Basic Information | |
---|---|
Family ID | F087154 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 43 residues |
Representative Sequence | PSGVGRRSGLPVSVSLIGAPGADWDLLAAGAALQDELGTVAP |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.91 % |
% of genes near scaffold ends (potentially truncated) | 98.18 % |
% of genes from short scaffolds (< 2000 bps) | 91.82 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (51.818 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.909 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.455 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.86% β-sheet: 2.86% Coil/Unstructured: 74.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF04909 | Amidohydro_2 | 69.09 |
PF01614 | IclR | 5.45 |
PF09339 | HTH_IclR | 4.55 |
PF01144 | CoA_trans | 1.82 |
PF00378 | ECH_1 | 1.82 |
PF05977 | MFS_3 | 1.82 |
PF02771 | Acyl-CoA_dh_N | 0.91 |
PF08448 | PAS_4 | 0.91 |
PF07690 | MFS_1 | 0.91 |
PF13458 | Peripla_BP_6 | 0.91 |
PF13561 | adh_short_C2 | 0.91 |
PF00571 | CBS | 0.91 |
PF06267 | DUF1028 | 0.91 |
PF01926 | MMR_HSR1 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 5.45 |
COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 1.82 |
COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 1.82 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.82 |
COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 1.82 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.91 |
COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 51.82 % |
All Organisms | root | All Organisms | 48.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918008|ConsensusfromContig264297 | Not Available | 643 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0569387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
3300000890|JGI11643J12802_10251309 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300000891|JGI10214J12806_10084281 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300000956|JGI10216J12902_101516650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
3300004479|Ga0062595_102459502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 518 | Open in IMG/M |
3300005168|Ga0066809_10070333 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300005335|Ga0070666_10549806 | Not Available | 840 | Open in IMG/M |
3300005339|Ga0070660_100448283 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300005364|Ga0070673_101315316 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300005435|Ga0070714_100684364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 989 | Open in IMG/M |
3300005455|Ga0070663_100273848 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300005457|Ga0070662_101774941 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005615|Ga0070702_101182224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
3300005616|Ga0068852_102344561 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300005618|Ga0068864_101226699 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005713|Ga0066905_100168809 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
3300005888|Ga0075289_1076496 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005897|Ga0075281_1086292 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005902|Ga0075273_10065089 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300005937|Ga0081455_10410974 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300006046|Ga0066652_100517965 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300006057|Ga0075026_101029801 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300006581|Ga0074048_10071423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3559 | Open in IMG/M |
3300006953|Ga0074063_13358251 | Not Available | 517 | Open in IMG/M |
3300009090|Ga0099827_11296267 | Not Available | 634 | Open in IMG/M |
3300009094|Ga0111539_10218196 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
3300009098|Ga0105245_11357746 | Not Available | 760 | Open in IMG/M |
3300009098|Ga0105245_11471047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 732 | Open in IMG/M |
3300009098|Ga0105245_13095671 | Not Available | 515 | Open in IMG/M |
3300009100|Ga0075418_11001479 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300009100|Ga0075418_12493317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 564 | Open in IMG/M |
3300009147|Ga0114129_11321494 | Not Available | 893 | Open in IMG/M |
3300009147|Ga0114129_11908287 | Not Available | 720 | Open in IMG/M |
3300009148|Ga0105243_11823422 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300009177|Ga0105248_11176811 | Not Available | 867 | Open in IMG/M |
3300009545|Ga0105237_10919753 | Not Available | 882 | Open in IMG/M |
3300009553|Ga0105249_10513698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
3300010375|Ga0105239_12794962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300010376|Ga0126381_101282864 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300012001|Ga0120167_1054057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 876 | Open in IMG/M |
3300012360|Ga0137375_10042061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5067 | Open in IMG/M |
3300012910|Ga0157308_10134152 | Not Available | 772 | Open in IMG/M |
3300012943|Ga0164241_10027645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4332 | Open in IMG/M |
3300012951|Ga0164300_11034324 | Not Available | 531 | Open in IMG/M |
3300012971|Ga0126369_10516975 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
3300012985|Ga0164308_11969015 | Not Available | 545 | Open in IMG/M |
3300012987|Ga0164307_10586110 | Not Available | 857 | Open in IMG/M |
3300013100|Ga0157373_10390509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
3300013307|Ga0157372_13052168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300014325|Ga0163163_10989613 | Not Available | 904 | Open in IMG/M |
3300014497|Ga0182008_10045362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2186 | Open in IMG/M |
3300015077|Ga0173483_10812107 | Not Available | 541 | Open in IMG/M |
3300015374|Ga0132255_105582978 | Not Available | 532 | Open in IMG/M |
3300016319|Ga0182033_11634957 | Not Available | 583 | Open in IMG/M |
3300017939|Ga0187775_10413831 | Not Available | 560 | Open in IMG/M |
3300018466|Ga0190268_10709225 | Not Available | 741 | Open in IMG/M |
3300019362|Ga0173479_10805476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter deserti | 520 | Open in IMG/M |
3300020081|Ga0206354_10880103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
3300021078|Ga0210381_10320786 | Not Available | 562 | Open in IMG/M |
3300022915|Ga0247790_10155053 | Not Available | 591 | Open in IMG/M |
3300023078|Ga0247756_1132601 | Not Available | 501 | Open in IMG/M |
3300023102|Ga0247754_1046644 | Not Available | 999 | Open in IMG/M |
3300025327|Ga0209751_10154652 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
3300025901|Ga0207688_10435519 | Not Available | 816 | Open in IMG/M |
3300025914|Ga0207671_10736411 | Not Available | 783 | Open in IMG/M |
3300025919|Ga0207657_10948709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
3300025921|Ga0207652_10505970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1087 | Open in IMG/M |
3300025927|Ga0207687_11549006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300025932|Ga0207690_10621505 | Not Available | 883 | Open in IMG/M |
3300025937|Ga0207669_10508625 | Not Available | 965 | Open in IMG/M |
3300025940|Ga0207691_10536040 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300025940|Ga0207691_11072461 | Not Available | 671 | Open in IMG/M |
3300025944|Ga0207661_10934080 | Not Available | 799 | Open in IMG/M |
3300025945|Ga0207679_12086605 | Not Available | 515 | Open in IMG/M |
3300025961|Ga0207712_11898664 | Not Available | 533 | Open in IMG/M |
3300025990|Ga0208527_1015088 | Not Available | 928 | Open in IMG/M |
3300026067|Ga0207678_10294309 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300026067|Ga0207678_11100660 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300026095|Ga0207676_10970347 | Not Available | 836 | Open in IMG/M |
3300026095|Ga0207676_12429868 | Not Available | 521 | Open in IMG/M |
3300027560|Ga0207981_1044702 | Not Available | 808 | Open in IMG/M |
3300027909|Ga0209382_10767861 | Not Available | 1030 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10105385 | Not Available | 1189 | Open in IMG/M |
3300028379|Ga0268266_12175439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300028592|Ga0247822_10612797 | Not Available | 873 | Open in IMG/M |
3300028793|Ga0307299_10079604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
3300028802|Ga0307503_10466632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
3300028809|Ga0247824_10625811 | Not Available | 649 | Open in IMG/M |
3300028875|Ga0307289_10031712 | Not Available | 2082 | Open in IMG/M |
3300030619|Ga0268386_10087933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2415 | Open in IMG/M |
3300031251|Ga0265327_10502183 | Not Available | 523 | Open in IMG/M |
3300031543|Ga0318516_10016323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3708 | Open in IMG/M |
3300031682|Ga0318560_10236699 | Not Available | 979 | Open in IMG/M |
3300031782|Ga0318552_10316529 | Not Available | 794 | Open in IMG/M |
3300031846|Ga0318512_10354583 | Not Available | 734 | Open in IMG/M |
3300031847|Ga0310907_10713373 | Not Available | 555 | Open in IMG/M |
3300031858|Ga0310892_10377932 | Not Available | 917 | Open in IMG/M |
3300031890|Ga0306925_11435104 | Not Available | 679 | Open in IMG/M |
3300031939|Ga0308174_10579078 | Not Available | 927 | Open in IMG/M |
3300031943|Ga0310885_10774313 | Not Available | 543 | Open in IMG/M |
3300031996|Ga0308176_11263899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
3300032068|Ga0318553_10660516 | Not Available | 547 | Open in IMG/M |
3300032770|Ga0335085_12043438 | Not Available | 580 | Open in IMG/M |
3300032782|Ga0335082_10008419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11206 | Open in IMG/M |
3300032829|Ga0335070_10858301 | Not Available | 842 | Open in IMG/M |
3300033004|Ga0335084_11784020 | Not Available | 603 | Open in IMG/M |
3300033158|Ga0335077_12206636 | Not Available | 506 | Open in IMG/M |
3300033433|Ga0326726_11269512 | Not Available | 717 | Open in IMG/M |
3300033806|Ga0314865_149692 | Not Available | 621 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 7.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.36% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.64% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.73% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.82% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.91% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.91% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.91% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.91% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.91% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023078 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Bog_all_C_01536750 | 2140918008 | Soil | RSGLPTSVSLIGPPNADWNLIAAGVALQSRLGPVAL |
ICChiseqgaiiDRAFT_05693871 | 3300000033 | Soil | SGTGSRSGLPVSXSLIGAPGTEWDLLAWGAALHDRLGTVSP* |
JGI11643J12802_102513091 | 3300000890 | Soil | FPGVSLPSGVGSRSGLPTSVSLVGAPGAEWDLLAWGSALQEELGTVSP* |
JGI10214J12806_100842811 | 3300000891 | Soil | LPSGVGSRSGLPTSVSLVGAPGAEWDLLAWGSALQEELGTVSP* |
JGI10216J12902_1015166502 | 3300000956 | Soil | ALPAGIGRRSGLPVSVSLIGPPGADWDLLAAGTALQTELEPPTP* |
Ga0062595_1024595022 | 3300004479 | Soil | FPVVSLPSGVGKRSGLPTSVSLIGAPGADWDVLAWGTALQGELGTVSP* |
Ga0066809_100703332 | 3300005168 | Soil | SGVGSRSGLPTSVSLIGPPGAEWDLLAAGAALQDELGEVTPP* |
Ga0070666_105498061 | 3300005335 | Switchgrass Rhizosphere | PSGVGARSGLPVSVSLIGAHCTEWELLDWGAALQDRLGTVSPP* |
Ga0070660_1004482831 | 3300005339 | Corn Rhizosphere | PVVAFPSGVGSRSALPTGVSLIGAPGADWDLLAAGAALEAELRPMSYFGR* |
Ga0070673_1013153161 | 3300005364 | Switchgrass Rhizosphere | PSGLGRRSGLPTSVSLIGRPGADWDLLAAGAALQAELGTVSP* |
Ga0070714_1006843641 | 3300005435 | Agricultural Soil | GFPVVALPSGLGRASGLPTSVSLVGPAGADAALLGAGVALQRELGAPQPPP* |
Ga0070663_1002738483 | 3300005455 | Corn Rhizosphere | TGFPVVALPSGVGRRSGLPTSVSLIGAPGTEWDLLAWGAALQDRLGTVSP* |
Ga0070662_1017749411 | 3300005457 | Corn Rhizosphere | LPSGVGRHSGLPVSVSLIGAPGSDWDLLAWGAALQNELGTVAP* |
Ga0070702_1011822241 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GFPVVTLPSGVGRRSGLPVSVSLIGGPGSDWELLAWGVALQDELGTVAPA* |
Ga0068852_1023445611 | 3300005616 | Corn Rhizosphere | SALPTGVSLIGAPGADWDLLAAGAALEAELRPMSYFGR* |
Ga0068864_1012266991 | 3300005618 | Switchgrass Rhizosphere | HSGLPVSVSLIGPPGADWDLLEWGARLQDELGTVTPP* |
Ga0066905_1001688093 | 3300005713 | Tropical Forest Soil | FPVVALPSGVGSRSGLPVSVSLIGAPGSEWDLLGWGVALQEKLGTVSP* |
Ga0075289_10764961 | 3300005888 | Rice Paddy Soil | FPVVSLPSGVGRRSGLPVGVSLVGAPGADWDLLAWGAALQDELGTVAP* |
Ga0075281_10862922 | 3300005897 | Rice Paddy Soil | SGLPTSVSLIGRRGADWDLLAAGAALQAELGTVSP* |
Ga0075273_100650891 | 3300005902 | Rice Paddy Soil | GVGRRSGLPVSVSLVGAPGADWDLLAAGTALQAELGTVSP* |
Ga0081455_104109741 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RSGLPVSVSLIGRPGSDWDLLAWGTALQDELGTVAPP* |
Ga0066652_1005179653 | 3300006046 | Soil | GLGRRSGLPTSVSLIGRPGSDWDLLAAGAALQAELGAVSP* |
Ga0075026_1010298013 | 3300006057 | Watersheds | PSGIGRRSGLPVGVSLIGPAGSDWDLLAAGAILQSTI* |
Ga0074048_100714231 | 3300006581 | Soil | GVGRRSGLPVSVSLIARPGADWDLLAWGAALQAKLGTVTP* |
Ga0074063_133582511 | 3300006953 | Soil | ALPSGTGSRSVLPTSVSLIGPPHAEWDLLAAGAALQAGLGTRAT* |
Ga0099827_112962672 | 3300009090 | Vadose Zone Soil | PSGVGRRSGLPVSVSLIGAPGADWDLLAAGAALQDELGTVAP* |
Ga0111539_102181964 | 3300009094 | Populus Rhizosphere | FPVVSLPSGVGSHSGLPVSVSLIGAPGADWDLLSWGAALQDELGTVSP* |
Ga0105245_113577462 | 3300009098 | Miscanthus Rhizosphere | VSLPSGVGTRSGLPTGVSVVGAPGAEWDLLAWGAALQNELGTVAP* |
Ga0105245_114710472 | 3300009098 | Miscanthus Rhizosphere | VVSLPSGVGTRSGLPTGVSVVGAPGAEWDLLAWGAALQAELGTVSP* |
Ga0105245_130956711 | 3300009098 | Miscanthus Rhizosphere | GLPTGVSLVGAPGADWDVLAWGAALQAELGTVAP* |
Ga0075418_110014791 | 3300009100 | Populus Rhizosphere | WTGFPVVCLPSGVGSRSGLPVSVSLIGRPHADWDLLAWGAALQDELGTVGPR* |
Ga0075418_124933171 | 3300009100 | Populus Rhizosphere | LPSGVGSRSGLPVSVSLIGRPHADWDLLAWGAALQDELGTVEP* |
Ga0114129_113214942 | 3300009147 | Populus Rhizosphere | RSGLPTSVSLIGRPGAEWDLLSWGKALQDKLGTVSP* |
Ga0114129_119082872 | 3300009147 | Populus Rhizosphere | SGVGQRSGLPVSASLIGAPGADWDLLAWGAALQDELGTVAP* |
Ga0105243_118234222 | 3300009148 | Miscanthus Rhizosphere | VSLPSGVGGRSGLPVGVSLIGRPGSEWDLLAWAAALQGELGVVSPP* |
Ga0105248_111768111 | 3300009177 | Switchgrass Rhizosphere | GLPVSVSLIGAHRTEWELLDWGAALQDRLGTVSPP* |
Ga0105237_109197531 | 3300009545 | Corn Rhizosphere | LPSGVGTRSGLPTSVSLIGAPGADWDVLAWGAALQAELGTVAP* |
Ga0105249_105136981 | 3300009553 | Switchgrass Rhizosphere | LPSGVGTRSGLPTGVSVVGAPGAEWDLLAWGAALQAELGTVSP* |
Ga0105239_127949621 | 3300010375 | Corn Rhizosphere | FPSGVGSRSALPTGVSLIGAPGADWDLLAAGAALEAELRPVSYFGR* |
Ga0126381_1012828642 | 3300010376 | Tropical Forest Soil | VGSRSGLPVSVSLIGAPGADWDLLAWGTALQAELGVPAP* |
Ga0120167_10540571 | 3300012001 | Permafrost | VVALPSGVGSRSGLPTSVSLIGPPHADWNLLAAGAELQTVLGIPAP* |
Ga0137375_100420611 | 3300012360 | Vadose Zone Soil | LPSGVGRRSGLPVSVSLIGAPGADWDLLAAGAALQDELGTVTP* |
Ga0157308_101341521 | 3300012910 | Soil | RSGLPTGVSLVGAPGAEWDLLAWGSALQAELGTVSP* |
Ga0164241_100276456 | 3300012943 | Soil | GFPVVALPSGVGTRSGLPTSVSLIGAPGADWDVLAWGMALQAELGTVAP* |
Ga0164300_110343241 | 3300012951 | Soil | GVGSRSGLPVSVSLVGAPGVEWDLLGWGAALQDELGTVSPQ* |
Ga0126369_105169753 | 3300012971 | Tropical Forest Soil | LPAGVGGRSGLPVSVSLVGRPGSDWDLLAAGAVLQSQLG* |
Ga0164308_119690151 | 3300012985 | Soil | PSGVGARSGLPVSVSLIGAPGADWDLLAMGAALQDELGRVTPP* |
Ga0164307_105861101 | 3300012987 | Soil | SGLPVSVSLIGAHCTDWELLDWGAALQDRLGTVSPP* |
Ga0157373_103905092 | 3300013100 | Corn Rhizosphere | WDWTGFPVVALPSGVGRRSGLPTSVSLIGAPGTEWDLLAWGAALQDRLGTVSP* |
Ga0157372_130521682 | 3300013307 | Corn Rhizosphere | FPVVSLPSGVGGRSGMPVGVSIVGGPGTEGRLLEMGIALQDELGVPEPPVR* |
Ga0163163_109896131 | 3300014325 | Switchgrass Rhizosphere | GVGRRSGLPTSVSLIGAPGTEWDLLAWGAALQDRLGTVSP* |
Ga0182008_100453623 | 3300014497 | Rhizosphere | LTYYWNWTGFPVVASPAGPGPRSGLPTSASLIGRPGADWDLLAWGGAAYGR* |
Ga0173483_108121071 | 3300015077 | Soil | RSGLPVSVSLIGAHCTEWELLDWGAALQDRLGTVSPP* |
Ga0132255_1055829782 | 3300015374 | Arabidopsis Rhizosphere | RSGLPVSVSLIGAPGSEWDLLDWGAALQDRLGTVSP* |
Ga0182033_116349571 | 3300016319 | Soil | RSGLPVSVSLIGAPGADWDLLAWGAALQEALGTVSP |
Ga0187775_104138312 | 3300017939 | Tropical Peatland | SGVGAETGLPVSVSLVGAPGSDWELLALGAALQDELGVPSPPLAS |
Ga0190268_107092252 | 3300018466 | Soil | VVALPSGVGGRSGLPVGVSLIARNHSETELLEMGIALQDELGVPEPPGF |
Ga0173479_108054762 | 3300019362 | Soil | PVVSLPSGLGSASRLPVSVSLIGPPGSEWDLLEWGSTLQAELGMIAP |
Ga0206354_108801032 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LGTRSGLPTSVSLIGPPGTEWDLLAAGTVLERELGPVSQ |
Ga0210381_103207862 | 3300021078 | Groundwater Sediment | PVVALPSGVGRLSGLPVSVSLIGAPGADWDLLAAGAALQDELGTVAP |
Ga0247790_101550532 | 3300022915 | Soil | LPSGVGRHSGLPVSVSLIGAPGSDWDLLAWGAALQNELGTVAP |
Ga0247756_11326011 | 3300023078 | Plant Litter | LPSGVGKRSGLPTSVSLIGAPGADWDVLAWGTALQADLGTVTP |
Ga0247754_10466441 | 3300023102 | Soil | GFPVVALPSGVGARSGLPTSVSLIGAPGADWDVLAWGTALQAELGTVSP |
Ga0209751_101546524 | 3300025327 | Soil | WDWTGFPVVALPSGVGRRSGLPVSVSLIGAPGADWDLLAAGAALQAELGTVAP |
Ga0207688_104355192 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ALPAGLGRRSGLPVGVSLVGRPGADWDLLAWGAALQDRLGTVSP |
Ga0207671_107364111 | 3300025914 | Corn Rhizosphere | LPSGVGTRSGLPTSVSLIGAPGADWDVLAWGAALQAELGTVAP |
Ga0207657_109487092 | 3300025919 | Corn Rhizosphere | RSGLPTSVSLIGPPGTEWDLLAAGTVLERELGPVSQ |
Ga0207652_105059701 | 3300025921 | Corn Rhizosphere | FPVVAFPSGVGSRSALPTGVSLIGAPGAEWDLLAAGAALEAELRPVSYLDR |
Ga0207687_115490061 | 3300025927 | Miscanthus Rhizosphere | VAFPSGVGSRSALPTGVSLIGAPGADWDVLAAGAALEAELRPMSYFGR |
Ga0207690_106215051 | 3300025932 | Corn Rhizosphere | VALPSGVGTRSGLPTSVSLIGAPGADWDVLAWGAALQAELGTVAP |
Ga0207669_105086252 | 3300025937 | Miscanthus Rhizosphere | RSGLPVSVSLIGAHCTEWELLDWGAALQDRLGTVSPP |
Ga0207691_105360401 | 3300025940 | Miscanthus Rhizosphere | GQRSGLPVGVSLIGAPGSDWDLLAAGAALQDELGTVEP |
Ga0207691_110724611 | 3300025940 | Miscanthus Rhizosphere | SGLPTGVSLIGAPGADWDVLAWGAALQAELGTVSP |
Ga0207661_109340802 | 3300025944 | Corn Rhizosphere | FPVVSLPSGVGTRSGLPTGVSVVGAPGAEWDLLAWGAALQAELGTVSP |
Ga0207679_120866051 | 3300025945 | Corn Rhizosphere | SLPSGVGTRSGLPTGVSLVGAPGAEWDLLAWGAALQAELGTVAP |
Ga0207712_118986641 | 3300025961 | Switchgrass Rhizosphere | SACRLPVSVSVIGAPGSEWDLLAWGAALQADLGTVSP |
Ga0208527_10150881 | 3300025990 | Rice Paddy Soil | SGLPVSVSLVGAPGADWDLLAAGTALQAELGTVSP |
Ga0207678_102943093 | 3300026067 | Corn Rhizosphere | IGSRSGLPTGVSLIGAPGADWDLLAAGATLEARLGPVPYAGR |
Ga0207678_111006602 | 3300026067 | Corn Rhizosphere | MHPDNTNGIPLIGAPGADWDVLAWGAALQAELGTVSP |
Ga0207676_109703472 | 3300026095 | Switchgrass Rhizosphere | SGVGRHSGLPVSVSLIGPPGADWDLLEWGARLQDELGTVTPP |
Ga0207676_124298681 | 3300026095 | Switchgrass Rhizosphere | RSGLPVSVSLIGAPGSEWDLLDWGAALQDRLGTVSP |
Ga0207981_10447021 | 3300027560 | Soil | PSGVGSRSGLPTSVSLIGPPGAEWDLLAAGAALQDELGEVTPP |
Ga0209382_107678612 | 3300027909 | Populus Rhizosphere | FPVVALPSGVGQRSGLPVSVSLIGAPGADWDLLAWGAQLQDELGTVAP |
(restricted) Ga0233417_101053853 | 3300028043 | Sediment | VLPSGVGSRSGLPVSVSLIGAPGADWDLLAWGAALQDRLGTVSP |
Ga0268266_121754392 | 3300028379 | Switchgrass Rhizosphere | WDWTGFPVVSLPSGVGGRSGMPVGVSIVGGPGTEGRLLEMGIALQDELGVPEPPVR |
Ga0247822_106127971 | 3300028592 | Soil | GFPVVSLPSGVGKRSGLPTSVSLIGAPGADWDVLAWGTALQGELGTVSP |
Ga0307299_100796041 | 3300028793 | Soil | SGLPVSVSLVGAQGADWDLLDWGAKLQDELGTVSPP |
Ga0307503_104666321 | 3300028802 | Soil | PVVALPSGIGSRSGLPASVSLIGPPNAEWDLLAAGSALQERLGTANLAAI |
Ga0247824_106258111 | 3300028809 | Soil | FPVVSLPSGVGTRSGLPTGVSLVGAPGAEWDLLAWGAGLQAELGTVSP |
Ga0307289_100317121 | 3300028875 | Soil | TGFPVVSLPSGVGRHSRLPVSVSLVGAPGADWDLLGWGAKLQDELGTVSPP |
Ga0268386_100879331 | 3300030619 | Soil | CLPSGVGSRSGLPVSVSLIGRPHADWDLLAWGAALQDELGTVEP |
Ga0265327_105021831 | 3300031251 | Rhizosphere | SGVGSRSGLPVSVSLVGAPGAEWDLLGWGGALQAELGTVSP |
Ga0318516_100163236 | 3300031543 | Soil | DWTGFPVVALPSGVGARSGLPVSVSLIGAPGADWDLLAWGAALQEALGTVSP |
Ga0318560_102366991 | 3300031682 | Soil | PSGVGSRSGLPVSVSMIGAPGTDWDLLAWGTALQDELGAPAP |
Ga0318552_103165292 | 3300031782 | Soil | PVVALPSGVGSRSGLPVSVSLVAAPGAEWDLLAWGASLQDELGVPST |
Ga0318512_103545832 | 3300031846 | Soil | PSGVGSRSGLPVSVSLVAAPGAEWDLLAWGASLQDELGVPST |
Ga0310907_107133731 | 3300031847 | Soil | LPSGVGARSGLPTSVSLIGAPGADWDVLAWGAALQAELGTVSP |
Ga0310892_103779321 | 3300031858 | Soil | PSGVGRRSGLPTSVSLIGAPGADWDVLAWGTALQVELGTVTP |
Ga0306925_114351042 | 3300031890 | Soil | GVGARSGLPVSVSLIGAPGADWDLLAWGAALQEALGTVSP |
Ga0308174_105790781 | 3300031939 | Soil | SRSGLPTSVSLIGPAGRDFDLLGAGVALESELGSVAA |
Ga0310885_107743132 | 3300031943 | Soil | PVVALPSGVGRRSGLPTSVSLIGAPGADWDVLAWGTALQVELGTVTP |
Ga0308176_112638993 | 3300031996 | Soil | FPSGVGSRSALPTGVSLIGAPGADWDLLAAGAALEAELRPMSYFGR |
Ga0318553_106605161 | 3300032068 | Soil | PSGVGSRSGLPVSVSLIGARGADWDLLAWGRSLEAALGSVTP |
Ga0335085_120434382 | 3300032770 | Soil | VALPSGVGSRSGLPASVSLIGPAGADWNLLAAGAALQAELGTVSP |
Ga0335082_1000841912 | 3300032782 | Soil | SGLPTSVSLIGARGADWDLLAWGSALEAELGEVTPP |
Ga0335070_108583011 | 3300032829 | Soil | AVALPSGTGPRSGLPASVSLIGPPGADWDLLAAGAALQDALG |
Ga0335084_117840202 | 3300033004 | Soil | GVGSRSGLPVSVSLIGAPGSDWELLAWGAALQANLDTVAP |
Ga0335077_122066362 | 3300033158 | Soil | VALPAGVGSRSGLPVSVSLIGAPGSDFDLLAWGSALERELGSVSPS |
Ga0326726_112695121 | 3300033433 | Peat Soil | GVGRRSGLPVSVSLIGAPGADWDLLAAGAALQDELGTVTP |
Ga0314865_149692_498_620 | 3300033806 | Peatland | RSGLPVGVSLVGPPGRDFDALAAGVELQGELGPIAAALPR |
⦗Top⦘ |