| Basic Information | |
|---|---|
| Family ID | F087194 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MTLDEYKQMVEAQRLASLAIALEALTKSNAIAKEMNK |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 95.45 % |
| % of genes near scaffold ends (potentially truncated) | 5.45 % |
| % of genes from short scaffolds (< 2000 bps) | 58.18 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (13.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13640 | 2OG-FeII_Oxy_3 | 7.27 |
| PF06067 | DUF932 | 6.36 |
| PF11397 | GlcNAc | 1.82 |
| PF01464 | SLT | 1.82 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF04572 | Gb3_synth | 0.91 |
| PF02511 | Thy1 | 0.91 |
| PF01391 | Collagen | 0.91 |
| PF03567 | Sulfotransfer_2 | 0.91 |
| PF04860 | Phage_portal | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199788704 | All Organisms → Viruses → Predicted Viral | 2206 | Open in IMG/M |
| 3300000756|JGI12421J11937_10098945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300001255|B570J13889_100677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
| 3300001266|B570J13884_100019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19396 | Open in IMG/M |
| 3300001282|B570J14230_10016363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2757 | Open in IMG/M |
| 3300001282|B570J14230_10074883 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300001848|RCM47_1108694 | Not Available | 610 | Open in IMG/M |
| 3300002835|B570J40625_100147658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2696 | Open in IMG/M |
| 3300004792|Ga0007761_11220709 | Not Available | 780 | Open in IMG/M |
| 3300005517|Ga0070374_10034827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2605 | Open in IMG/M |
| 3300005585|Ga0049084_10045449 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
| 3300005662|Ga0078894_10007767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8342 | Open in IMG/M |
| 3300005662|Ga0078894_10009670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7543 | Open in IMG/M |
| 3300005662|Ga0078894_10046767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3650 | Open in IMG/M |
| 3300005662|Ga0078894_10464445 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
| 3300005662|Ga0078894_10537543 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300005662|Ga0078894_10965586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300005941|Ga0070743_10139566 | Not Available | 806 | Open in IMG/M |
| 3300006484|Ga0070744_10013004 | All Organisms → Viruses → Predicted Viral | 2469 | Open in IMG/M |
| 3300006484|Ga0070744_10080614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300006484|Ga0070744_10145745 | Not Available | 679 | Open in IMG/M |
| 3300006641|Ga0075471_10072734 | Not Available | 1877 | Open in IMG/M |
| 3300007555|Ga0102817_1085640 | Not Available | 691 | Open in IMG/M |
| 3300007708|Ga0102859_1079678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300007708|Ga0102859_1091780 | Not Available | 870 | Open in IMG/M |
| 3300008055|Ga0108970_11070117 | Not Available | 874 | Open in IMG/M |
| 3300008107|Ga0114340_1080435 | Not Available | 1348 | Open in IMG/M |
| 3300008119|Ga0114354_1258910 | Not Available | 552 | Open in IMG/M |
| 3300008996|Ga0102831_1017541 | All Organisms → Viruses → Predicted Viral | 2465 | Open in IMG/M |
| 3300009079|Ga0102814_10308161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300009152|Ga0114980_10000254 | All Organisms → Viruses | 37749 | Open in IMG/M |
| 3300009158|Ga0114977_10323423 | Not Available | 874 | Open in IMG/M |
| 3300009159|Ga0114978_10872624 | Not Available | 503 | Open in IMG/M |
| 3300009164|Ga0114975_10060151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2227 | Open in IMG/M |
| 3300009180|Ga0114979_10186551 | Not Available | 1261 | Open in IMG/M |
| 3300009183|Ga0114974_10002650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13751 | Open in IMG/M |
| 3300009183|Ga0114974_10044765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2990 | Open in IMG/M |
| 3300009419|Ga0114982_1048511 | All Organisms → Viruses → Predicted Viral | 1343 | Open in IMG/M |
| 3300009419|Ga0114982_1100252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
| 3300010885|Ga0133913_10059398 | All Organisms → Viruses | 10257 | Open in IMG/M |
| 3300011268|Ga0151620_1039062 | All Organisms → Viruses → Predicted Viral | 1592 | Open in IMG/M |
| 3300011268|Ga0151620_1042810 | Not Available | 1510 | Open in IMG/M |
| 3300012667|Ga0157208_10004847 | Not Available | 2202 | Open in IMG/M |
| 3300012770|Ga0138291_1123459 | Not Available | 517 | Open in IMG/M |
| 3300013006|Ga0164294_10085202 | All Organisms → Viruses → Predicted Viral | 2367 | Open in IMG/M |
| 3300013006|Ga0164294_10258470 | Not Available | 1217 | Open in IMG/M |
| 3300013372|Ga0177922_10043139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12472 | Open in IMG/M |
| 3300014960|Ga0134316_1017367 | Not Available | 787 | Open in IMG/M |
| 3300019784|Ga0181359_1226533 | Not Available | 584 | Open in IMG/M |
| 3300020048|Ga0207193_1140068 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
| 3300020048|Ga0207193_1501200 | Not Available | 805 | Open in IMG/M |
| 3300020141|Ga0211732_1175929 | Not Available | 9869 | Open in IMG/M |
| 3300020141|Ga0211732_1202750 | Not Available | 9661 | Open in IMG/M |
| 3300020141|Ga0211732_1246415 | Not Available | 3514 | Open in IMG/M |
| 3300020141|Ga0211732_1567859 | Not Available | 18827 | Open in IMG/M |
| 3300020159|Ga0211734_10431979 | Not Available | 654 | Open in IMG/M |
| 3300020159|Ga0211734_11124984 | Not Available | 1040 | Open in IMG/M |
| 3300020480|Ga0208201_105246 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300020494|Ga0208326_100011 | Not Available | 9440 | Open in IMG/M |
| 3300020513|Ga0208090_1018302 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300020531|Ga0208487_1015282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300020541|Ga0208359_1000136 | Not Available | 14971 | Open in IMG/M |
| 3300020541|Ga0208359_1022633 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300020549|Ga0207942_1044867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300021519|Ga0194048_10000420 | Not Available | 20590 | Open in IMG/M |
| 3300021519|Ga0194048_10107997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300021519|Ga0194048_10120817 | Not Available | 998 | Open in IMG/M |
| 3300021600|Ga0194059_1042868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1503 | Open in IMG/M |
| 3300021961|Ga0222714_10110263 | All Organisms → Viruses → Predicted Viral | 1720 | Open in IMG/M |
| 3300021961|Ga0222714_10273425 | Not Available | 937 | Open in IMG/M |
| 3300021962|Ga0222713_10124862 | Not Available | 1810 | Open in IMG/M |
| 3300021963|Ga0222712_10045724 | Not Available | 3312 | Open in IMG/M |
| 3300021963|Ga0222712_10390613 | Not Available | 848 | Open in IMG/M |
| 3300021963|Ga0222712_10551096 | Not Available | 673 | Open in IMG/M |
| 3300021963|Ga0222712_10665836 | Not Available | 591 | Open in IMG/M |
| 3300022752|Ga0214917_10132095 | Not Available | 1362 | Open in IMG/M |
| 3300022752|Ga0214917_10287433 | Not Available | 740 | Open in IMG/M |
| 3300023174|Ga0214921_10002176 | Not Available | 32260 | Open in IMG/M |
| 3300024343|Ga0244777_10000371 | Not Available | 35978 | Open in IMG/M |
| 3300024346|Ga0244775_10014706 | Not Available | 7289 | Open in IMG/M |
| 3300024346|Ga0244775_10069780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3015 | Open in IMG/M |
| 3300024346|Ga0244775_10133916 | All Organisms → Viruses → Predicted Viral | 2096 | Open in IMG/M |
| 3300024346|Ga0244775_10150564 | All Organisms → Viruses → Predicted Viral | 1964 | Open in IMG/M |
| 3300024348|Ga0244776_10004426 | Not Available | 13214 | Open in IMG/M |
| 3300025872|Ga0208783_10181404 | Not Available | 880 | Open in IMG/M |
| 3300027185|Ga0208672_1006174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1270 | Open in IMG/M |
| 3300027418|Ga0208022_1044132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300027644|Ga0209356_1000332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18516 | Open in IMG/M |
| 3300027644|Ga0209356_1104226 | Not Available | 825 | Open in IMG/M |
| 3300027649|Ga0208960_1055008 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300027733|Ga0209297_1038865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2189 | Open in IMG/M |
| 3300027733|Ga0209297_1098801 | Not Available | 1253 | Open in IMG/M |
| 3300027759|Ga0209296_1002329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13728 | Open in IMG/M |
| 3300027759|Ga0209296_1009333 | Not Available | 5956 | Open in IMG/M |
| 3300027759|Ga0209296_1324586 | Not Available | 602 | Open in IMG/M |
| 3300027763|Ga0209088_10000029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 114777 | Open in IMG/M |
| 3300027769|Ga0209770_10038661 | All Organisms → Viruses → Predicted Viral | 2055 | Open in IMG/M |
| 3300027805|Ga0209229_10005204 | Not Available | 5438 | Open in IMG/M |
| 3300027892|Ga0209550_10550253 | Not Available | 685 | Open in IMG/M |
| 3300028025|Ga0247723_1001253 | Not Available | 15197 | Open in IMG/M |
| 3300028025|Ga0247723_1002291 | Not Available | 10322 | Open in IMG/M |
| 3300028178|Ga0265593_1047020 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1249 | Open in IMG/M |
| 3300029687|Ga0265602_1051364 | Not Available | 534 | Open in IMG/M |
| 3300033557|Ga0316617_100094700 | All Organisms → Viruses → Predicted Viral | 2080 | Open in IMG/M |
| 3300034063|Ga0335000_0608240 | Not Available | 613 | Open in IMG/M |
| 3300034066|Ga0335019_0040027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3228 | Open in IMG/M |
| 3300034106|Ga0335036_0620887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300034111|Ga0335063_0008453 | Not Available | 6598 | Open in IMG/M |
| 3300034117|Ga0335033_0236640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300034283|Ga0335007_0001172 | Not Available | 20289 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 11.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.18% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 7.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.36% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.36% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.64% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.82% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.82% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.82% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.82% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.82% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.91% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.91% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.91% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.91% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001255 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001266 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027185 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300029687 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2199948563 | 2199352004 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALRKSDTIAKEMNK |
| JGI12421J11937_100989453 | 3300000756 | Freshwater And Sediment | MKLDEYKQMVEAQRLASLGKGLEALMKSKAIQEKMKEENK* |
| B570J13889_1006773 | 3300001255 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALRKSDAIAKEMNK* |
| B570J13884_10001924 | 3300001266 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALRKSDTIAKEMNK* |
| B570J14230_100163633 | 3300001282 | Freshwater | MNLDEYKQMVEAQRLASLAIALEALTKSEAIAKEMNK* |
| B570J14230_100748832 | 3300001282 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALTKSKAISEEMNK* |
| RCM47_11086942 | 3300001848 | Marine Plankton | MNLDEFKQYVEAQRLSSLAVALEALTKSQAIQKKEGSK* |
| B570J40625_1001476586 | 3300002835 | Freshwater | MKLDEYKQMVEAQRLASLGLALEALMKSKAIQEQMKEGNK* |
| Ga0007761_112207091 | 3300004792 | Freshwater Lake | MTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDKMKEGK* |
| Ga0070374_100348275 | 3300005517 | Freshwater Lake | MNLEEYKQHVEAQRLASLAIALDALTKSNAIAKEMNK* |
| Ga0049084_100454494 | 3300005585 | Freshwater Lentic | MNLDEYKEMVEAQRLASLAIALEALTKSNAIAKEMNK* |
| Ga0078894_100077673 | 3300005662 | Freshwater Lake | MTLDEYKQMVEAQRLASLAIALEALTKSEAIAKEMNK* |
| Ga0078894_100096704 | 3300005662 | Freshwater Lake | MTLDEYKQMVEAQRLASLAIALEALTKSNAIAKEMNK* |
| Ga0078894_100467672 | 3300005662 | Freshwater Lake | MTLEEYKQMVEAQRLASLSVALEALTKSEAIAKEMNK* |
| Ga0078894_104644454 | 3300005662 | Freshwater Lake | MTLDEYKQLVEAQRLASLSVALEALTKSKAIAEEMNK* |
| Ga0078894_105375432 | 3300005662 | Freshwater Lake | MTLEEYKEMVEAQRLASLAIALDALTKSNAIAKEMNK* |
| Ga0078894_109655861 | 3300005662 | Freshwater Lake | MTLDEYKQMVEAQRLASLSIALEALRKSESIAKEMNK* |
| Ga0070743_101395664 | 3300005941 | Estuarine | MTLEEYKQHVEAQRLASLAIALDALTKSNAIAKEMNK* |
| Ga0070744_100130049 | 3300006484 | Estuarine | MTLDEYKQMVEAQRLASLSIALEALTKSEAIAKEMNK* |
| Ga0070744_100806142 | 3300006484 | Estuarine | MTLDEYKQMVEAQRLASLSVALEALTKSKAIAEEMNK* |
| Ga0070744_101457452 | 3300006484 | Estuarine | MTLDEYKQMVEAQRLASLAVALEALTKSNAIAKEMNK* |
| Ga0075471_100727344 | 3300006641 | Aqueous | MTLDEYKQMVEAQRLASLAIALEALTKSQAIAKEMNK* |
| Ga0102817_10856402 | 3300007555 | Estuarine | MNLDEYKQHVEAQRLASLAVALDALTKSDAIAKEMNK* |
| Ga0102859_10796784 | 3300007708 | Estuarine | MKLDEYKQMVEAQRLASLGKGLEALMKSKAIQEQMK |
| Ga0102859_10917803 | 3300007708 | Estuarine | MTLEEYKQMVEAQRLASLGIALEALMKSKAIQEQMKGDN* |
| Ga0108970_110701172 | 3300008055 | Estuary | MTLEEYKQMVEAQRLASLAVALEALTKSNAIAKEMNK* |
| Ga0114340_10804351 | 3300008107 | Freshwater, Plankton | MTLDEYKQMVEAKRLASLAIALDALRKSSAIQKDMENK* |
| Ga0114354_12589102 | 3300008119 | Freshwater, Plankton | MTLDEYKQMVEAQRLASLSIALEALTKSKAIAEEMNK* |
| Ga0102831_10175416 | 3300008996 | Estuarine | MNLEEYKQHVEAQRLASLAIALDALTKSNDIAKEMNK* |
| Ga0102814_103081612 | 3300009079 | Estuarine | MNLDEYKQMVEAQRLASLAIALEALRKSDTIAKEMNK* |
| Ga0114980_1000025468 | 3300009152 | Freshwater Lake | MTLDEYKQMVEAQRLASLSVALEALTKSDAIAKEMNK* |
| Ga0114977_103234232 | 3300009158 | Freshwater Lake | MTLDEYKQMVEAQRLSSLAIAMDALRKSKAIQELESEKNK* |
| Ga0114978_108726242 | 3300009159 | Freshwater Lake | MTLDEYKDMVEAQRLASLAVALDALTKSNTIAKEMNK* |
| Ga0114975_100601512 | 3300009164 | Freshwater Lake | MNLEEYKQYVEAQRLSSLAIALDALRKSNAIQELESEKNK* |
| Ga0114979_101865511 | 3300009180 | Freshwater Lake | MTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDQMKEGK* |
| Ga0114974_1000265015 | 3300009183 | Freshwater Lake | MTLEEYKQYVEAQRLSSLAIALEALTKSKAIQEQQGVK* |
| Ga0114974_100447653 | 3300009183 | Freshwater Lake | MTLDEYKQMVEAQRLSSLAIAMDALRKSKTIQELESEKNK* |
| Ga0114982_10485113 | 3300009419 | Deep Subsurface | MTLDEYKLMVEAQRLASLAIALEALTKSEAIAKEMNK* |
| Ga0114982_11002522 | 3300009419 | Deep Subsurface | MTLDEYKQYIEAQRLSSLAIALEALTKSKSLQERESK* |
| Ga0133913_1005939815 | 3300010885 | Freshwater Lake | MTLDEYKQMVEAQRLASLSVALEALTKSDAIDKEMNK* |
| Ga0151620_10390622 | 3300011268 | Freshwater | MTLDEYKQMVEAQRLASLSVALEALRKSESIAKEMNK* |
| Ga0151620_10428104 | 3300011268 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALTKSESIAKEMNK* |
| Ga0157208_100048473 | 3300012667 | Freshwater | MTLEEYKQMVEAQRLASLAIALDALRKSDAIAKEMNK* |
| Ga0138291_11234591 | 3300012770 | Freshwater Lake | QIMTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDKMKEGK* |
| Ga0164294_100852022 | 3300013006 | Freshwater | MNLEEYKQYVEAQRLSSLGIALEALMKSSAMQKEMESK* |
| Ga0164294_102584703 | 3300013006 | Freshwater | MNLEEYKQYVEAQRLSSLGIALEALMKSSAMQKEMENN* |
| Ga0177922_1004313920 | 3300013372 | Freshwater | MNLDEYKEMVEAQRLASLAIALEALTKSEAIAKEMNK* |
| Ga0134316_10173673 | 3300014960 | Surface Water | MNLEEYKQYVEAQRLSSLAIALEALTKSKALQEKENN* |
| Ga0181359_12265331 | 3300019784 | Freshwater Lake | MTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDKMKEGK |
| Ga0207193_11400682 | 3300020048 | Freshwater Lake Sediment | MTLDEYKQMVEAQRLASLSIALEALRKSESIAKEMNK |
| Ga0207193_15012001 | 3300020048 | Freshwater Lake Sediment | MTLDEYKDMVEAQRLASLAVALDALTKSNAIAKEMNK |
| Ga0211732_11759295 | 3300020141 | Freshwater | MNLEEYKQMVEAQRLASLAIALEALNKSAAIAKEMNK |
| Ga0211732_120275026 | 3300020141 | Freshwater | MTLEEYKQMVEAQRLASLGIALEALMKSKAIQEKMKEAK |
| Ga0211732_124641514 | 3300020141 | Freshwater | MNLDEYKQMVEAQRLASLGIALEALMKSKAIQEKMKEENK |
| Ga0211732_156785935 | 3300020141 | Freshwater | MTLDEYKQLVEAQRLTSLAIALDALRKSSAMQKEMEK |
| Ga0211734_104319792 | 3300020159 | Freshwater | MTLDEYKQMVEAQRLTSLAIALDALRKSSAMQKEMEK |
| Ga0211734_111249841 | 3300020159 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALTKSNAIAKEMNK |
| Ga0208201_1052464 | 3300020480 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALRKSDAIAKEMNK |
| Ga0208326_1000113 | 3300020494 | Freshwater | MNLDEYKQMVEAQRLASLAIALEALTKSEAIAKEMNK |
| Ga0208090_10183023 | 3300020513 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALTKSKAISEEMNK |
| Ga0208487_10152823 | 3300020531 | Freshwater | MKLDEYKQMVEAQRLASLGLALEALMKSKAIQEQMKEGNK |
| Ga0208359_10001368 | 3300020541 | Freshwater | MTLDEYKQMVEAQRLASLSIALEALTKSKAIAEEMNK |
| Ga0208359_10226332 | 3300020541 | Freshwater | MTLDEYKQMVEAQRLASLSVALEALTKSKAIAEEMNK |
| Ga0207942_10448671 | 3300020549 | Freshwater | MTLDEYKQMVEAQRLASLGLALEALMKSKAIQEQMKEGNK |
| Ga0194048_1000042049 | 3300021519 | Anoxic Zone Freshwater | MTLDEYKKYVEAQRLSSLGLALEALTKSKSMQESENK |
| Ga0194048_101079972 | 3300021519 | Anoxic Zone Freshwater | MTLDEYKQYVEAQRLSSLGLALEALTKSKAIQESENK |
| Ga0194048_101208172 | 3300021519 | Anoxic Zone Freshwater | MTLDEYKQYVEAQRLTSLAIAMEALRKSSAMQAVENE |
| Ga0194059_10428682 | 3300021600 | Anoxic Zone Freshwater | MTLDEYKQLIEAQRLSSLGLALEALTKSKAMQESENK |
| Ga0222714_101102635 | 3300021961 | Estuarine Water | MTLDEYKQMVEAQRLASLAIALEALTKSEAIAKEMNK |
| Ga0222714_102734252 | 3300021961 | Estuarine Water | MTLDEYKQMVEAQRLASLSVALEALTKSEAIAKEMNK |
| Ga0222713_101248625 | 3300021962 | Estuarine Water | MTLDEYKQMVEAQRLASLSVALEALRKSESIAKEMNK |
| Ga0222712_1004572412 | 3300021963 | Estuarine Water | MTLEEYKQMVEAQRLASLGKGLEALMKSKAIQDQMKEGK |
| Ga0222712_103906133 | 3300021963 | Estuarine Water | MNLEEYKQMVEAQRLSSLAIALEALTKSKAIQEKEGK |
| Ga0222712_105510963 | 3300021963 | Estuarine Water | MNLDEYKEMVEAQRLASLSVALEALTKSKAISEEMNK |
| Ga0222712_106658361 | 3300021963 | Estuarine Water | MTLDEYKQMVEAQRLASLAIALEALTKSETIAKEMNK |
| Ga0214917_101320954 | 3300022752 | Freshwater | MTLDEYKQMVEAQRLASLSIALEALTKSQAIAKEMNK |
| Ga0214917_102874332 | 3300022752 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALTKSQAIAKEMNK |
| Ga0214921_1000217617 | 3300023174 | Freshwater | MKLDEYKQMVEAQRLSSLAIAMDALRKSKAIQELESEKNK |
| Ga0244777_1000037142 | 3300024343 | Estuarine | MKLDEYKQMVEAQRLASLGKGLEALMKSKAIQEKMKEENK |
| Ga0244775_1001470624 | 3300024346 | Estuarine | MTLDEYKQMVEAQRLASLSIALEALTKSEAIAKEMNK |
| Ga0244775_1006978010 | 3300024346 | Estuarine | MKLDEYKQMVEAQRLASLGKGLEALMKSKAIQEQMKEGNK |
| Ga0244775_101339169 | 3300024346 | Estuarine | MTLEEYKQHVEAQRLASLAIALDALTKSNAIAKEMNK |
| Ga0244775_101505641 | 3300024346 | Estuarine | MTLDEYKQMVEAQRLASLAIALEALTKSDAIAKEMNK |
| Ga0244776_1000442623 | 3300024348 | Estuarine | MTLDEYKQMVEAQRLASLAVALEALTKSNAIAKEMNK |
| Ga0208783_101814042 | 3300025872 | Aqueous | MTLDEYKQLVEAQRLASLSVALEALTKSKAIAEEMNK |
| Ga0208672_10061745 | 3300027185 | Estuarine | LDEYKQMVEAQRLASLGKGLEALMKSKAIQEKMKEENK |
| Ga0208022_10441323 | 3300027418 | Estuarine | MTLEEYKQHVEAQRLASLAIALDALIKSNAIAKEMNK |
| Ga0209356_100033254 | 3300027644 | Freshwater Lake | MNLEEYKQHVEAQRLASLAIALDALTKSNAIAKEMNK |
| Ga0209356_11042263 | 3300027644 | Freshwater Lake | MNLDEYKQHVEAQRLASLAVALDALTKSNAIAKEMNK |
| Ga0208960_10550083 | 3300027649 | Freshwater Lentic | MNLDEYKEMVEAQRLASLAIALEALTKSNAIAKEMNK |
| Ga0209297_10388652 | 3300027733 | Freshwater Lake | MTLDEYKQMVEAQRLSSLAIAMDALRKSKAIQELESEKNK |
| Ga0209297_10988015 | 3300027733 | Freshwater Lake | MTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDQMKEGK |
| Ga0209296_100232915 | 3300027759 | Freshwater Lake | MTLEEYKQYVEAQRLSSLAIALEALTKSKAIQEQQGVK |
| Ga0209296_100933325 | 3300027759 | Freshwater Lake | MNLEEYKQYVEAQRLSSLAIALDALRKSNAIQELESEKNK |
| Ga0209296_13245861 | 3300027759 | Freshwater Lake | MTLDEYKQMVEAQRLSSLAIAMDALRKSKTIQELESEKNK |
| Ga0209088_10000029122 | 3300027763 | Freshwater Lake | MTLDEYKQMVEAQRLASLSVALEALTKSDAIAKEMNK |
| Ga0209770_100386619 | 3300027769 | Freshwater Lake | MTLEEYKEMVEAQRLASLAIALDALTKSNAIAKEMNK |
| Ga0209229_100052042 | 3300027805 | Freshwater And Sediment | MTLDEYKQMVDAQRLASLAIALEALTKSEAIAKEMNK |
| Ga0209550_105502531 | 3300027892 | Freshwater Lake | LDEYKQMVEAQRLASLSVALEALRKSESIAKEMNK |
| Ga0247723_10012538 | 3300028025 | Deep Subsurface Sediment | MTLDEYKQYIEAQRLSSLAIALEALTKSKSLQERESK |
| Ga0247723_10022913 | 3300028025 | Deep Subsurface Sediment | MNLDEYKQMVEAQRLASLGKGLEALMKSKAIQEKMKEENK |
| Ga0265593_10470203 | 3300028178 | Saline Water | MNIDEYKQYVEAQRLSSLGIALEALMKSSAMQKEMENK |
| Ga0265602_10513642 | 3300029687 | Marine | MNLDEYKQLVEAQRLASLAVALEALTKSNDIAKEMNK |
| Ga0316617_1000947001 | 3300033557 | Soil | MNLEEYKQYVEAQRLSSLAIALDALRKSSHIQKEMQKEMENK |
| Ga0335000_0608240_325_447 | 3300034063 | Freshwater | MNLDEYKQMVEAQRLSSLGKGLEALMKSKAIQEKMKEENK |
| Ga0335019_0040027_2951_3064 | 3300034066 | Freshwater | MTLDEYKQMVEAQRLASLAIALEALSKSSAIAKEMNK |
| Ga0335036_0620887_140_253 | 3300034106 | Freshwater | MTLDEYKQYVEAQRLSSLAIALEALTKSKAIQERESK |
| Ga0335063_0008453_4539_4652 | 3300034111 | Freshwater | MTLDEYKQMVEAQRLASLSIALEALNKSKAIAEEMNK |
| Ga0335033_0236640_2_112 | 3300034117 | Freshwater | MKLDEYKQMVEAQRLASLGLALEALMKSKAIQEQMKE |
| Ga0335007_0001172_5329_5448 | 3300034283 | Freshwater | MTLEEYKQMVEAQRLASLGKGLEALLKSKAIQEQMKEGK |
| ⦗Top⦘ |