NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087144

Metagenome / Metatranscriptome Family F087144

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087144
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 47 residues
Representative Sequence MNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLVDDGMMGAR
Number of Associated Samples 99
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 44.55 %
% of genes from short scaffolds (< 2000 bps) 65.45 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(27.273 % of family members)
Environment Ontology (ENVO) Unclassified
(45.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.909 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 76.09%    β-sheet: 0.00%    Coil/Unstructured: 23.91%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF01510Amidase_2 40.91
PF13419HAD_2 24.55
PF00877NLPC_P60 10.00
PF00903Glyoxalase 3.64
PF07690MFS_1 2.73
PF01380SIS 2.73
PF16123HAGH_C 2.73
PF03702AnmK 1.82
PF12681Glyoxalase_2 1.82
PF01925TauE 0.91
PF00106adh_short 0.91
PF12697Abhydrolase_6 0.91
PF13458Peripla_BP_6 0.91
PF13561adh_short_C2 0.91
PF03741TerC 0.91
PF13738Pyr_redox_3 0.91
PF03480DctP 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 10.00
COG23771,6-Anhydro-N-acetylmuramate kinaseCell wall/membrane/envelope biogenesis [M] 1.82
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.91
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573028|GS313G0146KB_1112079519660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum886Open in IMG/M
3300000101|DelMOSum2010_c10010031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum6145Open in IMG/M
3300000224|SI34jun09_10mDRAFT_1055629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300001346|JGI20151J14362_10001798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum15374Open in IMG/M
3300001353|JGI20159J14440_10181627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria589Open in IMG/M
3300001935|GOS2223_1014718All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300001941|GOS2219_1028225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum991Open in IMG/M
3300003216|JGI26079J46598_1018664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1836Open in IMG/M
3300003345|JGI26080J50196_1016840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1934Open in IMG/M
3300003346|JGI26081J50195_1000101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum34842Open in IMG/M
3300003410|JGI26086J50260_1008945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum3980Open in IMG/M
3300003427|JGI26084J50262_1007230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum4771Open in IMG/M
3300003427|JGI26084J50262_1020903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2068Open in IMG/M
3300003621|JGI26083J51738_10105475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300004279|Ga0066605_10238576All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300006025|Ga0075474_10021671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2323Open in IMG/M
3300006027|Ga0075462_10059090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum1213Open in IMG/M
3300006027|Ga0075462_10119753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium813Open in IMG/M
3300006621|Ga0101441_107464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum7746Open in IMG/M
3300007956|Ga0105741_1021997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1599Open in IMG/M
3300008012|Ga0075480_10261382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum891Open in IMG/M
3300009024|Ga0102811_1052511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1538Open in IMG/M
3300009054|Ga0102826_1113919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300009071|Ga0115566_10361069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum844Open in IMG/M
3300009080|Ga0102815_10442488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum724Open in IMG/M
3300009172|Ga0114995_10034301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2958Open in IMG/M
3300009442|Ga0115563_1112362All Organisms → cellular organisms → Bacteria → Proteobacteria1144Open in IMG/M
3300009472|Ga0115554_1287668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum652Open in IMG/M
3300009507|Ga0115572_10120879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1555Open in IMG/M
3300010389|Ga0136549_10119166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum1219Open in IMG/M
3300010883|Ga0133547_10034920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria12265Open in IMG/M
3300013010|Ga0129327_10011457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum4849Open in IMG/M
3300013010|Ga0129327_10685438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria573Open in IMG/M
3300016742|Ga0182052_1388593All Organisms → cellular organisms → Bacteria → Proteobacteria1036Open in IMG/M
3300016776|Ga0182046_1539227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum4419Open in IMG/M
3300017783|Ga0181379_1265249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300017818|Ga0181565_10182224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1452Open in IMG/M
3300017818|Ga0181565_10314603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1048Open in IMG/M
3300017824|Ga0181552_10150222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1242Open in IMG/M
3300017950|Ga0181607_10213792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1126Open in IMG/M
3300017950|Ga0181607_10214712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1123Open in IMG/M
3300017951|Ga0181577_10040518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum3347Open in IMG/M
3300017968|Ga0181587_10017725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum5516Open in IMG/M
3300017985|Ga0181576_10435137All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300018036|Ga0181600_10265972All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300018041|Ga0181601_10214153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1121Open in IMG/M
3300018048|Ga0181606_10189683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1203Open in IMG/M
3300018049|Ga0181572_10262654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1106Open in IMG/M
3300019756|Ga0194023_1029780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1108Open in IMG/M
3300020051|Ga0181555_1002652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum14636Open in IMG/M
3300020052|Ga0181554_1064140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1904Open in IMG/M
3300020052|Ga0181554_1123186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1179Open in IMG/M
3300020053|Ga0181595_10028838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum3405Open in IMG/M
3300020166|Ga0206128_1000541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria42490Open in IMG/M
3300020168|Ga0181588_10082323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1772Open in IMG/M
3300020176|Ga0181556_1121498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1133Open in IMG/M
3300020177|Ga0181596_10034765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum3207Open in IMG/M
3300020184|Ga0181573_10187735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1124Open in IMG/M
3300020187|Ga0206130_10050800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2937Open in IMG/M
3300020189|Ga0181578_10202880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium987Open in IMG/M
3300020385|Ga0211677_10022429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum3142Open in IMG/M
3300020404|Ga0211659_10386910All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300021347|Ga0213862_10231350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium651Open in IMG/M
3300021371|Ga0213863_10049119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2200Open in IMG/M
3300021373|Ga0213865_10417951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300021373|Ga0213865_10446304All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300021378|Ga0213861_10067287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2235Open in IMG/M
3300021425|Ga0213866_10442273All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300021957|Ga0222717_10015524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum5187Open in IMG/M
3300021957|Ga0222717_10440045All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300021960|Ga0222715_10004701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum11767Open in IMG/M
3300021960|Ga0222715_10515511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300021961|Ga0222714_10654140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300022900|Ga0255771_1001938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria21482Open in IMG/M
3300022907|Ga0255775_1007135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum8089Open in IMG/M
3300022909|Ga0255755_1057476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum1879Open in IMG/M
(restricted) 3300022920|Ga0233426_10077109All Organisms → cellular organisms → Bacteria → Proteobacteria1518Open in IMG/M
(restricted) 3300022920|Ga0233426_10164958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria929Open in IMG/M
3300022921|Ga0255765_1054336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2334Open in IMG/M
3300023087|Ga0255774_10048884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2580Open in IMG/M
(restricted) 3300023109|Ga0233432_10000804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum30091Open in IMG/M
3300023273|Ga0255763_1043615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2343Open in IMG/M
3300024191|Ga0228636_1134690All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300024250|Ga0228677_1041067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum873Open in IMG/M
(restricted) 3300024264|Ga0233444_10447510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300024314|Ga0228657_1097842All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300024318|Ga0233400_1097960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300024335|Ga0228672_1044625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1411Open in IMG/M
3300024348|Ga0244776_10961682All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300025608|Ga0209654_1077509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria943Open in IMG/M
3300025621|Ga0209504_1055009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum1195Open in IMG/M
3300025636|Ga0209136_1001390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum16028Open in IMG/M
3300025684|Ga0209652_1000606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria30375Open in IMG/M
3300025694|Ga0209406_1006365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum6650Open in IMG/M
3300025695|Ga0209653_1001369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum19719Open in IMG/M
3300025803|Ga0208425_1011923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2397Open in IMG/M
3300025822|Ga0209714_1019257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum2690Open in IMG/M
3300025849|Ga0209603_1244921All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300025876|Ga0209223_10438440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300025886|Ga0209632_10122003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum1481Open in IMG/M
3300025886|Ga0209632_10477088All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300025897|Ga0209425_10087772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1889Open in IMG/M
3300026479|Ga0228622_1071048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium756Open in IMG/M
3300027751|Ga0208304_10011358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum3722Open in IMG/M
3300028115|Ga0233450_10002771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria16987Open in IMG/M
3300028135|Ga0228606_1081390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria842Open in IMG/M
3300031519|Ga0307488_10636970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300031621|Ga0302114_10183716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium892Open in IMG/M
3300031773|Ga0315332_10413379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria860Open in IMG/M
3300031851|Ga0315320_10919822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh27.27%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine12.73%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater11.82%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.27%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine5.45%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.55%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.55%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.55%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.64%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.73%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.73%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.82%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.82%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.82%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.91%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.91%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.91%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.91%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.91%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.91%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.91%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.91%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573028Estuarine microbial communities from Columbia River, sample from South Channel ETM site, CMGS313-FOS-0p8-ETM-15mEnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001353Pelagic Microbial community sample from North Sea - COGITO 998_met_09EnvironmentalOpen in IMG/M
3300001935Marine microbial communities from Northern Gulf of Maine, Canada - GS007EnvironmentalOpen in IMG/M
3300001941Marine microbial communities from Browns Bank, Gulf of Maine - GS003EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003345Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNAEnvironmentalOpen in IMG/M
3300003346Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNAEnvironmentalOpen in IMG/M
3300003410Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNAEnvironmentalOpen in IMG/M
3300003427Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNAEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006621Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time pointEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300020051Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020052Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020053Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020168Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300022907Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaGEnvironmentalOpen in IMG/M
3300022909Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaGEnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022921Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaGEnvironmentalOpen in IMG/M
3300023087Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023273Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaGEnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024250Seawater microbial communities from Monterey Bay, California, United States - 58D_rEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024314Seawater microbial communities from Monterey Bay, California, United States - 70DEnvironmentalOpen in IMG/M
3300024318Seawater microbial communities from Monterey Bay, California, United States - 46DEnvironmentalOpen in IMG/M
3300024335Seawater microbial communities from Monterey Bay, California, United States - 90DEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026479Seawater microbial communities from Monterey Bay, California, United States - 26DEnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300028135Seawater microbial communities from Monterey Bay, California, United States - 7DEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GS313G0146KB_000167002189573028Marine EstuarineMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGAQ
DelMOSum2010_1001003153300000101MarineMNAAFTCAMICLNVAARLWHGFAAKENALNQNCHIGLVDDGMMGAR*
SI34jun09_10mDRAFT_105562913300000224MarineMNAAFTCAMICLNVAARLWHEFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ*
JGI20151J14362_10001798153300001346Pelagic MarineMNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLVDDGMMGAR*
JGI20159J14440_1018162723300001353Pelagic MarineMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR*
GOS2223_101471833300001935MarineMNAAFICAMICMNEAGRLWHGFTTKENAINQNCHMGLIYGGMMGARCDEYELDE*
GOS2219_102822523300001941MarineMNAAFTCAMICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR*
JGI26079J46598_101866443300003216MarineMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYG
JGI26080J50196_101684023300003345MarineMNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGAR*
JGI26081J50195_1000101143300003346MarineMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ*
JGI26086J50260_100894553300003410MarineMNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGRAIR*
JGI26084J50262_100723013300003427MarinePMNAAFTCAMICLNXAARLWHGFATKENAINQNCHIGLVDDGMMGAR*
JGI26084J50262_102090343300003427MarineMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGAQ*
JGI26083J51738_1010547523300003621MarineMNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGM
Ga0066605_1023857613300004279MarineMNAAFTCAMICLNLAGRLWHGFTTKENAINQNCHMGLISGGMMGARCDEYELDE*
Ga0075474_1002167123300006025AqueousMNAAFTCAMICLNVAARLWHGFAAKENAMNQNCHIGLVDDCMMGAR*
Ga0075462_1005909013300006027AqueousICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA*
Ga0075462_1011975313300006027AqueousMNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGVKVNKNWTNESC*
Ga0101441_10746433300006621Marine Surface WaterMNAAFTCAMICLNAAARLWHGIAAKENAINKNCHIGLINDGMMGAR*
Ga0105741_102199723300007956Estuary WaterMNAAFTCAMICLNAAGRLWHGFTTKENAINQNCHMGRIYGGMMGARCDEYELDE*
Ga0075480_1026138223300008012AqueousMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA*
Ga0102811_105251133300009024EstuarineMNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLADDGMMGAR*
Ga0102826_111391913300009054EstuarineMNAAFTCAMICLNAACRLWHGFAAKENAIRQNWHIALIYGGMMGVYGGMMGAQ*
Ga0115566_1036106923300009071Pelagic MarineMICLNVAARLWHGFAAKENAINQNCHIGLIDGGMMGARCDEYELDE*
Ga0102815_1044248823300009080EstuarineMNAAFTCAMICLNVAARLWHEFAAKENVINQNCHIGLVDDGMIGGAIW*
Ga0114995_1003430133300009172MarineMNAAFTCAMICLNAATRLWHGFAAKENATNQNCHIGLIDDGMMGARCDEYELDE*
Ga0115563_111236233300009442Pelagic MarineMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHTALIYGGMMGVYGGMMGAQ*
Ga0115554_128766823300009472Pelagic MarineMNAAFTCAMICLNVAARLWHGFAAKENAINHDCYIGLIDGGMMGARCDEYELDE*
Ga0115572_1012087913300009507Pelagic MarineWHEYFPINAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLIDGGMMGAMR*
Ga0136549_1011916623300010389Marine Methane Seep SedimentMNAAFTCAMICLNAACRLWHGFAAKENAICQNCHIALIYGGMMGAQ*
Ga0133547_1003492033300010883MarineMNAAFTCAMICLNAATRLWHGFAAKENATNQNCHIGLIDNGMMGARCDEYELDE*
Ga0129327_1001145743300013010Freshwater To Marine Saline GradientMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGAQ*
Ga0129327_1068543823300013010Freshwater To Marine Saline GradientMNAAFTCAMICLNVAARLLHGFTAKENAINQNCHIDHIDDGMMGAR*
Ga0182052_138859333300016742Salt MarshLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR
Ga0182046_153922743300016776Salt MarshMNAAFTCAIICLNVAAGLLHGFTAKENAINQNCHIGHIDDGMMGAR
Ga0181379_126524923300017783SeawaterMNAAFTCAMICLNAAARLWHGFAAKENAINLNRHIGLVDGGIMGA
Ga0181565_1018222413300017818Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHI
Ga0181565_1031460313300017818Salt MarshHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA
Ga0181552_1015022223300017824Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR
Ga0181607_1021379213300017950Salt MarshEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR
Ga0181607_1021471213300017950Salt MarshEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR
Ga0181577_1004051833300017951Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA
Ga0181587_1001772583300017968Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR
Ga0181576_1043513733300017985Salt MarshMNAAFTCAIICLNVAARLLHGFTTKENAINQNCHIGHIDDGMMGAR
Ga0181600_1026597233300018036Salt MarshMNAAFTCAMICLNAAGRLWHGFTAKENAINQNCHIALIYGGMMGVYGGMMGAQ
Ga0181601_1021415313300018041Salt MarshAFTCAIICLNVAARLLHGFTAKENAINQNCHISLVDDGMMRA
Ga0181606_1018968313300018048Salt MarshMNAAFTCAMICLNAAARLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ
Ga0181572_1026265433300018049Salt MarshAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR
Ga0194023_102978023300019756FreshwaterMNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLVDDGMMGAR
Ga0181555_1002652103300020051Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGRIDDGMMGAR
Ga0181554_106414013300020052Salt MarshWHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR
Ga0181554_112318633300020052Salt MarshWHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR
Ga0181595_1002883813300020053Salt MarshWHEYVPMNAAFTCAIICLNVAARLLHGFTTKENAINQNCHIGHIDDGMMGAR
Ga0206128_1000541273300020166SeawaterMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGAQ
Ga0181588_1008232333300020168Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHVGLIDDGMMGAR
Ga0181556_112149813300020176Salt MarshWHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA
Ga0181596_1003476553300020177Salt MarshNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR
Ga0181573_1018773533300020184Salt MarshHEYFPMNAAFTCAIICLNVAARLLHGFTTKENAINQNCHIGHIDDGMMGAR
Ga0206130_1005080043300020187SeawaterMNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGVKVNKNWTR
Ga0181578_1020288013300020189Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGM
Ga0211677_1002242943300020385MarineMNAAFTCAMICLNAAGRLWHGFTTKENATNQNCHMGLIYGGMMGTRCDEYELDE
Ga0211659_1038691023300020404MarineMNAAFTCAMICLNVAAQLWHGFAAKENAINQNCHIGLIDDGMLGAR
Ga0213862_1023135023300021347SeawaterMNAAFTCAMICLNVAARLWHGFAAKENALNQNCHIGLVDDGMM
Ga0213863_1004911923300021371SeawaterMICLNVAARLWHGFAAKENAINQNCHIGLIDGGMMGARCDEYELDE
Ga0213865_1041795123300021373SeawaterMNAAFTCAMICLNVAARLWHGFAAKENALNQNCHIGLVDDGMMGAR
Ga0213865_1044630423300021373SeawaterAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA
Ga0213861_1006728723300021378SeawaterMNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGVKVNKNWTNESC
Ga0213866_1044227323300021425SeawaterMNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGA
Ga0222717_1001552433300021957Estuarine WaterMNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGAR
Ga0222717_1044004513300021957Estuarine WaterCLNTAARLWHGFAAKENAINQSCHIGLVDDGMMGAR
Ga0222715_10004701143300021960Estuarine WaterICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGAR
Ga0222715_1051551113300021960Estuarine WaterMNAAFTCAMIWLNAAARLWHGFAAKENAINQNCHIGLIG
Ga0222714_1065414023300021961Estuarine WaterMNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGDK
Ga0255771_100193813300022900Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIG
Ga0255775_1007135113300022907Salt MarshAAFTCAIICLNVAAGLLHGFTAKENAINQNCHIGHIDDGMMGAR
Ga0255755_105747643300022909Salt MarshYCPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA
(restricted) Ga0233426_1007710933300022920SeawaterMNAAFTCAMICLNAAGRLWHGFTTKENAINQNCHMGRIDGGMMGARCDEYELDE
(restricted) Ga0233426_1016495833300022920SeawaterAAFTCAMICSNAAARLWHGFAAKENAINQNRHIGLIDNGIMGAR
Ga0255765_105433613300022921Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMM
Ga0255774_1004888443300023087Salt MarshWHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHLGLVDDGMMGA
(restricted) Ga0233432_10000804163300023109SeawaterMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ
Ga0255763_104361553300023273Salt MarshMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGA
Ga0228636_113469023300024191SeawaterMNAAFTCAMICLNVAARLWHGFAAKENAINQNYHIGLIDGGMMGAMR
Ga0228677_104106723300024250SeawaterLHEYFPINAAFTCAMICLNVAARLWHGFAAKENAINQNYHIGLIDGGMMGAMR
(restricted) Ga0233444_1044751013300024264SeawaterMNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIG
Ga0228657_109784223300024314SeawaterMNAAFTCAMICLNAAARLWHGFAAKENAINQSCHIGLVDDGIMGARLGKYELDE
Ga0233400_109796013300024318SeawaterMNAAFTCAMICLNAAARLWHGFAAKENAINQSCHIGLVDDG
Ga0228672_104462533300024335SeawaterMNAAFTCAMICLNAAGRLWHGFTTKENAINQNCHMGRIYGGMMGARCDEYELDE
Ga0244776_1096168223300024348EstuarineMNAAFTCAMICLNVAARLWHEFAAKENAINQNCHIGLVDDGMIGGAIW
Ga0209654_107750913300025608MarineAMICLNAACRLWHGFAAKENAIHQNCHIALIYGDMMGAQ
Ga0209504_105500933300025621Pelagic MarineHEYFPMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ
Ga0209136_1001390163300025636MarineFPMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGAQ
Ga0209652_1000606293300025684MarineMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMG
Ga0209406_100636533300025694Pelagic MarineMNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLVDDCMMGAR
Ga0209653_1001369163300025695MarineMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGVYGGMMGAQ
