 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F087161 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MESLTETAELALPGLEKASMTEPSPGHWIERGPQKRLMVFAGRSH |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.91 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 10.96% Coil/Unstructured: 89.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00132 | Hexapep | 63.64 |
| PF14602 | Hexapep_2 | 20.00 |
| PF12804 | NTP_transf_3 | 5.45 |
| PF08544 | GHMP_kinases_C | 4.55 |
| PF00483 | NTP_transferase | 3.64 |
| PF01551 | Peptidase_M23 | 0.91 |
| PF00563 | EAL | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.91 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.91 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.91 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300013105|Ga0157369_10175322 | Not Available | 2257 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.45% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.73% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.73% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.91% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.91% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00744730 | 2166559006 | Grass Soil | MESPTTIELALPGLEGGVVSEPQPQHYIVRGPEKRLMVFSGRSHPALA |
| JGI12635J15846_108988651 | 3300001593 | Forest Soil | MSTETTPELTRLPGLEVTPGTMTGPKVGHWLERGPQKRLM |
| JGI12053J15887_105332152 | 3300001661 | Forest Soil | MESLTAELALPGLEKATVTQPAQGHWIERGPQKRLM |
| C688J35102_1203943661 | 3300002568 | Soil | MESPTATEVALPGLEARVVTDPSPQHFIERGPLKRLMVFAGRSHPDL |
| Ga0063454_1017151171 | 3300004081 | Soil | MESLTAELALPGLEKATLTDPAQSNWIERGPSKRLMVFSGRS |
| Ga0063455_1000748862 | 3300004153 | Soil | MESPTATELALPGLEGGVAMSDPAPQHYIVRGPQKRLMVFSGRSH |
| Ga0066674_105593602 | 3300005166 | Soil | MTSATTTPTEARLPGLEVPEVTAEPTPGHFIERGPQKRLMVFSG |
| Ga0066683_109083811 | 3300005172 | Soil | MPTETTPELTRLPGLEVSPSTMTEPKVGHWLERGPQKRLMVF |
| Ga0066680_104201911 | 3300005174 | Soil | MESLTTPTDLALPGLEGAVVSEPITGHWIERGPQKKLMVFSGRSHP |
| Ga0066684_109534631 | 3300005179 | Soil | MESLTTPTDIALPGLEGAVLSEASAGHFIERGPQKKLMVFSGRSHPEL |
| Ga0066684_111149581 | 3300005179 | Soil | MESPTATELALPGLESGVAMSDPSPQHYIVRGPEKRLMVFAGRS |
| Ga0066675_100273056 | 3300005187 | Soil | MESLTAELALPGLEKATMTQPAEGHWIERGTHKRLMVFAGRSHPDL |
| Ga0070683_1004639031 | 3300005329 | Corn Rhizosphere | MESLTAEIALPGLEKAVSETVRGNWIERPGGKRLMVFSGRSHP |
| Ga0070683_1016333971 | 3300005329 | Corn Rhizosphere | MESPTATELALPGLEARVVTDPAPEHYIERGPLKRLMVFA |
| Ga0066388_1009046211 | 3300005332 | Tropical Forest Soil | MESPTATELPLPGLEARVVTDPSPEHFIERGPLKRLMVFAGRS |
| Ga0070713_1007664092 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MESLTETAELALPGLEKASMTEPSPGHWIERGPQKRLMVF |
| Ga0070713_1017984912 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MESLTAELALPGLEKATVTQPAEGHWIERGTHKRLMVFAGRSHPD |
| Ga0070699_1012548671 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MESLTATELALPGLEGGAVLTETRPGHWIERGPQKRLMVFS |
| Ga0070679_1019151622 | 3300005530 | Corn Rhizosphere | MESLTAELPLPGLEKGSVSEPQHGHWIERPGGKRLMVFAGRSHPDLA |
| Ga0070693_1014702501 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MESPTATELALPGLEARTVTDPAPEHFIERGPLKRLMVFAGRSHPDL |
| Ga0066701_102030891 | 3300005552 | Soil | MESLTTPTDLALPGLEGAVVSEPITGHWIERGPQKKLMVFSGRSHPEL |
| Ga0066702_100092521 | 3300005575 | Soil | MESPTATELALPGLEGGVAMSDPSPQHYIVRGPEKRLMVFSGRSH |
| Ga0068857_1011802142 | 3300005577 | Corn Rhizosphere | MESPTATELALPGLEEARVVTDPSPQHYIERGPLKRLMVFAGRSHP |
| Ga0068866_107097081 | 3300005718 | Miscanthus Rhizosphere | MESPTATELALPGLEEARVVMDPAPEHFIERGPLKRLMVFA |
| Ga0075290_10694441 | 3300005889 | Rice Paddy Soil | MESVTELALPGLEKSTMAEPLKENWIERGPSKRLMV |
| Ga0075276_100936831 | 3300005898 | Rice Paddy Soil | MESPTATELALPGLEARVVTNPSPQHFIERGPLKRLMVFAGR |
| Ga0075273_100367501 | 3300005902 | Rice Paddy Soil | MESPTATELALPGLEARVVTDPSPEHFIERGPLKRLMVFAGRSH |
| Ga0075273_100679452 | 3300005902 | Rice Paddy Soil | MESPTATTELALPGLEGKVAMSEPSPQHYIVRGPEKRLMVFAGRSHPALAA |
| Ga0066656_107218851 | 3300006034 | Soil | MESPTATELALPGLEGGVAMSDPAPQHSIVRGPQKRLMVFSGRSHPEL |
| Ga0066652_1001457931 | 3300006046 | Soil | MESVTTAELALPGLEKGTLTEPSQGHWIERGPQKRLMVF |
| Ga0075024_1002476672 | 3300006047 | Watersheds | MESLTAELALPGLEGAAVTQPVQGHWLERGPSKRLMVFAGRSHP |
| Ga0075015_1006603411 | 3300006102 | Watersheds | MESPTATELALPGFEGSVVTEPQAQHYIVRGPEKRLMVFSGRSHPALAQAI |
| Ga0074059_119701282 | 3300006578 | Soil | MESPTATELALPGLEGGTVMSDPSPQHYIVRGPEKRLMVFSGRSHPELAAA |
| Ga0066653_102119481 | 3300006791 | Soil | MESVTTAELALPGLEKGTLTEPSQGHWIERGPQKRLMVFSGRSH |
| Ga0079221_104029112 | 3300006804 | Agricultural Soil | MESLTAELALPGLEPSTVTQPASGHWLERGPQKRLMVF |
| Ga0079221_105709401 | 3300006804 | Agricultural Soil | MESPTATELALPGLEGGVAMSDPSPQHYIVRGPEKRLMVFAGR |
| Ga0099827_117325721 | 3300009090 | Vadose Zone Soil | MESLTAIEVALPGLEGAVVSEPKTGHWLERGPQKRLMVFAGRSHP |
| Ga0105240_121951141 | 3300009093 | Corn Rhizosphere | MESLTGTVELTLPGLEGATMTESSQGHWIERGPQKRLMVFSGR |
| Ga0111538_118215602 | 3300009156 | Populus Rhizosphere | MESPTATELALPGLEEARVVMDPAPEHFIERGPLKRLMVFAGRS |
| Ga0105237_112164121 | 3300009545 | Corn Rhizosphere | MESPTATELALPGLEARTVTDPAPEHFIERGPLKRPMVFA |
| Ga0126380_106093701 | 3300010043 | Tropical Forest Soil | MESPTATELPLPGLEARVVTDPSPEHFIERGPLKRLMVFAGRSHPDLAQN |
| Ga0126318_108944352 | 3300010152 | Soil | MESPTATELALPGLEAPVVTGPSPQHFIERGPLKRLMVFAGRSH |
| Ga0134070_102884732 | 3300010301 | Grasslands Soil | MESLTAELPIPGLERATLNEPSPGHFIERGPLKRLMVFAGRSH |
| Ga0134070_103900262 | 3300010301 | Grasslands Soil | MESPTATELALPGLEGGVAMSDPAPQHSIVRGPQKRLMVFSGRSHPELA |
| Ga0134067_102132732 | 3300010321 | Grasslands Soil | MPTETTHELTRLPGLEVSPSTMTEPKVGHWLERGPQKRLMVFSG |
| Ga0134067_102369812 | 3300010321 | Grasslands Soil | MESPTATELALPGLESGVAMSDPSPQHYIVRGPEKRLMVFAGRSHP |
| Ga0134062_101673412 | 3300010337 | Grasslands Soil | MESVTTAELALPGLEKAAMSEPSQGHWIERGPQKRLMVF |
| Ga0134128_110362372 | 3300010373 | Terrestrial Soil | MESLTAEIALPGLEKGAMTEPQQGHWLERPTGKRLMVFSGRSHP |
| Ga0134126_126179811 | 3300010396 | Terrestrial Soil | MESPTATELALPGLEGGVAMSDPTPQHSLVRGPQKRLMVFSG |
| Ga0137392_105157582 | 3300011269 | Vadose Zone Soil | MESLTAELTLPGLEGVTMTEPKQGHWIERGPQKRLMVFSGRSHPDLAN |
| Ga0137391_114551222 | 3300011270 | Vadose Zone Soil | MESLTAELALPGLEGTTATQPETGHWIERGPQKRLMVFAGRS |
| Ga0137378_114292731 | 3300012210 | Vadose Zone Soil | MESPTATELALPGLEGGVVTEPSPRHFIERGPQKRLMVFSG |
| Ga0150985_1045142821 | 3300012212 | Avena Fatua Rhizosphere | MESLTAELALPGLEKATLTDPAQSNWIERGPSKRLMVFSGRSHPDLAQ |
| Ga0150984_1139493131 | 3300012469 | Avena Fatua Rhizosphere | MATTELVRLPGLDTPVMPTEPKQGHWIERGPQRRLMVFTGRSHPQLAE |
| Ga0137394_113551671 | 3300012922 | Vadose Zone Soil | METVAELALPGLEKGTVTEPTPGHWIERGPQKRLMV |
| Ga0137413_105139991 | 3300012924 | Vadose Zone Soil | MESPTATELALPGLEGGVAMSDPAPQHSIVRGPQKRLMV |
| Ga0137404_107742641 | 3300012929 | Vadose Zone Soil | MESLTETAELALPGLEKASMTEPSSGHWIERGPQKRLMVFAG |
| Ga0164303_100010731 | 3300012957 | Soil | MESPTATELALPGLEGESGAVMSEPSPQHYIVRGPQK |
| Ga0164307_102556671 | 3300012987 | Soil | MESLTETAELALPGLEKASMTEPSAGHWIERGPQKRLMVFAGR |
| Ga0164307_113288762 | 3300012987 | Soil | MPIESTTTELALPGLAEARVVTDPAPEHFIERGPLKRPMVFAGRSHPDLAQD |
| Ga0157369_101753221 | 3300013105 | Corn Rhizosphere | MESPTATELALPGLEARVVTDPAPEHYIERGPLKRL |
| Ga0157369_111743851 | 3300013105 | Corn Rhizosphere | MESLTAELSLPGLEKATVSQPERGHFLERPGGKRLMVFSGRSHPDLA |
| Ga0120154_10570911 | 3300013501 | Permafrost | MESLTAELTLPGLEKATMTQPGQGHWIERGPQKRLMVFAGRSHP |
| Ga0120111_11060531 | 3300013764 | Permafrost | MESLTETAELALPGLEKASMTEPSPGHWIERGPQKRLMVFAGRSHP |
| Ga0120181_11385051 | 3300013766 | Permafrost | MESLTEPAELALPGLEKASMTEPSPGHWIERGPQKRLMVFAGRSH |
| Ga0182008_105320571 | 3300014497 | Rhizosphere | MESLTAELALPGLEKATVTDPAQSNWIERGPSKRLMVFSGRSHP |
| Ga0120171_11599511 | 3300014827 | Permafrost | MESLTTPAEIALPGLEGSVVSEPNPEHWIERGPQKRLMVFSGR |
| Ga0134069_11508442 | 3300017654 | Grasslands Soil | MESPTATELALPGLEARVVTDPSPRQFIDRGPLKWLMVCAGRS |
| Ga0136617_114780341 | 3300017789 | Polar Desert Sand | VESATAELTLPGLETPAVRNAPVAGHWIERGPQKRLMLFAGRSHP |
| Ga0187809_101915151 | 3300017937 | Freshwater Sediment | MESPTATELALPGLEAGVAMSDPSPQHYIVRGPEKRLMV |
| Ga0187778_107179471 | 3300017961 | Tropical Peatland | METPTAIELALPGLEGSLVTADPSPEHFIVRGPQKRLMVFSGRSHPQLAM |
| Ga0187776_110497281 | 3300017966 | Tropical Peatland | MESLTAELALPGLEGAAVTQPVQGHWLERGPSKRLMVFSGRSHPD |
| Ga0187780_106760732 | 3300017973 | Tropical Peatland | MESPTAIELALPGLEGSLVSGDPSPEHFIVRGPQKRLMVFSGR |
| Ga0187777_112906161 | 3300017974 | Tropical Peatland | MESSTATELALPGLEGGVVLSDPSPQHFIERGPLKRL |
| Ga0066669_114009991 | 3300018482 | Grasslands Soil | MESLTGTAELTLPGLEGATVTEPSQGHWIERGPQKRLMIFS |
| Ga0206356_109547791 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MESLTATEITLPGLERAVVTEVTHTRWLERAPQKRLMV |
| Ga0206354_112753882 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MESLTAELPLPGLEKGSVSEPQHGHWIERPGGKRLMVFAGRSHPDLARAISE |
| Ga0193699_103081312 | 3300021363 | Soil | MESLTAELALPGLEKATVTQPNQGHWIERGPQKRLMVFAGRS |
| Ga0207653_101736251 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MESPTTVELALPGLEGEGGAVVSEPSPQHYIVRGPQKRL |
| Ga0207705_100587851 | 3300025909 | Corn Rhizosphere | MESLTAEIALPGLEKGAMTEPQQGHWLERPTGKRLMVFSGRSHPDL |
| Ga0207654_102429331 | 3300025911 | Corn Rhizosphere | MESPTATELALPGLEGESGAVMSEPSPQHYIVRGP |
| Ga0207654_110226061 | 3300025911 | Corn Rhizosphere | MESLTGTAELTLPGLEGGAMTEPSQGHWIERGPQKRLMVF |
| Ga0207695_115387101 | 3300025913 | Corn Rhizosphere | MESLTAELALPGLEGATMTRPAPGHWIERGPQKRLM |
| Ga0207694_112975732 | 3300025924 | Corn Rhizosphere | MESVTAEIALPGLEKGTMTEPQQGHWLERPGGKRLMVFSGRSHPDLAQ |
| Ga0207700_119253502 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MESPTATELALPGLEGGVAMSEPSPQHYIVRGPEKRLMVFAGRSHPALA |
| Ga0207665_116475982 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MESPTATELALPGLEARVVTDPAPEHYIERGPLKRLMVFAGRSHPDLALNI |
| Ga0207679_113105302 | 3300025945 | Corn Rhizosphere | MESLTETAELALPGLEKASMTEPSPGHWIERGPQKRLMVFAGRSH |
| Ga0209804_11644411 | 3300026335 | Soil | MESLTETAELALPGLEKASMTESSPGHWIERGPQKRLMVFAGRS |
| Ga0209058_13043241 | 3300026536 | Soil | MESPTATELALPGLEGGVAMSDPAPQHSIVRGPQKRLMVFSGRS |
| Ga0209156_104807682 | 3300026547 | Soil | MESPTATELPLPGLEGGVVMSDPSPRHYIVRGPEKR |
| Ga0209648_108390362 | 3300026551 | Grasslands Soil | MESLTAELTLPGLEGATMTEPKQGHWIERGPQKRLMVFSGR |
| Ga0208042_10769171 | 3300027568 | Peatlands Soil | MESVTATEIALPGLEKAIMSAPVQGHWIERGPQKRLMVF |
| Ga0209178_11325191 | 3300027725 | Agricultural Soil | MESPTATELALPGLEARVVTDPSPQHFIERGPLKRLMVFAGRS |
| Ga0209811_101489951 | 3300027821 | Surface Soil | MESPTTVELALPGLEGEGGAVVSEPSPQHYIVRGPQKRLMVFSGRSHPYL |
| Ga0247822_112487032 | 3300028592 | Soil | MAELATLPGLDLAMTQQPAGGHYIERPNGKRLMVFSGRSHA |
| Ga0265336_100410241 | 3300028666 | Rhizosphere | MESLTAELPIPGLERAVVTEPTEVHWVERAPQKRLM |
| Ga0307296_106747912 | 3300028819 | Soil | MSTTSATTTTELALPGLEASDVTVQPDPRHFIERGPQKRLMVVSGRSHP |
| Ga0170824_1153396951 | 3300031231 | Forest Soil | MESLTAELALPGLEGSTASQPETGHWIERGPQKRLM |
| Ga0318555_103777892 | 3300031640 | Soil | MESPTATELALPGLEGGVVSEPQPQHYIVRGPEKRLMVFSGRSHPYL |
| Ga0318542_103733791 | 3300031668 | Soil | MESPTATELALPGLEGGVVSEPQPQHYIVRGPEKRLMVFSGRSHPYLARAI |
| Ga0310813_111870761 | 3300031716 | Soil | MESLTAELSLPGLEKATVSQPERGHFLERPGGKRLMVFSGRSHP |
| Ga0307468_1001297121 | 3300031740 | Hardwood Forest Soil | MESPTATELPLPGLEARVVTDPSPQHFIERGPLKRLMVFA |
| Ga0318565_103103732 | 3300031799 | Soil | MESPTATELALPGLEARVVTDPSPEHYIERGPLKRLMVFSGRSHP |
| Ga0308174_107539231 | 3300031939 | Soil | METPTATELALPGLEGGVVTSDPSPQHYIVRGPEKRLMVFSG |
| Ga0307479_102748224 | 3300031962 | Hardwood Forest Soil | MESLTAELALPGLEKAVVTEPTPGHWIERAPQKRLMVV |
| Ga0307479_113795502 | 3300031962 | Hardwood Forest Soil | MESLTAELALPGLEKATVTQPSQGHWIERGPQKRLMVFAG |
| Ga0308176_103039001 | 3300031996 | Soil | MESPTATELALPGLEEARVVKDPAPEHFIERGPLK |
| Ga0318553_106549772 | 3300032068 | Soil | MQPAIGTTELALPGLDVAEPVTGMKPGHWIERGPSKRLMVFAGRS |
| Ga0310810_103097744 | 3300033412 | Soil | MESLTAELALPGLEGPTTMTQPMPGHWIERGPQKRLMVFSGR |
| Ga0370546_061322_3_110 | 3300034681 | Soil | MESLTGTAELTLPGLEGAIVTEPSQGHWIERGPQKR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |