| Basic Information | |
|---|---|
| Family ID | F087164 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRRRREAEADGREIAELAALADGSLAPERRAALEARVAASS |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 35.45 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.45 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.818 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.28% β-sheet: 0.00% Coil/Unstructured: 50.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00353 | HemolysinCabind | 9.09 |
| PF03640 | Lipoprotein_15 | 4.55 |
| PF03475 | 3-alpha | 1.82 |
| PF13490 | zf-HC2 | 1.82 |
| PF00535 | Glycos_transf_2 | 0.91 |
| PF03724 | META | 0.91 |
| PF00196 | GerE | 0.91 |
| PF02698 | DUF218 | 0.91 |
| PF13090 | PP_kinase_C | 0.91 |
| PF03551 | PadR | 0.91 |
| PF04828 | GFA | 0.91 |
| PF01471 | PG_binding_1 | 0.91 |
| PF13602 | ADH_zinc_N_2 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 4.55 |
| COG2258 | N-hydroxylaminopurine reductase YiiM, contains MOSC domain | Defense mechanisms [V] | 1.82 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.91 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.91 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.91 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.82 % |
| All Organisms | root | All Organisms | 38.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_11264409 | Not Available | 533 | Open in IMG/M |
| 3300000956|JGI10216J12902_101007216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1810 | Open in IMG/M |
| 3300000956|JGI10216J12902_102738902 | Not Available | 635 | Open in IMG/M |
| 3300000956|JGI10216J12902_113195966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300000956|JGI10216J12902_126448380 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300004156|Ga0062589_102164642 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300004157|Ga0062590_102018822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300004479|Ga0062595_101158330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 682 | Open in IMG/M |
| 3300005093|Ga0062594_102282160 | Not Available | 588 | Open in IMG/M |
| 3300005164|Ga0066815_10084530 | Not Available | 576 | Open in IMG/M |
| 3300005331|Ga0070670_100049667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3606 | Open in IMG/M |
| 3300005345|Ga0070692_10500822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 787 | Open in IMG/M |
| 3300005355|Ga0070671_100501857 | Not Available | 1044 | Open in IMG/M |
| 3300005355|Ga0070671_101540738 | Not Available | 589 | Open in IMG/M |
| 3300005364|Ga0070673_100584493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300005459|Ga0068867_101793531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 577 | Open in IMG/M |
| 3300005539|Ga0068853_101243531 | Not Available | 719 | Open in IMG/M |
| 3300005546|Ga0070696_101622520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 556 | Open in IMG/M |
| 3300005560|Ga0066670_10149272 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300005568|Ga0066703_10167372 | Not Available | 1325 | Open in IMG/M |
| 3300005615|Ga0070702_100003542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6996 | Open in IMG/M |
| 3300005617|Ga0068859_102123797 | Not Available | 620 | Open in IMG/M |
| 3300005937|Ga0081455_10300738 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300006574|Ga0074056_10015993 | All Organisms → cellular organisms → Bacteria | 2593 | Open in IMG/M |
| 3300006580|Ga0074049_12881226 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300006800|Ga0066660_10523273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 996 | Open in IMG/M |
| 3300006845|Ga0075421_101646233 | Not Available | 696 | Open in IMG/M |
| 3300006852|Ga0075433_10180955 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300006852|Ga0075433_11594122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia mimosarum | 563 | Open in IMG/M |
| 3300006854|Ga0075425_100829119 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300009012|Ga0066710_104184101 | Not Available | 539 | Open in IMG/M |
| 3300009090|Ga0099827_10633195 | Not Available | 923 | Open in IMG/M |
| 3300009094|Ga0111539_11966108 | Not Available | 678 | Open in IMG/M |
| 3300009098|Ga0105245_13214317 | Not Available | 506 | Open in IMG/M |
| 3300009156|Ga0111538_11477993 | Not Available | 857 | Open in IMG/M |
| 3300009174|Ga0105241_11280446 | Not Available | 697 | Open in IMG/M |
| 3300009177|Ga0105248_10595140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
| 3300010036|Ga0126305_10148383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1456 | Open in IMG/M |
| 3300010042|Ga0126314_10484096 | Not Available | 897 | Open in IMG/M |
| 3300010044|Ga0126310_11098941 | Not Available | 632 | Open in IMG/M |
| 3300010044|Ga0126310_11572968 | Not Available | 542 | Open in IMG/M |
| 3300010045|Ga0126311_10600237 | Not Available | 871 | Open in IMG/M |
| 3300010333|Ga0134080_10436861 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300010361|Ga0126378_12209774 | Not Available | 628 | Open in IMG/M |
| 3300010364|Ga0134066_10399045 | Not Available | 524 | Open in IMG/M |
| 3300010375|Ga0105239_10295496 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300010376|Ga0126381_101916895 | Not Available | 855 | Open in IMG/M |
| 3300011119|Ga0105246_10712589 | Not Available | 881 | Open in IMG/M |
| 3300012011|Ga0120152_1056645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1237 | Open in IMG/M |
| 3300012014|Ga0120159_1138055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300012209|Ga0137379_11150240 | Not Available | 682 | Open in IMG/M |
| 3300012285|Ga0137370_10833929 | Not Available | 571 | Open in IMG/M |
| 3300012350|Ga0137372_10973868 | Not Available | 594 | Open in IMG/M |
| 3300012356|Ga0137371_10786492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300012356|Ga0137371_10909588 | Not Available | 669 | Open in IMG/M |
| 3300012360|Ga0137375_10274609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1540 | Open in IMG/M |
| 3300012532|Ga0137373_10552443 | Not Available | 873 | Open in IMG/M |
| 3300012902|Ga0157291_10276740 | Not Available | 571 | Open in IMG/M |
| 3300012908|Ga0157286_10390606 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 537 | Open in IMG/M |
| 3300012916|Ga0157310_10541937 | Not Available | 515 | Open in IMG/M |
| 3300012957|Ga0164303_10643711 | Not Available | 705 | Open in IMG/M |
| 3300012984|Ga0164309_11771914 | Not Available | 530 | Open in IMG/M |
| 3300012984|Ga0164309_11873163 | Not Available | 514 | Open in IMG/M |
| 3300012986|Ga0164304_11841019 | Not Available | 506 | Open in IMG/M |
| 3300012989|Ga0164305_11263488 | Not Available | 643 | Open in IMG/M |
| 3300013096|Ga0157307_1167027 | Not Available | 523 | Open in IMG/M |
| 3300015077|Ga0173483_10171154 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300015372|Ga0132256_102625243 | Not Available | 604 | Open in IMG/M |
| 3300015373|Ga0132257_103708959 | Not Available | 556 | Open in IMG/M |
| 3300015374|Ga0132255_101179891 | Not Available | 1153 | Open in IMG/M |
| 3300016294|Ga0182041_10780757 | Not Available | 852 | Open in IMG/M |
| 3300018072|Ga0184635_10154206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
| 3300018433|Ga0066667_11325628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300018469|Ga0190270_11872594 | Not Available | 656 | Open in IMG/M |
| 3300018482|Ga0066669_10458743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1095 | Open in IMG/M |
| 3300019361|Ga0173482_10085077 | Not Available | 1115 | Open in IMG/M |
| 3300020002|Ga0193730_1141980 | Not Available | 642 | Open in IMG/M |
| 3300020002|Ga0193730_1168514 | Not Available | 563 | Open in IMG/M |
| 3300021560|Ga0126371_11291530 | Not Available | 864 | Open in IMG/M |
| 3300022756|Ga0222622_10214402 | Not Available | 1285 | Open in IMG/M |
| 3300022892|Ga0247753_1020457 | Not Available | 738 | Open in IMG/M |
| 3300023064|Ga0247801_1042656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300023263|Ga0247800_1072259 | Not Available | 663 | Open in IMG/M |
| 3300023275|Ga0247776_10231809 | Not Available | 692 | Open in IMG/M |
| 3300025901|Ga0207688_10334458 | Not Available | 931 | Open in IMG/M |
| 3300025905|Ga0207685_10102111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1228 | Open in IMG/M |
| 3300025911|Ga0207654_10755932 | Not Available | 700 | Open in IMG/M |
| 3300025916|Ga0207663_10439764 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300025924|Ga0207694_11573668 | Not Available | 554 | Open in IMG/M |
| 3300025931|Ga0207644_10139186 | Not Available | 1867 | Open in IMG/M |
| 3300025932|Ga0207690_10436005 | Not Available | 1051 | Open in IMG/M |
| 3300025933|Ga0207706_10155421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2012 | Open in IMG/M |
| 3300025938|Ga0207704_11333779 | Not Available | 614 | Open in IMG/M |
| 3300025941|Ga0207711_10500970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1132 | Open in IMG/M |
| 3300025960|Ga0207651_11342555 | Not Available | 643 | Open in IMG/M |
| 3300025986|Ga0207658_10222222 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300026023|Ga0207677_10895534 | Not Available | 800 | Open in IMG/M |
| 3300026041|Ga0207639_12070417 | Not Available | 530 | Open in IMG/M |
| 3300026078|Ga0207702_10522610 | Not Available | 1159 | Open in IMG/M |
| 3300026142|Ga0207698_10042474 | All Organisms → cellular organisms → Bacteria | 3397 | Open in IMG/M |
| 3300028722|Ga0307319_10236341 | Not Available | 601 | Open in IMG/M |
| 3300028872|Ga0307314_10232493 | Not Available | 566 | Open in IMG/M |
| 3300028878|Ga0307278_10398087 | Not Available | 605 | Open in IMG/M |
| 3300031731|Ga0307405_10606889 | Not Available | 894 | Open in IMG/M |
| 3300031996|Ga0308176_11334304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300032001|Ga0306922_11426814 | Not Available | 695 | Open in IMG/M |
| 3300032013|Ga0310906_11404656 | Not Available | 512 | Open in IMG/M |
| 3300032066|Ga0318514_10253183 | Not Available | 927 | Open in IMG/M |
| 3300032067|Ga0318524_10793381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300032205|Ga0307472_100765393 | Not Available | 877 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.45% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.82% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_112644091 | 3300000443 | Soil | MSWRRPRRDAVDGQETAELAALADGSLPPERREELEARVASSSELAD |
| JGI10216J12902_1010072164 | 3300000956 | Soil | VLRRRRPGEVGSQEIAELAALADGSLAPERRAVLEARVAGSPELA |
| JGI10216J12902_1027389022 | 3300000956 | Soil | MRRRRQNGAGGDELAELAALADESLAPERRAALEAR |
| JGI10216J12902_1131959662 | 3300000956 | Soil | MNSRRDEEVGAQELAELAALADGSLAPERRATLEARVAASPEL |
| JGI10216J12902_1264483801 | 3300000956 | Soil | MLRRRRQDGVGEELSELAALADGSLPPDRRAALEARVAASAELAD |
| Ga0062589_1021646422 | 3300004156 | Soil | MRRGREDDAGARELAELAALADGSLTAERRAALEARVASSPELAG |
| Ga0062590_1020188222 | 3300004157 | Soil | LRRRKEDDAGGQEIAELAALADGSLAPERRAVLEARVAASPELADRLAEQ |
| Ga0062595_1011583302 | 3300004479 | Soil | MPLRRSRQDDAGADEIAALAALADGSLAPERRAALEERVAASPELAD |
| Ga0062594_1022821602 | 3300005093 | Soil | MSDQQDQNGGHEVAELAALADGSLAPDRRAALEERVAADP |
| Ga0066815_100845301 | 3300005164 | Soil | MRRRREDEDGGQELSELAALADGSLAPERRAPLEAQVAASSKLAEQLA |
| Ga0070670_1000496675 | 3300005331 | Switchgrass Rhizosphere | MRRRREDENGTQEVVELAALADGTLAAERRAELEARVAASSELVE |
| Ga0070692_105008221 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MREADDQESAELAALADGSLAPARRAALEAEVAASPELADR |
| Ga0070671_1005018572 | 3300005355 | Switchgrass Rhizosphere | MPMRRRRADDAVVDESVELAALADGSLSGERRSRLEARVAA |
| Ga0070671_1015407382 | 3300005355 | Switchgrass Rhizosphere | MPMRRRRADDAVVDEPVELAALADGSLPGERRSQLDARVAASPDLSA |
| Ga0070673_1005844931 | 3300005364 | Switchgrass Rhizosphere | MRRRREDENGTQEVVELAALADGTLAAERRAELEARVAASS |
| Ga0068867_1017935312 | 3300005459 | Miscanthus Rhizosphere | MRRGREDEAGTAELAELTALADGSLAPDRRAALEARVAADPELAGLLA |
| Ga0068853_1012435312 | 3300005539 | Corn Rhizosphere | MRRRRADEGGDREIAELAALADGSLAPEQRVALEARVAASS |
| Ga0070696_1016225202 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRGREDEAGTAELAELTALADGSLAPDRRAALEARVAADPELA |
| Ga0066670_101492721 | 3300005560 | Soil | MLRRRRQEGVGKESAELAALADGSLPPERRAALEARVAASSELA |
| Ga0066703_101673721 | 3300005568 | Soil | MPLRRPNADEAGARETPELAALADGSLPPELRAPLEARVAAS |
| Ga0070702_1000035429 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRRRDATNDQEIVELAALADGSLAPERRAELEARVAASSELAAL |
| Ga0068859_1021237972 | 3300005617 | Switchgrass Rhizosphere | MLLRRRARDEADRRELAELAALADGSLPADRRSALEEQVAASPE |
| Ga0081455_103007382 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRRRRSEQNGDQEIVELAALADGSLSPERRTELEARVAASPELA |
| Ga0074056_100159934 | 3300006574 | Soil | MRRRRADEDGDREIAELAALADGSLEPERRDALEARVAAS |
| Ga0074049_128812261 | 3300006580 | Soil | MTTRRRRKDEGRIREAELAALADGSLAPERRAALEERVAA |
| Ga0066660_105232732 | 3300006800 | Soil | MPLRRPNADEAGARETPELAALADGSLPPELRAPLEARVAASP |
| Ga0075421_1016462332 | 3300006845 | Populus Rhizosphere | VLRRRRQDEVGSQEIAELAALADGSLAPERRAVLEARVAGS |
| Ga0075433_101809551 | 3300006852 | Populus Rhizosphere | MSRRRPRRDDVDDRETAELAALADGSLAAERREELEARVAASSELAD |
| Ga0075433_115941221 | 3300006852 | Populus Rhizosphere | MRRRRPDEDGDREIAELAALADGSLEPERRDALEARVAASSELADQLA |
| Ga0075425_1008291193 | 3300006854 | Populus Rhizosphere | MSRRRPRRDDVDDRETAELAALADGSLAAERREELEARVAAS |
| Ga0066710_1041841011 | 3300009012 | Grasslands Soil | MRRRRDDETGGREIAELAALADGSLTPERRAALEARVAE |
| Ga0099827_106331951 | 3300009090 | Vadose Zone Soil | MRPRRRDETSDQEIVELAALADGSLAPERRAELEARVA |
| Ga0111539_119661083 | 3300009094 | Populus Rhizosphere | MRRRREDENGAQEVVELAALADGTLEPERRAALEAQV |
| Ga0105245_132143172 | 3300009098 | Miscanthus Rhizosphere | VSPRRSREDEAGGSETAELAALADGTLAPDQVAALEARVGAS |
| Ga0111538_114779932 | 3300009156 | Populus Rhizosphere | MRRHRADEAGDREIAELAALADGSLAPERRVALEARVAASPELADRLA |
| Ga0105241_112804462 | 3300009174 | Corn Rhizosphere | MRRRRADEDGDREIAELAALADGSLEPERRDALEARVAASSEL |
| Ga0105248_105951402 | 3300009177 | Switchgrass Rhizosphere | MLLRRRARDEADRRELAELAALADGSLPADRRSALEEQVAASPEVAD |
| Ga0126305_101483833 | 3300010036 | Serpentine Soil | MRRRRQDEARGQETAELAALADGSLAPDRRAALEERVAASTELAGRLAE |
| Ga0126314_104840963 | 3300010042 | Serpentine Soil | MRRRPRDEPAGDVAELAALADGSLAPERRAALEARVAASPELT |
| Ga0126310_110989412 | 3300010044 | Serpentine Soil | MRRRRDNGAADGELAELAALADGSLPRERRAALEAKVDASPELADLLAEQQ |
| Ga0126310_115729681 | 3300010044 | Serpentine Soil | MRRRPPDEAAGDLAELAALADGSLAPERRAALEAQVAASP |
| Ga0126311_106002371 | 3300010045 | Serpentine Soil | MRRRRDNGAADGELAELAALADGSLARERRAALEAKVEASPELAD |
| Ga0134080_104368611 | 3300010333 | Grasslands Soil | MVRRRRHEDSAGPDVTELAALADGSLAPERRAALEAQVAASLELTDR |
| Ga0126378_122097741 | 3300010361 | Tropical Forest Soil | MRRRRDDEKLDRELAELAALADGSLSGERRAAAEARVDGSTELAALL |
| Ga0134066_103990452 | 3300010364 | Grasslands Soil | VLRRRRREDGPEVEIAELAALADGSLPPGRRAVLEARVAASSELAEQLGE |
| Ga0105239_102954963 | 3300010375 | Corn Rhizosphere | VSLRRRGDPETDDREIAELAALADGSLTPDRRAALEAEVSASS |
| Ga0126381_1019168951 | 3300010376 | Tropical Forest Soil | MRRRRDDEKLDRELAELAALADGSLSGERRAAAEARVDGSTE |
| Ga0105246_107125891 | 3300011119 | Miscanthus Rhizosphere | MRRRRADEDGDREITELAALADGSLEPERRDALEARVAASSEL |
| Ga0120152_10566453 | 3300012011 | Permafrost | VRRRREEEESGREIAELAALADGSLPSERRAAVEARVAGSAEL |
| Ga0120159_11380551 | 3300012014 | Permafrost | MRRRREERAGGQEIAELAALADGELASERREALEAQ |
| Ga0137379_111502402 | 3300012209 | Vadose Zone Soil | VLSRRRREDGPEVEIVELAALADGSLPPGGRAALEARVAASSEL |
| Ga0137370_108339291 | 3300012285 | Vadose Zone Soil | MRGRREDEGEEIAELAALADGSLAPGRRAALEARGAASSELAERRSEQ |
| Ga0137372_109738681 | 3300012350 | Vadose Zone Soil | MRRRREAETGARELAELAALADGSLAPARRAALEAR |
| Ga0137371_107864922 | 3300012356 | Vadose Zone Soil | MKRRREDRPDGELAALAALADGSLAPERRAELDARVAASSE |
| Ga0137371_109095882 | 3300012356 | Vadose Zone Soil | MRGRREDEADGEEIAELAALADGSLTSERRAALEA |
| Ga0137375_102746091 | 3300012360 | Vadose Zone Soil | MRGRREDEADGEKIAELAAFADGSLAPERRAALEAQVAA |
| Ga0137373_105524431 | 3300012532 | Vadose Zone Soil | MRRRRTDEADGQEIAELAALADGSLAPERRAALEAR |
| Ga0157291_102767401 | 3300012902 | Soil | VSLRRRRAHESDDREIAELAALADGSLGPDRRVALEAE |
| Ga0157286_103906061 | 3300012908 | Soil | MRRPPADDAAREVAELAALADGSLAPERRAALEAQVAASP |
| Ga0157310_105419371 | 3300012916 | Soil | MREADDQEIAELAALADGSLGPERRAALEAEVAASPE |
| Ga0164303_106437111 | 3300012957 | Soil | MRRRRADDAVVDESVELAALADGSLAGERRSQLEARVAASP |
| Ga0164309_117719142 | 3300012984 | Soil | MRGRRGDPAGDQEIAELAALADGSLSPERRAALEARVA |
| Ga0164309_118731632 | 3300012984 | Soil | MRRRRGEESGDRELVELAALADGSLSSERRAELEAEIEASPELADRLR |
| Ga0164304_118410192 | 3300012986 | Soil | MSMNRRRDHEAEGQELAELAALADGSLATERRAAIEARVAGSPEL |
| Ga0164305_112634882 | 3300012989 | Soil | MPMRRRRADDAVVDESVELAALADGSLSGERRSQLEARV |
| Ga0157307_11670271 | 3300013096 | Soil | MRETDDQEIAELAALADGSLGPERRAALEAEVAASP |
| Ga0173483_101711541 | 3300015077 | Soil | MRRGREDDAGARELAELAALADGSLTAERRAALEARVASSPELAGQLA |
| Ga0132256_1026252432 | 3300015372 | Arabidopsis Rhizosphere | VSLRRRRPRGPGDQEIAELAALADGSLGNERRVALEDEV |
| Ga0132257_1037089591 | 3300015373 | Arabidopsis Rhizosphere | MSLRRRREGEDGGQEISELAALADGSLAPERRAALMARVAASSELSDR |
| Ga0132255_1011798913 | 3300015374 | Arabidopsis Rhizosphere | MRRRREADDGGREIAELAALADGSLDPERRTAAEARVAGSAELAERLAE |
| Ga0182041_107807571 | 3300016294 | Soil | MRRRRDDEKLDRELAELAALADGSLSGERRAAAEARVGGSAEL |
| Ga0184635_101542062 | 3300018072 | Groundwater Sediment | MRRRRQDLNGGEQPAELAALADGSLAPERRAELEAQIAESPELAELL |
| Ga0066667_113256281 | 3300018433 | Grasslands Soil | MRKRRGDEAADREIAELAALADGSLAPERRAALEAQVAASSE |
| Ga0190270_118725941 | 3300018469 | Soil | MRRGREEDADARELAELAALADGSLTAERRAALEARVASSPELA |
| Ga0066669_104587433 | 3300018482 | Grasslands Soil | MRRRPDEGNGQEIVELAALADGSLAPEHRAALEARVAAS |
| Ga0173482_100850771 | 3300019361 | Soil | MRRRRQDLNGGEPPAELAALADGSLAPERRAELEA |
| Ga0193730_11419801 | 3300020002 | Soil | MRGRREDEADGEEMAELAALADGSLASERRAALEARVAASSELADRLVE |
| Ga0193730_11685142 | 3300020002 | Soil | MRRRREAEADGREIAELAALADGSLAPERRAALEARVAASS |
| Ga0126371_112915302 | 3300021560 | Tropical Forest Soil | MWMRRGPEDEADVREVAEIAALADGSLAAERRAALEAQVA |
| Ga0222622_102144021 | 3300022756 | Groundwater Sediment | MPVRRRPRDENGGQELAELAALADGSLAPERRAALEARVAASPE |
| Ga0247753_10204572 | 3300022892 | Soil | MRRRRADEDGDREIAELAALADGSLEPERRDALEARVAASSELAD |
| Ga0247801_10426561 | 3300023064 | Soil | MRRRRQDLNGGEPPAELAALADGSLAPERRAELEAQIAESPE |
| Ga0247800_10722591 | 3300023263 | Soil | MRRRRADEDGDREIAELAALADGSLEQERRDALEARVA |
| Ga0247776_102318092 | 3300023275 | Plant Litter | MRRRRADEDGDREIAELAALADGSLEQERRDALEA |
| Ga0207688_103344583 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRRREDENGTQEVVELAALADGTLAAERRAELEARVAAS |
| Ga0207685_101021112 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMNRRRDDEAEGQELAELAALADGSLATERRAAIEARVAGSPELAERL |
| Ga0207654_107559321 | 3300025911 | Corn Rhizosphere | MRRRRADEDGDREIAELAALADGSLEPERRDALEARVAASSELA |
| Ga0207663_104397641 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPRRRDATNDQEIVELAALADGSLAPERRAELEARVAASSEL |
| Ga0207694_115736682 | 3300025924 | Corn Rhizosphere | MRRRRADEDGDREIAELAALADGSLEPERRDALEARVAGSSELA |
| Ga0207644_101391862 | 3300025931 | Switchgrass Rhizosphere | MPLRRRARDEADSRELAELAALADGSLPADRRSALEEQVAASPEVADRLAEQ |
| Ga0207690_104360051 | 3300025932 | Corn Rhizosphere | MRRRRADEDGDREIAELAALADGSLEPERRDALEARVAGSSE |
| Ga0207706_101554213 | 3300025933 | Corn Rhizosphere | MRPRRRDATSDQEIVELAALADGSLAPERRAALEAR |
| Ga0207704_113337792 | 3300025938 | Miscanthus Rhizosphere | MPLRRRPRDENGGQELAELAALADGSLAPERRAALEARVAASPELADRL |
| Ga0207711_105009702 | 3300025941 | Switchgrass Rhizosphere | MLLRRRARDEADRRELAELAALADGSLPADRRSALEEQVAASPEVADRVTII |
| Ga0207651_113425552 | 3300025960 | Switchgrass Rhizosphere | VRAMRRRREDENGTQEVVELAALADGTLAAERRAELEARVAASSELVE |
| Ga0207658_102222221 | 3300025986 | Switchgrass Rhizosphere | MRPRRRDATNDQEIVELAALADGSLAPERRAELEARV |
| Ga0207677_108955341 | 3300026023 | Miscanthus Rhizosphere | MRRRREDENGTQEVVELAALADGTLPAERRAELEAR |
| Ga0207639_120704172 | 3300026041 | Corn Rhizosphere | MRRRRADEGGDREIAELAALADGSLAPEQRVALEARVAASSELADRLA |
| Ga0207702_105226101 | 3300026078 | Corn Rhizosphere | MALRRRRSEDPLAGEPVELAALADGSLSDERRSHLEARVAASAELS |
| Ga0207698_100424741 | 3300026142 | Corn Rhizosphere | MRRRRADEDGDREIAELAALADGSLEQERRDALEARVAASSE |
| Ga0307319_102363412 | 3300028722 | Soil | MRRRREDETAELAALADGSLAPDRRAAAEARVAASPELAERLAEQE |
| Ga0307314_102324931 | 3300028872 | Soil | MRRRRGAEVDGREIAELAALADGSLAPERRAALEARVAASS |
| Ga0307278_103980871 | 3300028878 | Soil | MRGRRENEADGEEMAELAALADGSLASERRAALEARVAASS |
| Ga0307405_106068891 | 3300031731 | Rhizosphere | MRPRRQDLNGGEQLAELAALADGSLAPQRRAELEAQIAE |
| Ga0308176_113343042 | 3300031996 | Soil | MPLRRRPRDENGGQELAELAALADGSLAPERRAALEARVAASP |
| Ga0306922_114268141 | 3300032001 | Soil | MRRRRAPEDGGLEIAELAALADGSLAPHRRAAVEE |
| Ga0310906_114046562 | 3300032013 | Soil | MTTRRRQGDERRAPDAELAALADGSLAPERRAALEERV |
| Ga0318514_102531831 | 3300032066 | Soil | MRRRRAPEDGGLEIAELAALADGSLAPHRRAAVEEQVAESTDLSD |
| Ga0318524_107933812 | 3300032067 | Soil | MRRTRAEVPDPEPVELAALADGSLPPSRRAALEARVAASPELRDR |
| Ga0307472_1007653931 | 3300032205 | Hardwood Forest Soil | MSAGREEPAELAALADGSLSPERRAEVEASVAASP |
| ⦗Top⦘ |