Metagenome / Metatranscriptome Family F087194

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F087194
Family Type	Metagenome / Metatranscriptome
Number of Sequences	110
Average Sequence Length	38 residues
Representative Sequence	MTLDEYKQMVEAQRLASLAIALEALTKSNAIAKEMNK
Number of Associated Samples	76
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	95.45 %
% of genes near scaffold ends (potentially truncated)	5.45 %
% of genes from short scaffolds (< 2000 bps)	58.18 %
Associated GOLD sequencing projects	69
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (50.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (13.636 % of family members)
Environment Ontology (ENVO)	Unclassified (53.636 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (60.000 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.53
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF13640	2OG-FeII_Oxy_3	7.27
PF06067	DUF932	6.36
PF11397	GlcNAc	1.82
PF01464	SLT	1.82
PF08241	Methyltransf_11	0.91
PF04572	Gb3_synth	0.91
PF02511	Thy1	0.91
PF01391	Collagen	0.91
PF03567	Sulfotransfer_2	0.91
PF04860	Phage_portal	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG1351	Thymidylate synthase ThyX, FAD-dependent family	Nucleotide transport and metabolism [F]	0.91

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Viruses	superkingdom	All Organisms → Viruses	48.18 %
cellular organisms	root	All Organisms → cellular organisms	1.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	27.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.82 %
unclassified viruses	clade	All Organisms → Viruses → unclassified viruses	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	27.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.82 %
unclassified DNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	27.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.82 %
unclassified dsDNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	27.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.82 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	25.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	1.82 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.91 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	25.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Aphanizomenonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae	1.82 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.91 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	25.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Aphanizomenon	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon	1.82 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.91 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	25.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Aphanizomenon flos-aquae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae	1.82 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.91 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	25.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.18 %
Aphanizomenon flos-aquae WA102	isolate	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	1.82 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.91 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2199352004\|2199788704	All Organisms → Viruses → Predicted Viral	2206	Open in IMG/M
3300000756\|JGI12421J11937_10098945	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	801	Open in IMG/M
3300001255\|B570J13889_100677	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	841	Open in IMG/M
3300001266\|B570J13884_100019	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19396	Open in IMG/M
3300001282\|B570J14230_10016363	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2757	Open in IMG/M
3300001282\|B570J14230_10074883	All Organisms → Viruses → Predicted Viral	1061	Open in IMG/M
3300001848\|RCM47_1108694	Not Available	610	Open in IMG/M
3300002835\|B570J40625_100147658	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2696	Open in IMG/M
3300004792\|Ga0007761_11220709	Not Available	780	Open in IMG/M
3300005517\|Ga0070374_10034827	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2605	Open in IMG/M
3300005585\|Ga0049084_10045449	All Organisms → Viruses → Predicted Viral	1668	Open in IMG/M
3300005662\|Ga0078894_10007767	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8342	Open in IMG/M
3300005662\|Ga0078894_10009670	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7543	Open in IMG/M
3300005662\|Ga0078894_10046767	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	3650	Open in IMG/M
3300005662\|Ga0078894_10464445	All Organisms → Viruses → Predicted Viral	1139	Open in IMG/M
3300005662\|Ga0078894_10537543	All Organisms → Viruses → Predicted Viral	1046	Open in IMG/M
3300005662\|Ga0078894_10965586	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	735	Open in IMG/M
3300005941\|Ga0070743_10139566	Not Available	806	Open in IMG/M
3300006484\|Ga0070744_10013004	All Organisms → Viruses → Predicted Viral	2469	Open in IMG/M
3300006484\|Ga0070744_10080614	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	943	Open in IMG/M
3300006484\|Ga0070744_10145745	Not Available	679	Open in IMG/M
3300006641\|Ga0075471_10072734	Not Available	1877	Open in IMG/M
3300007555\|Ga0102817_1085640	Not Available	691	Open in IMG/M
3300007708\|Ga0102859_1079678	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	931	Open in IMG/M
3300007708\|Ga0102859_1091780	Not Available	870	Open in IMG/M
3300008055\|Ga0108970_11070117	Not Available	874	Open in IMG/M
3300008107\|Ga0114340_1080435	Not Available	1348	Open in IMG/M
3300008119\|Ga0114354_1258910	Not Available	552	Open in IMG/M
3300008996\|Ga0102831_1017541	All Organisms → Viruses → Predicted Viral	2465	Open in IMG/M
3300009079\|Ga0102814_10308161	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	861	Open in IMG/M
3300009152\|Ga0114980_10000254	All Organisms → Viruses	37749	Open in IMG/M
3300009158\|Ga0114977_10323423	Not Available	874	Open in IMG/M
3300009159\|Ga0114978_10872624	Not Available	503	Open in IMG/M
3300009164\|Ga0114975_10060151	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	2227	Open in IMG/M
3300009180\|Ga0114979_10186551	Not Available	1261	Open in IMG/M
3300009183\|Ga0114974_10002650	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13751	Open in IMG/M
3300009183\|Ga0114974_10044765	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2990	Open in IMG/M
3300009419\|Ga0114982_1048511	All Organisms → Viruses → Predicted Viral	1343	Open in IMG/M
3300009419\|Ga0114982_1100252	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	895	Open in IMG/M
3300010885\|Ga0133913_10059398	All Organisms → Viruses	10257	Open in IMG/M
3300011268\|Ga0151620_1039062	All Organisms → Viruses → Predicted Viral	1592	Open in IMG/M
3300011268\|Ga0151620_1042810	Not Available	1510	Open in IMG/M
3300012667\|Ga0157208_10004847	Not Available	2202	Open in IMG/M
3300012770\|Ga0138291_1123459	Not Available	517	Open in IMG/M
3300013006\|Ga0164294_10085202	All Organisms → Viruses → Predicted Viral	2367	Open in IMG/M
3300013006\|Ga0164294_10258470	Not Available	1217	Open in IMG/M
3300013372\|Ga0177922_10043139	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12472	Open in IMG/M
3300014960\|Ga0134316_1017367	Not Available	787	Open in IMG/M
3300019784\|Ga0181359_1226533	Not Available	584	Open in IMG/M
3300020048\|Ga0207193_1140068	All Organisms → Viruses → Predicted Viral	2061	Open in IMG/M
3300020048\|Ga0207193_1501200	Not Available	805	Open in IMG/M
3300020141\|Ga0211732_1175929	Not Available	9869	Open in IMG/M
3300020141\|Ga0211732_1202750	Not Available	9661	Open in IMG/M
3300020141\|Ga0211732_1246415	Not Available	3514	Open in IMG/M
3300020141\|Ga0211732_1567859	Not Available	18827	Open in IMG/M
3300020159\|Ga0211734_10431979	Not Available	654	Open in IMG/M
3300020159\|Ga0211734_11124984	Not Available	1040	Open in IMG/M
3300020480\|Ga0208201_105246	All Organisms → Viruses → Predicted Viral	1068	Open in IMG/M
3300020494\|Ga0208326_100011	Not Available	9440	Open in IMG/M
3300020513\|Ga0208090_1018302	All Organisms → Viruses → Predicted Viral	1038	Open in IMG/M
3300020531\|Ga0208487_1015282	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	965	Open in IMG/M
3300020541\|Ga0208359_1000136	Not Available	14971	Open in IMG/M
3300020541\|Ga0208359_1022633	All Organisms → Viruses → Predicted Viral	1014	Open in IMG/M
3300020549\|Ga0207942_1044867	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	546	Open in IMG/M
3300021519\|Ga0194048_10000420	Not Available	20590	Open in IMG/M
3300021519\|Ga0194048_10107997	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1067	Open in IMG/M
3300021519\|Ga0194048_10120817	Not Available	998	Open in IMG/M
3300021600\|Ga0194059_1042868	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1503	Open in IMG/M
3300021961\|Ga0222714_10110263	All Organisms → Viruses → Predicted Viral	1720	Open in IMG/M
3300021961\|Ga0222714_10273425	Not Available	937	Open in IMG/M
3300021962\|Ga0222713_10124862	Not Available	1810	Open in IMG/M
3300021963\|Ga0222712_10045724	Not Available	3312	Open in IMG/M
3300021963\|Ga0222712_10390613	Not Available	848	Open in IMG/M
3300021963\|Ga0222712_10551096	Not Available	673	Open in IMG/M
3300021963\|Ga0222712_10665836	Not Available	591	Open in IMG/M
3300022752\|Ga0214917_10132095	Not Available	1362	Open in IMG/M
3300022752\|Ga0214917_10287433	Not Available	740	Open in IMG/M
3300023174\|Ga0214921_10002176	Not Available	32260	Open in IMG/M
3300024343\|Ga0244777_10000371	Not Available	35978	Open in IMG/M
3300024346\|Ga0244775_10014706	Not Available	7289	Open in IMG/M
3300024346\|Ga0244775_10069780	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3015	Open in IMG/M
3300024346\|Ga0244775_10133916	All Organisms → Viruses → Predicted Viral	2096	Open in IMG/M
3300024346\|Ga0244775_10150564	All Organisms → Viruses → Predicted Viral	1964	Open in IMG/M
3300024348\|Ga0244776_10004426	Not Available	13214	Open in IMG/M
3300025872\|Ga0208783_10181404	Not Available	880	Open in IMG/M
3300027185\|Ga0208672_1006174	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1270	Open in IMG/M
3300027418\|Ga0208022_1044132	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	995	Open in IMG/M
3300027644\|Ga0209356_1000332	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	18516	Open in IMG/M
3300027644\|Ga0209356_1104226	Not Available	825	Open in IMG/M
3300027649\|Ga0208960_1055008	All Organisms → Viruses → Predicted Viral	1246	Open in IMG/M
3300027733\|Ga0209297_1038865	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2189	Open in IMG/M
3300027733\|Ga0209297_1098801	Not Available	1253	Open in IMG/M
3300027759\|Ga0209296_1002329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13728	Open in IMG/M
3300027759\|Ga0209296_1009333	Not Available	5956	Open in IMG/M
3300027759\|Ga0209296_1324586	Not Available	602	Open in IMG/M
3300027763\|Ga0209088_10000029	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	114777	Open in IMG/M
3300027769\|Ga0209770_10038661	All Organisms → Viruses → Predicted Viral	2055	Open in IMG/M
3300027805\|Ga0209229_10005204	Not Available	5438	Open in IMG/M
3300027892\|Ga0209550_10550253	Not Available	685	Open in IMG/M
3300028025\|Ga0247723_1001253	Not Available	15197	Open in IMG/M
3300028025\|Ga0247723_1002291	Not Available	10322	Open in IMG/M
3300028178\|Ga0265593_1047020	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1249	Open in IMG/M
3300029687\|Ga0265602_1051364	Not Available	534	Open in IMG/M
3300033557\|Ga0316617_100094700	All Organisms → Viruses → Predicted Viral	2080	Open in IMG/M
3300034063\|Ga0335000_0608240	Not Available	613	Open in IMG/M
3300034066\|Ga0335019_0040027	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3228	Open in IMG/M
3300034106\|Ga0335036_0620887	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	653	Open in IMG/M
3300034111\|Ga0335063_0008453	Not Available	6598	Open in IMG/M
3300034117\|Ga0335033_0236640	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	966	Open in IMG/M
3300034283\|Ga0335007_0001172	Not Available	20289	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.09%
Host-Associated	Host-Associated	0.91%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.55%
Terrestrial	Environmental → Terrestrial	4.55%
Plants	Host-Associated → Plants	0.91%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	69.09%
Marine	Environmental → Aquatic → Marine	24.55%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	3.64%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.91%
Soil	Environmental → Terrestrial → Soil	0.91%
Leaf	Host-Associated → Plants → Leaf	0.91%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	37.27%
Lentic	Environmental → Aquatic → Freshwater → Lentic	27.27%
Unclassified	Environmental → Aquatic → Marine → Unclassified	13.64%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	8.18%
Lotic	Environmental → Aquatic → Freshwater → Lotic	3.64%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	3.64%
Coastal	Environmental → Aquatic → Marine → Coastal	1.82%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.91%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.91%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.91%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.91%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	35.45%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	14.55%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	13.64%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	11.82%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	8.18%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	3.64%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	3.64%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.82%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.82%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.91%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.91%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	0.91%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	13.64%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	11.82%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	11.82%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	10.00%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	8.18%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	7.27%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	6.36%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	6.36%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	3.64%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	1.82%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.82%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	1.82%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	1.82%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	1.82%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.82%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	1.82%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.91%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.91%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.91%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.91%
Surface Water	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water	0.91%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	0.91%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	0.91%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.91%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2199352004	Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion	Environmental	Open in IMG/M
