQASAKCNGWVQETVPAVFSRNPLLSKALEWIFPNAAETLSFQGLRFQPFIAAHRNPFCEEPFLLPRERFGGLQDVALVSLVRHVVDESLRAYARGSPHLLEYVGKSPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNL
Ga0126381_10357685713300010376Tropical Forest SoilMATRQPSAKCHESILREIARAAFSRNAVLFEVLELIFPNSTKSLSVQGLRLQPFIAAHRNLIGAEPFVLPQERFGGSQDVALVPLIRHVVDEALRAYARGRPHLVESVGKTPISPYGSMGLSVSRWGKVDWDYIRDLDWRIFLPPEIGHLSGFKSELERSLTQELHKYKLYPLLFGMDAQGL
Ga0136449_10071950513300010379Peatlands SoilMGRRQPSAKSNGSLVEQTLRAFPSRNPNLAAALKFLFTNAAESLSFQDLRIHPLVAAHRNAFGEEPFFLPRERFGGTQDLAMVPLIRKVVDETLRAFASTSPHLLEQVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRVFLPAEIGH
Ga0157369_1160998313300013105Corn RhizosphereVQDIVRGAFSQNPILLKTLELIFPNKAESLSLKGLRLQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRHVVDEALRSYASGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPP
Ga0157374_1266734913300013296Miscanthus RhizosphereVRAAFCRNPIFLKALELIFPNKAESLCLQGLRFQPFIAVHRNLIGVEPFLLPKERFGGSQDVELVPLVRNVVDEAIRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDDIRDLDWRIFLPPAIGHLSGF
Ga0157378_1018818143300013297Miscanthus RhizosphereVQETFRAAFSRNPILLKTLELIFAIKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRYVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLS
Ga0163162_1218556813300013306Switchgrass RhizosphereVQETFRAAFSRNPILLKTLELIFAIKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRYVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELHKYKLYPLLFGKDAQGLP
Ga0157372_1348135413300013307Corn RhizosphereTRQPSTRCNGSIVQDIVRGAFSQNPILLKTLELIFPNKAESLSLKGLRLQPFIAAHRNLVGVEPFLLPKERFGGWQDVELVPLVRHVVDEALRSYASGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPAIGHLSGFKSELERNLTQELHKY
Ga0181539_110244613300014151BogMVTRQSSAKCNGSIVQDTLRTAFSGNPILLEALEFLFPNAAESLSFQGLRFQPVIAAHRNLVSMEPFVLPKERFGGSRDVALVSLVRHVVDETLRGYAHGIPHLLEYVGKTPVSPYGSIGLSVSRWGRVDWDFIRDLD
Ga0181539_113845313300014151BogMEQPPGKKAMVTRRPSVESNGSILQDTLRAVFSRNPAALGALKFLFPNAAEGLSFQGLRIQPLVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDETLRAYAHTSPHLLDYVGKTPISPYGSLGLSVSRWGQVDWDYVRDLDWR
Ga0181524_1000020013300014155BogMVTRQPPAKSKASIVQETLRAVCSRNPLLLGALEFLFPNAAESLSFRGLRIQPLVAAHRNLISAEPFLLPKERFGGSQDVALAPLVRIVVDETLRAYAHTSPHLLDYVGKTPISPYGSLGLSVSRWGQVDWDY
Ga0181521_1022806313300014158BogMKQPPGKKAMVTRRPSVESNGPTVQDTLRAVLSRNPSALGALKFLFPNAAESLSFQGLRIQPLVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDEALRAYAHTSPHLLDYVGKTPISPYGSLGLSVSRWGQVDWDYVRDLDWRIFLPPEIGHVSGFKSYLEQNLTEKLHE
Ga0181538_1063885413300014162BogMKQPPGKQAMVTRRPSVKSNGSIAQDTLRAVFSRNPAVPGALKFLFPNAAEGLSFQGLRIQPHVAAHRNLFSAEPFLLPKERFGGSHDVALAALVRNAVDETLRAYAHTSPHLLDYVGKTPISPYGSLGLSVSRWGQVDWDYVRDLDWRIFLPPEIGHVSGFKSYLEQNLTEKLHEY
Ga0182012_1104042113300014499BogAMPTRLPSVKSKASIEQQTVRALCSRNPHIAGALDFLFANAADSLSFQELRVQPAVGTHRNPVSEEAFRLPKERFGSSQDIALIPFMRAVVDETLGAYSATSPHLLEYVGKTPISPYGSLGLSVNRWGLVDWDYIRDLDWRIFLPPEIGHRAGFKSLLEQNLTEELQKYSL
Ga0181536_1017655723300014638BogMAKMEEPLDKNAMATRPPCAKNNESKVEEALRSVCSRNPSLHGALEFLFPNAVENLSFQALRFQPPVAAHRNLVSEEPFLLPKERFGGSQDIALIPFIRSVVDETLRACASTSPHLLESVGKT
Ga0157379_1045191713300014968Switchgrass RhizosphereVQDIVRGAFSQNPILLKTLELIFPNKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRYVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYI
Ga0137412_1092575613300015242Vadose Zone SoilMVTRQPSAERNGSIVLGTVRAALSRNPILLKILELIFPNTAENLSFQGLRFQPFIAVHRNLVSVEPFLLPKERFGGSQDVELVPLVRHVVDEALRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPQIGHLSGFKSE
Ga0182033_1043083913300016319SoilMATRQPSAKCNGAIVRETMRAAFSRNPILHEALELILPNLPESVSFQDLRFPPFIAAHRNFIGAEPFLLPEERFGGAQDVSMVPLVRHVVDETLLAYARGRPHLLDYVGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPQIGHLSGFKSELERNLTQ
Ga0182035_1060148113300016341SoilMVTRQPSTKWNGSIVQETVRAAFSRNPTLLEALEFILPNAAESLSFQGLRIQPFIAAHRNLVSVEPFLLPKERFGGSQDVEMVPLVRQVVDETLRAYARGSPHLLNHVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRIFLPPEVGHLSGFKSDLER
Ga0182034_1204229213300016371SoilMVTRQSSAKCHESILREIARAAFSRTAVLFEAVELIFPNSAENLSVQGLRFQPFVAAHRNLIGPEPFVLPNERFGGSQDVALVPLVRHVVDEALSAYARGSPRLVECVGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLP
Ga0187820_110268723300017924Freshwater SedimentMVTRQPSTKWNASIVQETVRATLSRNPILLEALEFILPNAAESLSFQGLRVQPFIAAHRNLVSVEPFLLPKDRFGGAQDIAMVALVRHVVDETLRAYAGGSPHLLKHVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRIFLPPEVGHLSGFKSDLERNLTHELHKYKLY
Ga0187849_124891713300017929PeatlandMGRRQPSAKSNGSLVEQALRAFSSRNPNLAAALKFLFTNAAESLSFQDLRIQPLVAAHRNAFGEEPLFLPRERFGGTQDLAMVPLIRTVVDETLRAFASTSPHLLEQVGKTPISPYGSMGLSVSRWGYVDWDYIRDLD
Ga0187877_117819713300017931PeatlandMVTRQSSAKCNGSIVQDTLRAAFSGNPILFEALEFLFPNAADSLSFQGLRFQPVIAAHRNLVSMEPFVLPKERFGGSRDVALVSLVRHVVDETLRGYAHGIPHLLEYVGKTPVSPYGSIGLSVSRWGRV
Ga0187848_1039186623300017935PeatlandMVTRPPSARSNASIEQQTLRALCSRNPHIAGALNFLFANAAESPSFQELRVQPRVGAHRNLVSDEPFLMPKERSGGSQDIALIPFMRTVVDETLRAYSATSPHLLEFVGK
Ga0187808_1054209613300017942Freshwater SedimentMVTRRLSANNNGSIVEESLRALLFRNPSLAQTLEFLFSNPRESWSLQGLRIDPAVATHRNLVDAEPFLLPAERFGGAEDLPMVPLLRHVVDESLRAYARTSPHLLDHVGKTPIAPYGSLGLSVSRWGYVDWDYIRDLDWRIFLPPEIGHVSGF
Ga0187781_1068020623300017972Tropical PeatlandMQEVLRVLLSRNPNVFEALEFLFPNAAEKLSFQGLRIQPVVAAHRNLVSVEPFLLPKERFGGTQDLPLVPLIRSAVDEALGDYAATSPHLLEYVGKTPISPYGSLGLSVSRWGQVDW
Ga0187782_1080055323300017975Tropical PeatlandMVPRQPCENSNESTVPEVLRAVFSRNPALREALDFLFQNAAESRSFAELRAEPHVAAHRNLIGPEPFLLPKERFGGSQDVALVPLIRDAVDETLRAYAYASPHLLQYAGKTPISPYGSMGLSVSRWGHV
Ga0187868_130928413300018002PeatlandRQSSAKCNGSIVQDTLRAAFSGNPILLEALEFLFPNAAESLSFQGLRFQPFIAAHRNLVSMEPFVLPQERFGGSQDVALVSLVRHVVDETLRACAYGSPHLLEYVGKTPISPYGSIRLSVSRWGRVDWDFIRDLDWRIFLPNEIGHRSGFKSELERNLTQELHKYKLYPLLF
Ga0187888_123482823300018008PeatlandMVTRQSSAKCNGSIVQDTLRAAFSGNPILLEALEFLFPNAAESLSFQGLRFQPFIAAHRNLVSMEPFVLPQERFGGSQDVALVSLVRHVVDETLRACAYGSPHLLEYVGKTPISPYGSIGLSVSRWGRVDWDFIRDLDWRIFLPPEI
Ga0187884_1022629813300018009PeatlandMEQPPGKKAMVTRRPSVESNGSIVQDTLRAVFSRNPAVLGALNFLLPNAAKSLSFQGLRIQPLVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDETLRAYAHTSPHLLDYVGKTPISPYGS
Ga0187810_1021074813300018012Freshwater SedimentMKSPRDKNAMARRRPSAKSNGSPVERVLRAASTRNPNLPAALKFLFPRGVEQIDFADLRTQPLFAAHHNPFDEEPFFLPRERFGGARDLPLVPLVRKVVDETLRSFAATSPHLEEQVGKTPISPYGSMGLSVSRWGNVDWDYIRDLDWRVFLPPEIGHLSGFKSQLEQNLREELHRYELYPVLFGKDAEGQPQVQLRDNRTGEV
Ga0187860_117397223300018014PeatlandMVTRPPSARSNASIEQQTLRALCSRNPHIAGALNFLFANAAESPSFQELRVQPRVGAHRNLVSDEPFLMPKERSGGSQDIALIPFMRTVVDETLRAYSATSPHLLEFVGKTPISPYGSLGLSVNRWGQVDWDYIRDLDWRIFLPPEIGHRAGFKSLLE
Ga0187860_133944213300018014PeatlandYRGPDRTSAPSKATMEQPPGKKAMVTRRPSVESNGSILQDTLRAVFSRNPAVPGALKFLFPNAAESLSFQGLRIQPLVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDEALRAYAHTSPHLLDYVGKTPISPYGSLGLSVSRWGQVDWDYVRDLDWRIFLPPEIGHVSGFKSYLEQNLTEKLHE
Ga0187857_1037904113300018026PeatlandMVTRQRSAKSKGSIVQETLRTVASRNPVLLKALKFLFSGAAETLSFQRLRLQPPVAAHRNPFGAEPFLLPKERFGGSQDVALVPLVRNVVDETLRAYASESPYLLEYVGKTPISPYGSLSLSVSRWGHVDWDYIRDLDWRIFLPPDIGHVSGFKSYLEQNLTEELLKFGLYPRL
Ga0187867_1063143613300018033PeatlandMVTRQSSAKCNGSIVQDTLRAAFSGNPILLEALEFLFPNAAESLSFQDLRFQPFIAAHRNLVSMEPFVLPQERFGGSQDVALVSLVRRVVDETLRAYSYGIPHLLEYVGKTPISPYGSIGLSVSRWGRVDWDFIRDLDWRIFLPPEVGHRSGFKSELERN
Ga0187890_1047413013300018044PeatlandMALDKKPMVTRLPSAKRNGSIVEDALQTVFSRNPGLLRTFEFLFPNLQENFSFNGLRVEPFIAAHRNLVSAEPFFLPRDRFGGTQNVALVPLVRHVVDETLRAYAATSPYLLEHVGKTPISPHGSLGLSVSRWGYVDWDYIRDLDWR
Ga0187890_1059787513300018044PeatlandMVTRPPSARSNASIEQQTLRALCSRNPHIAGALNFLFANAAESPSFQELRVQPRVGAHRNLVSDEPFLMPKERSGGSQDIALIPFMRTVVDETLRAYSATSPHLLEFVGKTPISPYGSLGLSVNRWGQVDWDYIRDLDWRIFLPPEIGHRAGFKSLLEQNLTEELQKHSLHPVM
Ga0187859_1030061023300018047PeatlandMDSGAQVSVLDPVTLVLPLEGYNFEQPLDKKDMVTRRISVKSKASIVQEILRAIRSRNPTLLAALEFILPNAAENLSFQGLRIQPLVGVHRNLIGAEPFLLPRERFGGSQEVALVPLIRKTVDETLRAYAATSPHLLEYVGKTPISPYGSLGLSVSRWGQVDWDYVRDLDWRIFLPPDVGHVSGFKSY
Ga0187772_1088726113300018085Tropical PeatlandMRQPSAQNKRSTAQDPLRAVFFRNPALRGALELLFPNPAESLSFQNLRVQPLVPAHRNLIGADPFLLPKERLGGSQDVAMVPLLRHVVDEPLRAYAATSPHFLEYVGKTPISPYGSMALSVSRWGYVDWDYIRDLDWRIFLPPEVGHLTGFKSYLERTLTQELHKYDLY
Ga0187769_1138972213300018086Tropical PeatlandRLRAGRRASGKTKMNQPPGEEAMVTRQPSVESNGSIMQQALRGLLSRNAVAARALKFLFPTAPESMSFKDLRIQPLVSEHRNLVGAEPFLLPQERFGGSQDIALVPLVRMIVDETLRAFAATSPHLLDYVGKTPISPYGSLSLSVARWGQADWDYIRDLDWRIFLPPELGHLSGFK
Ga0187771_1048145913300018088Tropical PeatlandMAEGTLRAVCSRNPKLLPAFDFLFPNAAESLSFQDLRIPPVVAAHRNPISAEPFLLPKERFGASQDLPLVPLIRKVVDEALRSYSHRSPHLLEYVGKTPISPYGSMSLSVSRWGYV
Ga0187770_1114066323300018090Tropical PeatlandMVARQPSAQSNGSVSEETLRAVFSRNPKLLPAFDFLFPNSAESFSFHNLRIPPVVAAHRNLLGAEPFLLPKERFGGSEDLPLVPLLRNVVDAALRAYAHRSPHHLQYVGKTPISPYGSMS
Ga0187852_130140213300019082PeatlandMEQPPGKKAMVTRRPSVESNGSILQDTLRAVFSRDPAVLGALKFLFPNAAESLSFQGLRIQPLVAAHRNLFSAEPFLLPKERFGGSQDVALAALVRNAVDETLRAYAHTSPHLLDYVGKTPISPYGSLGLSVSRWGQVD
Ga0210395_1124899113300020582SoilMVTRQPSANRNGSIVLETVRAALSRNPILLKTLELIFPNTAESLSFRGLRFQPFIAVHRNLVSVEPFLLPKERCGGSQDVELVPLVRHVVDEALRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQEL
Ga0210401_1080540223300020583SoilMVARQPSAKRNGSIVLETVRAALSRNILLKTPELIFPNTAESLSFQGLRFQPFIAAHRNLVSVEPFLLPKERFGGSQDVELVPLVRHVVDEALRSYARGSPHLLEYVGKTPTSPYGSMGLSVSRWGHVDWDYIRDL
Ga0210406_1114553713300021168SoilMVTRQPSARCNGSIVQETVRAAFSRNPILLKTLELIFPNTAESLSFHGVRFQPFIAAHRNLFSVEPFLLPKERFGGSQDVELVPLVRHVVDEALRSYARGSPHLLEYVGKTPISPYGSMGLNVSRWGHMDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELHKYK
Ga0213878_1039434313300021444Bulk SoilMVTRQPSAKSNGSIVQETARAAFSGNPILLEVLELILPNKTESPSLRDLRFQPFITAHRNPFNEKPFFLPEERFGGSQDVALVPLVRHVVDEALRAYARGSPHLLNYVGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPEIGHLSGFKSELERSLTQELHKYKLYPLLFGKDAQGQP
Ga0224558_110462713300023090SoilMDTRQPSTESQGSIVEETLRAFFSRNPNLAGALEFLFPNPAEDLSIQSLRILPFIAEHRNLVSSEPFLLPQERFGGSQDVALVPLVRDVVDETLRAYAYTSPHLLEYVGKTPISSYGSMGLSVSRWGQVDWDYIRDLDWRIFLPAEIGHRSGFK
Ga0224558_119195313300023090SoilMPTRLPSVKSKASIEQQTVRALCSRNPHIAGALDFLFANAADSLSFQELRVQPAVGTHRNPVSEEAFRLPKERFGSSQDIALIPFMRAVVDETLGAYSATSPHLLEYVGKTPISPYGSLGLSVNRWGLVDWDYIRDLDWRIFLPPEIGHRAGFKSLLEQNLTEELQK
Ga0208038_100500513300025446PeatlandMGRRQPSAKSNGSLVEQALRAFSSRNPNLAAALKFLFTNAAESLSFQDLRIQPLVAAHRNAFGEEPLFLPRERFGGTQDLAMVPLIRTVVDETLRAFASTSPHLLEQVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRVFLPAEIGHLSGFKSQMERNLREELHKYELYPV
Ga0208689_107323513300025459PeatlandMGRRQPSAKSNGSLVEQALRAFSSRNPNLAAALKFLFTNAAESLSFQDLRIQPLVAAHRNAFGEEPLFLPRERFGGTQDLAMVPLIRTVVDETLRAFASTSPHLLEQVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRVFLPAEI
Ga0208820_113875913300025576PeatlandMVTRQSSAKCNGSIVQDTLRAAFSGNPILLEALEFLFPNAAESLSFQDLRFQPFIAAHRNLVSMEPFVLPQERFGGSQDVALVSLVRRVVDETLRAYSYGIPHLLEYVGKTPISPYGSIRLSVSRWGRVDWDFIRDLDWRIFLPNEIGH
Ga0207671_1097980013300025914Corn RhizosphereMVTRQPSARCNGSILRETVRAAFCRNPIFLKALELIFPNKAESLCLQGLRFQPFIAVHRNLIGVEPFLLPKERFGGSQDVELVPLVRNVVDEAIRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELH
Ga0207671_1117195013300025914Corn RhizosphereAERRSLSTEGLPRLLKPVTEDSNPDRRSCLRGLQLDPLVRKNMVTRQPSAKCNGPLVQEIARAAFSRNPIVPEALELIFHNAAESLSFRDLQIHPFIAAHRNLASEEPFLLPKERFGGIQDVALVPLVRHVVDEALQACARGSPHLLEYVGKSPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPEIGHLSGFKSELE
Ga0207661_1054839213300025944Corn RhizosphereMDTRQPSARCNGSIVQETFRAAFSRNPILLKTLELIFAIKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRYVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQELHKYKLYP
Ga0207640_1039032033300025981Corn RhizosphereMVTRQPSARCNGSILRETVRAAFCRNPIFLKALELIFPNKAESLCLQGLRFQPFIAVHRNLIGVEPFLLPKERFGGSQDVELVPLVRYVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGFKSELERNLTQ
Ga0207658_1195263013300025986Switchgrass RhizosphereMDTRQPSARCNGSILRETVRAAFCRNPIFLKALELIFPNKAESLCLQGLRFQPFIAVHRNLIGVEPFLLPKERFGGSQDVELVPLVRNVVDEAIRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDW
Ga0207639_1144693113300026041Corn RhizosphereMDTRQPSARCNGSIVQETFRAAFSRNPILLKTLELIFAIKAESLSLQGLRFQPFIAAHRNLVSVDPFLLPKERFGGSQDVELVPLVRYVVDETLRSYALGSPHLLKYVGRTPISPYGSMGLSVSRWGHVDWDYIRDLDWRI
Ga0207698_1057642523300026142Corn RhizosphereMVTRQPSTRCNGSIVQDIVRGAFSQNPILLKTLELIFPNKAESLSLKGLRLQPFIAAHRNLVGVEPFLLPKERFGGWQDVELVPLVRQVVDEALRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGYVDWDYIRDLDWRIFL
Ga0209523_111799013300027548Forest SoilASFTIARGVAPLAQACHGRPQSGQKKLPSRATIRPLVRKDMVTRQPSAKCNGPLAQEIERAAFSRNPILSEALEFIFHNAAESLSFQDLQIHPFIAAHRNLVSEEPFLLPKERFGGIQDVALVPLVRHVVDEALRACARGSPHLLEHMGKSPISPYGSMSLSVSRWGQVDWDYIRDLDWRIF
Ga0208827_113983213300027641Peatlands SoilMVKHQPFGKSNKSILKETLRPILTKNSSLLHALEFLFPNAADNPSFQNLRIQPLVAEHRNLVSAEPFLLPKARLGGSQDIALLPFIRNVVDETMRAFATTSPHLLEYVGKTPISPYGSLGLSVSRWGYVDWDYIRDLDLRIFLPPE
Ga0268264_1071051823300028381Switchgrass RhizosphereMVTRQPSTRCNGSIVQDIVRGAFSQNPILLKTLELIFPNKAESLSLKGLRLQPFIAAHRNLVSVEPFLLPKERFGGSQDVELVPLVRHVVDEALRSYASGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDL
Ga0247275_106860323300029817SoilMVTRQSSAKCNGSIVQDTLRAAFSGNPILLEALEFLFPNAAESLSFQDLRFQPFIAAHRNLVSMEPFVLPQERFGGSQDVALVSLVRRVVDETLRAYSYGIPHLLEYVGKTPISPYGSIRLSVSRWGRVDWDFIRD
Ga0170824_10767710513300031231Forest SoilMDNLSQQTANGTEQVQLNPLVRKDMVTRQPSAKRNESIVLETVRAALSRNPILLKTLELIFPNTAESLSFEGLRFQPFIAVHRNLVSVEPFLLPKERFGGSQDVELVPLVRHVVDEALRSYARGSPHLLEYLGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGF
Ga0318573_1075928713300031564SoilLRTNGQGPRQRNVICSKSEDFKPNLRRQRLQLNPLAGKDMVTRQPSAKCNGSIVQEIVRAASSRYPAVLEALELIFPNASEGFSFQDLRFQPFIAMHRNPINEEPFWLPKERFGGTQDLALVPLVRHVVDESLGAYARGSPHLLEYVGKTPISPYGSMGLSVSRWGQVDWDYI
Ga0310915_1085365113300031573SoilMATRQPSAKCNGAIVRETMRAAFSRNPILHEALELILPNLPESVSFQDLRFPPFIAAHRNFIGAEPFLLPEERFGGAQDVSMVPLVRHVVDETLLAYARGRPHLLEYAGKTPISPYGSMGLSVIRWGQVDWDYIRDLDWRIFLP
Ga0307476_1086488913300031715Hardwood Forest SoilMVTRQPSARCNGSIVQETVRAAFSRNPILLKTLELIFPNTAESLSLQGLRFQPFIAVHRNPFTEEPFLLPKERFGGSQDVKLVPLVRHVVDEALRAYARGSPHLLKYVGKSPISPYGSMGLSVNRWGQVDWDYIRDLDWRIFLPPEIGHLSGF
Ga0307475_1077476513300031754Hardwood Forest SoilMVARQPSAKRNGSIVLETVRAALCPNPVLLKTLELIFPNTAESLSFQGLRFQPFIAVHRNLVSVEPFLLPKERFGGSQDVELVPLVRHVVDEALRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPPEIGHLSGFKSELE
Ga0318567_1011230523300031821SoilMVTRQSSAKCHESILREIARAAFSRTAVLFEAVELIFPNSAENLSVQGLRFQPFVAAHRNLIGPEPFVLPNERFGGSQDVALVPLVRHVVDEALSAYARGSPRLVECVGKTPISPYGSMGLSVSRWGQVDWDY
Ga0307478_1079520013300031823Hardwood Forest SoilMVARQPSAKRNGSIVLETVRAALCPNPVLLKTLELIFPNTAESLSFQDLRFQPFIAVHRNLVSVEPFLLPKERFGGSQDVELVPLVRNVVDEALRAYARGSPHLLEYVGKSPISPYGSMGLSVSRWGHVDWDYIRDLDWRIFLPP
Ga0307478_1164108713300031823Hardwood Forest SoilRRLQLTPLVRKDMVTRQPSARCNGSIVRETVRDAFSGNPILLKTLELIFPNKAESLSFHGLRFQPFIAAHRNLVGAEPFLLPKERFGGSQDVELVALVRHVVDEALRSYARGSPHLLEYVGKTPISPYGSMGLSVSRWGHVDWDYIRDVDWRIFLPPEIGHLSGFKSELERNLTQE
Ga0306921_1043101013300031912SoilMVTRQSSAKCHESILREIARAAFSRTAVLFEAVELIFPNSAENLSVQGLRFQPFVAAHRNLIGPEPFVLPNERFGGSQDVALVPLVRHVVDEALSAYARGSPRLVECVGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPEIGHLSGFKS
Ga0310912_1071176313300031941SoilMVTRQSSAKCHESILREIARAAFSRTAVLFEAVELIFPNSAENLSVQGLRFQPFVAAHRNLIGPEPFVLPNERFGGSQDVALVPLVRHVVDEALSAYARGSPRLVECVGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPEIGHLSGFKSELERSLTQELHKYKLYPLLFGK
Ga0306926_1211590823300031954SoilMATRQPSAKCNGAIVRETMRAAFSRNPILHEALELILPNLPESVSFQDLRFPPFIAAHRNFIGAEPFLLPEERFGGAQDVSMVPLVRHVVDETLLAYARGRPHLLEYVGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRI
Ga0306922_1102360413300032001SoilMATRQPSAKCNGAIVRETMRAAFSRNPILHEALELILPNLPESVSFQDLRFLPFIVGHRNFIGAEPFLLPKERFGGAQDVSMVPLVRHVVDETLRAYARGRPHLLEYVGKTPISPYGSMGLSVIRWGQVDWDYIRDLDW
Ga0318562_1067046913300032008SoilMATRQPSAKCNGAIVRETMRAAFSRNPILHEALELILPNLPESVSFQDLRFPPFIAAHRNFIGAEPFLLPEERFGGAQDVSMVPLVRHVVDETLLAYARGRPHLLEYAGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFL
Ga0318533_1099026013300032059SoilMVTRQSSAKCHESILREIARAAFSRTAVLFEAVELIFPNSAENLSVQGLRFQPFVAAHRNLIGPEPFVLPNERFGGSQDVALVPLVRHVVDEALSAYARGSPRLVECVGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPPEIGHLSGFKSELERSLTQELHKYKLY
Ga0306920_10099586223300032261SoilMVTRQPSAKYDGSIVQETVRAAFSRSPILLEALELLFPNVAESLSFQSLRIQPFIAAHRNLVSGGPFWLPKERFGGSQDIALVPLVRLVVDEALRAYARGSQHLLEYVGKTPISPYGSMGQSVSRWGYVDWDYIRDLDWRIFLPPEIG
Ga0306920_10293189813300032261SoilMVTHQPSAKRNGSIVGETVRAAFSRNPILLEALELIFPNATENLSFQSLRIQPFIAAHRNLVSAEPFWLPKERFGGSQDVALVPLVRHVVDEALRAYACVSPHLLEYVGKTPISPYGSMGQSVSRWGYVDWDYIRDLDWRVFLPPEIGHL
Ga0335078_1183311913300032805SoilMVTRQPSANRSELARQEILRPLLSRTPRLSAALEFLFPGAAERLSFQDLRIEPSVGTHRNLVGEEPFLLPRERFAGSQDIALIPFMRAVVDETLRACASTSPHLLEYVGRTPISPYGSLGLSVSRWGMVDWDYIRDLDWRIFLPPEIGHQSGFKSHLERNLTE
Ga0335080_1239934813300032828SoilMATRRPSTKSNGSIVQETLHVIASRDPVHLRALEFLFNDAAESLSVQDLRIQPLIATHRNPISAEPFLLPKERFGGSQDLAMVPLIRKVVDETFRAYAATSPHLLQYMGKTPISPYGSMGLSVARWGQVDWDYVRDLDWRIYLPPEIGH
Ga0335070_1070430613300032829SoilMVTRQPSAKYNGSIVQETVLAAFSRNSGLPEALEMIFPNAAEGLSFQGLRIQPSIAAHRNLDSEEPFLLPQERFGGSQDVALVPLVRHVVDEALRAYARGSPHLLNYVGKTPISPYGSMGLSVSRWGQVDWDYIRDLDWRIFLPP
Ga0335083_1076064413300032954SoilMATRRPSTKSNGSIVQETLHVIASRDPVHLRALEFLFNDAAESLSVQDLRIQPLIATHRNPISAEPFLLPKERFGGSQDLAMVPLIRKVVDETLRAYAATSPHLLQYMGKTPISPYGSMGLSVARWGQVDWD
Ga0326728_1036588313300033402Peat SoilMDTRQPSTESQGSIVEETLRAFLSRNPNLAGALEFLFPNPAEGLSIQSLRIPPFVAEHRNLVSAEPFLLPQERFGGSQDVALVPLVRDVVDETLRAYAYTSPHLLEYVGKTPISSYGSMGLSVSRWGQVDWDYIRDLDWRIFLPAEIGHRS
Ga0326727_1011251413300033405Peat SoilMVTRQASAKSKGSIVEVTLRAILSRNPIPPGALRFLFPNAAEGLSFQALRIQPLVAEHRNLVSAEPFLLPKERFGGSQDVAMLPLVRSVVDETLRAFASTSPHLLEYVGKTPISPYGSLGLSVHRWGQVDWDYIRDMDWRIFL
Ga0326727_1079208413300033405Peat SoilMVTRKASAKSKRSIVEETLRAVFSGNPAVPRVLEFLFPNPAESLSFQGLRIQSLVAAHRNLVSAEPFLLPQERFGGSQDLALLPLVRNTVDETLRAYASTSPHLMEYVGKTPISPYGSLGLSVHRWGQVDWDYIRDMDWRIFLPPELGHLSGFKSHLEQVLTEELHKYGLYPLL
Ga0314861_0508702_1_4683300033977PeatlandMVTRQPSAKSNASIAEETLRVIFSRNRILPGALEFLFQNAAESLSFQGLRIQPLVATHCNPISAEPFLLPKERFGGSQDLAMVPLVRNAVDETLRAFSATSPHLLEHVGKTPISPYGSMGLSVSRWGQVDWDYIRDMDWRIFLPPEIGHHSGFKSE
Ga0371487_0158719_3_4763300033982Peat SoilMLTRPPSVKSNASIEQQTLRALCSRNPHIAGALDFLFANAAESPSFQELRVQPRVGAHRNLVSDEPFLMPKERSGGSQDIALIPFMRTVVDETLRAYSATSPHLLEYVGKTPISPYGSLGLSANRWGLVDWDYIRDLDWRIFLPPEIGHRAGFKSLLE
Ga0371488_0288550_1_4713300033983Peat SoilMDTRQPSTESQGSIVEETLRAFLSRNPNLAGALEFLFPNPAEGLSIQSLRIPPFVAEHRNLVSAEPFLLPQERFGGSQDVALVPLVRDVVDETLRAYAYTSPHLLEYVGKTPISSYGSMGLSVSRWGRVDWDYIRDLDWRIFLPPEVGHLSGFKSEL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.