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300001255	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion	Environmental	Open in IMG/M
3300001266	Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion	Environmental	Open in IMG/M
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001848	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300004792	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005941	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental	Open in IMG/M
3300007555	Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008119	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300009079	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011268	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555	Environmental	Open in IMG/M
3300012667	Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15	Environmental	Open in IMG/M
3300012770	Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014960	Surface water microbial communities from Bangladesh - BaraHaldiaSW0709	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020480	Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020494	Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020513	Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020531	Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020541	Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020549	Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021600	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300025872	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027185	Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 (SPAdes)	Environmental	Open in IMG/M
3300027418	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)	Environmental	Open in IMG/M
3300027644	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027649	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028178	Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m	Environmental	Open in IMG/M
3300029687	Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034111	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186	Environmental	Open in IMG/M
3300034117	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2199948563	2199352004	Freshwater	MTLDEYKQMVEAQRLASLAIALEALRKSDTIAKEMNK
JGI12421J11937_100989453	3300000756	Freshwater And Sediment	MKLDEYKQMVEAQRLASLGKGLEALMKSKAIQEKMKEENK*
B570J13889_1006773	3300001255	Freshwater	MTLDEYKQMVEAQRLASLAIALEALRKSDAIAKEMNK*
B570J13884_10001924	3300001266	Freshwater	MTLDEYKQMVEAQRLASLAIALEALRKSDTIAKEMNK*
B570J14230_100163633	3300001282	Freshwater	MNLDEYKQMVEAQRLASLAIALEALTKSEAIAKEMNK*
B570J14230_100748832	3300001282	Freshwater	MTLDEYKQMVEAQRLASLAIALEALTKSKAISEEMNK*
RCM47_11086942	3300001848	Marine Plankton	MNLDEFKQYVEAQRLSSLAVALEALTKSQAIQKKEGSK*
B570J40625_1001476586	3300002835	Freshwater	MKLDEYKQMVEAQRLASLGLALEALMKSKAIQEQMKEGNK*
Ga0007761_112207091	3300004792	Freshwater Lake	MTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDKMKEGK*
Ga0070374_100348275	3300005517	Freshwater Lake	MNLEEYKQHVEAQRLASLAIALDALTKSNAIAKEMNK*
Ga0049084_100454494	3300005585	Freshwater Lentic	MNLDEYKEMVEAQRLASLAIALEALTKSNAIAKEMNK*
Ga0078894_100077673	3300005662	Freshwater Lake	MTLDEYKQMVEAQRLASLAIALEALTKSEAIAKEMNK*
Ga0078894_100096704	3300005662	Freshwater Lake	MTLDEYKQMVEAQRLASLAIALEALTKSNAIAKEMNK*
Ga0078894_100467672	3300005662	Freshwater Lake	MTLEEYKQMVEAQRLASLSVALEALTKSEAIAKEMNK*
Ga0078894_104644454	3300005662	Freshwater Lake	MTLDEYKQLVEAQRLASLSVALEALTKSKAIAEEMNK*
Ga0078894_105375432	3300005662	Freshwater Lake	MTLEEYKEMVEAQRLASLAIALDALTKSNAIAKEMNK*
Ga0078894_109655861	3300005662	Freshwater Lake	MTLDEYKQMVEAQRLASLSIALEALRKSESIAKEMNK*
Ga0070743_101395664	3300005941	Estuarine	MTLEEYKQHVEAQRLASLAIALDALTKSNAIAKEMNK*
Ga0070744_100130049	3300006484	Estuarine	MTLDEYKQMVEAQRLASLSIALEALTKSEAIAKEMNK*
Ga0070744_100806142	3300006484	Estuarine	MTLDEYKQMVEAQRLASLSVALEALTKSKAIAEEMNK*
Ga0070744_101457452	3300006484	Estuarine	MTLDEYKQMVEAQRLASLAVALEALTKSNAIAKEMNK*
Ga0075471_100727344	3300006641	Aqueous	MTLDEYKQMVEAQRLASLAIALEALTKSQAIAKEMNK*
Ga0102817_10856402	3300007555	Estuarine	MNLDEYKQHVEAQRLASLAVALDALTKSDAIAKEMNK*
Ga0102859_10796784	3300007708	Estuarine	MKLDEYKQMVEAQRLASLGKGLEALMKSKAIQEQMK
Ga0102859_10917803	3300007708	Estuarine	MTLEEYKQMVEAQRLASLGIALEALMKSKAIQEQMKGDN*
Ga0108970_110701172	3300008055	Estuary	MTLEEYKQMVEAQRLASLAVALEALTKSNAIAKEMNK*
Ga0114340_10804351	3300008107	Freshwater, Plankton	MTLDEYKQMVEAKRLASLAIALDALRKSSAIQKDMENK*
Ga0114354_12589102	3300008119	Freshwater, Plankton	MTLDEYKQMVEAQRLASLSIALEALTKSKAIAEEMNK*
Ga0102831_10175416	3300008996	Estuarine	MNLEEYKQHVEAQRLASLAIALDALTKSNDIAKEMNK*
Ga0102814_103081612	3300009079	Estuarine	MNLDEYKQMVEAQRLASLAIALEALRKSDTIAKEMNK*
Ga0114980_1000025468	3300009152	Freshwater Lake	MTLDEYKQMVEAQRLASLSVALEALTKSDAIAKEMNK*
Ga0114977_103234232	3300009158	Freshwater Lake	MTLDEYKQMVEAQRLSSLAIAMDALRKSKAIQELESEKNK*
Ga0114978_108726242	3300009159	Freshwater Lake	MTLDEYKDMVEAQRLASLAVALDALTKSNTIAKEMNK*
Ga0114975_100601512	3300009164	Freshwater Lake	MNLEEYKQYVEAQRLSSLAIALDALRKSNAIQELESEKNK*
Ga0114979_101865511	3300009180	Freshwater Lake	MTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDQMKEGK*
Ga0114974_1000265015	3300009183	Freshwater Lake	MTLEEYKQYVEAQRLSSLAIALEALTKSKAIQEQQGVK*
Ga0114974_100447653	3300009183	Freshwater Lake	MTLDEYKQMVEAQRLSSLAIAMDALRKSKTIQELESEKNK*
Ga0114982_10485113	3300009419	Deep Subsurface	MTLDEYKLMVEAQRLASLAIALEALTKSEAIAKEMNK*
Ga0114982_11002522	3300009419	Deep Subsurface	MTLDEYKQYIEAQRLSSLAIALEALTKSKSLQERESK*
Ga0133913_1005939815	3300010885	Freshwater Lake	MTLDEYKQMVEAQRLASLSVALEALTKSDAIDKEMNK*
Ga0151620_10390622	3300011268	Freshwater	MTLDEYKQMVEAQRLASLSVALEALRKSESIAKEMNK*
Ga0151620_10428104	3300011268	Freshwater	MTLDEYKQMVEAQRLASLAIALEALTKSESIAKEMNK*
Ga0157208_100048473	3300012667	Freshwater	MTLEEYKQMVEAQRLASLAIALDALRKSDAIAKEMNK*
Ga0138291_11234591	3300012770	Freshwater Lake	QIMTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDKMKEGK*
Ga0164294_100852022	3300013006	Freshwater	MNLEEYKQYVEAQRLSSLGIALEALMKSSAMQKEMESK*
Ga0164294_102584703	3300013006	Freshwater	MNLEEYKQYVEAQRLSSLGIALEALMKSSAMQKEMENN*
Ga0177922_1004313920	3300013372	Freshwater	MNLDEYKEMVEAQRLASLAIALEALTKSEAIAKEMNK*
Ga0134316_10173673	3300014960	Surface Water	MNLEEYKQYVEAQRLSSLAIALEALTKSKALQEKENN*
Ga0181359_12265331	3300019784	Freshwater Lake	MTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDKMKEGK
Ga0207193_11400682	3300020048	Freshwater Lake Sediment	MTLDEYKQMVEAQRLASLSIALEALRKSESIAKEMNK
Ga0207193_15012001	3300020048	Freshwater Lake Sediment	MTLDEYKDMVEAQRLASLAVALDALTKSNAIAKEMNK
Ga0211732_11759295	3300020141	Freshwater	MNLEEYKQMVEAQRLASLAIALEALNKSAAIAKEMNK
Ga0211732_120275026	3300020141	Freshwater	MTLEEYKQMVEAQRLASLGIALEALMKSKAIQEKMKEAK
Ga0211732_124641514	3300020141	Freshwater	MNLDEYKQMVEAQRLASLGIALEALMKSKAIQEKMKEENK
Ga0211732_156785935	3300020141	Freshwater	MTLDEYKQLVEAQRLTSLAIALDALRKSSAMQKEMEK
Ga0211734_104319792	3300020159	Freshwater	MTLDEYKQMVEAQRLTSLAIALDALRKSSAMQKEMEK
Ga0211734_111249841	3300020159	Freshwater	MTLDEYKQMVEAQRLASLAIALEALTKSNAIAKEMNK
Ga0208201_1052464	3300020480	Freshwater	MTLDEYKQMVEAQRLASLAIALEALRKSDAIAKEMNK
Ga0208326_1000113	3300020494	Freshwater	MNLDEYKQMVEAQRLASLAIALEALTKSEAIAKEMNK
Ga0208090_10183023	3300020513	Freshwater	MTLDEYKQMVEAQRLASLAIALEALTKSKAISEEMNK
Ga0208487_10152823	3300020531	Freshwater	MKLDEYKQMVEAQRLASLGLALEALMKSKAIQEQMKEGNK
Ga0208359_10001368	3300020541	Freshwater	MTLDEYKQMVEAQRLASLSIALEALTKSKAIAEEMNK
Ga0208359_10226332	3300020541	Freshwater	MTLDEYKQMVEAQRLASLSVALEALTKSKAIAEEMNK
Ga0207942_10448671	3300020549	Freshwater	MTLDEYKQMVEAQRLASLGLALEALMKSKAIQEQMKEGNK
Ga0194048_1000042049	3300021519	Anoxic Zone Freshwater	MTLDEYKKYVEAQRLSSLGLALEALTKSKSMQESENK
Ga0194048_101079972	3300021519	Anoxic Zone Freshwater	MTLDEYKQYVEAQRLSSLGLALEALTKSKAIQESENK
Ga0194048_101208172	3300021519	Anoxic Zone Freshwater	MTLDEYKQYVEAQRLTSLAIAMEALRKSSAMQAVENE
Ga0194059_10428682	3300021600	Anoxic Zone Freshwater	MTLDEYKQLIEAQRLSSLGLALEALTKSKAMQESENK
Ga0222714_101102635	3300021961	Estuarine Water	MTLDEYKQMVEAQRLASLAIALEALTKSEAIAKEMNK
Ga0222714_102734252	3300021961	Estuarine Water	MTLDEYKQMVEAQRLASLSVALEALTKSEAIAKEMNK
Ga0222713_101248625	3300021962	Estuarine Water	MTLDEYKQMVEAQRLASLSVALEALRKSESIAKEMNK
Ga0222712_1004572412	3300021963	Estuarine Water	MTLEEYKQMVEAQRLASLGKGLEALMKSKAIQDQMKEGK
Ga0222712_103906133	3300021963	Estuarine Water	MNLEEYKQMVEAQRLSSLAIALEALTKSKAIQEKEGK
Ga0222712_105510963	3300021963	Estuarine Water	MNLDEYKEMVEAQRLASLSVALEALTKSKAISEEMNK
Ga0222712_106658361	3300021963	Estuarine Water	MTLDEYKQMVEAQRLASLAIALEALTKSETIAKEMNK
Ga0214917_101320954	3300022752	Freshwater	MTLDEYKQMVEAQRLASLSIALEALTKSQAIAKEMNK
Ga0214917_102874332	3300022752	Freshwater	MTLDEYKQMVEAQRLASLAIALEALTKSQAIAKEMNK
Ga0214921_1000217617	3300023174	Freshwater	MKLDEYKQMVEAQRLSSLAIAMDALRKSKAIQELESEKNK
Ga0244777_1000037142	3300024343	Estuarine	MKLDEYKQMVEAQRLASLGKGLEALMKSKAIQEKMKEENK
Ga0244775_1001470624	3300024346	Estuarine	MTLDEYKQMVEAQRLASLSIALEALTKSEAIAKEMNK
Ga0244775_1006978010	3300024346	Estuarine	MKLDEYKQMVEAQRLASLGKGLEALMKSKAIQEQMKEGNK
Ga0244775_101339169	3300024346	Estuarine	MTLEEYKQHVEAQRLASLAIALDALTKSNAIAKEMNK
Ga0244775_101505641	3300024346	Estuarine	MTLDEYKQMVEAQRLASLAIALEALTKSDAIAKEMNK
Ga0244776_1000442623	3300024348	Estuarine	MTLDEYKQMVEAQRLASLAVALEALTKSNAIAKEMNK
Ga0208783_101814042	3300025872	Aqueous	MTLDEYKQLVEAQRLASLSVALEALTKSKAIAEEMNK
Ga0208672_10061745	3300027185	Estuarine	LDEYKQMVEAQRLASLGKGLEALMKSKAIQEKMKEENK
Ga0208022_10441323	3300027418	Estuarine	MTLEEYKQHVEAQRLASLAIALDALIKSNAIAKEMNK
Ga0209356_100033254	3300027644	Freshwater Lake	MNLEEYKQHVEAQRLASLAIALDALTKSNAIAKEMNK
Ga0209356_11042263	3300027644	Freshwater Lake	MNLDEYKQHVEAQRLASLAVALDALTKSNAIAKEMNK
Ga0208960_10550083	3300027649	Freshwater Lentic	MNLDEYKEMVEAQRLASLAIALEALTKSNAIAKEMNK
Ga0209297_10388652	3300027733	Freshwater Lake	MTLDEYKQMVEAQRLSSLAIAMDALRKSKAIQELESEKNK
Ga0209297_10988015	3300027733	Freshwater Lake	MTLDEYKQMVEAQRLASLGKGLEALMKSKAIQDQMKEGK
Ga0209296_100232915	3300027759	Freshwater Lake	MTLEEYKQYVEAQRLSSLAIALEALTKSKAIQEQQGVK
Ga0209296_100933325	3300027759	Freshwater Lake	MNLEEYKQYVEAQRLSSLAIALDALRKSNAIQELESEKNK
Ga0209296_13245861	3300027759	Freshwater Lake	MTLDEYKQMVEAQRLSSLAIAMDALRKSKTIQELESEKNK
Ga0209088_10000029122	3300027763	Freshwater Lake	MTLDEYKQMVEAQRLASLSVALEALTKSDAIAKEMNK
Ga0209770_100386619	3300027769	Freshwater Lake	MTLEEYKEMVEAQRLASLAIALDALTKSNAIAKEMNK
Ga0209229_100052042	3300027805	Freshwater And Sediment	MTLDEYKQMVDAQRLASLAIALEALTKSEAIAKEMNK
Ga0209550_105502531	3300027892	Freshwater Lake	LDEYKQMVEAQRLASLSVALEALRKSESIAKEMNK
Ga0247723_10012538	3300028025	Deep Subsurface Sediment	MTLDEYKQYIEAQRLSSLAIALEALTKSKSLQERESK
Ga0247723_10022913	3300028025	Deep Subsurface Sediment	MNLDEYKQMVEAQRLASLGKGLEALMKSKAIQEKMKEENK
Ga0265593_10470203	3300028178	Saline Water	MNIDEYKQYVEAQRLSSLGIALEALMKSSAMQKEMENK
Ga0265602_10513642	3300029687	Marine	MNLDEYKQLVEAQRLASLAVALEALTKSNDIAKEMNK
Ga0316617_1000947001	3300033557	Soil	MNLEEYKQYVEAQRLSSLAIALDALRKSSHIQKEMQKEMENK
Ga0335000_0608240_325_447	3300034063	Freshwater	MNLDEYKQMVEAQRLSSLGKGLEALMKSKAIQEKMKEENK
Ga0335019_0040027_2951_3064	3300034066	Freshwater	MTLDEYKQMVEAQRLASLAIALEALSKSSAIAKEMNK
Ga0335036_0620887_140_253	3300034106	Freshwater	MTLDEYKQYVEAQRLSSLAIALEALTKSKAIQERESK
Ga0335063_0008453_4539_4652	3300034111	Freshwater	MTLDEYKQMVEAQRLASLSIALEALNKSKAIAEEMNK
Ga0335033_0236640_2_112	3300034117	Freshwater	MKLDEYKQMVEAQRLASLGLALEALMKSKAIQEQMKE
Ga0335007_0001172_5329_5448	3300034283	Freshwater	MTLEEYKQMVEAQRLASLGKGLEALLKSKAIQEQMKEGK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F087194

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences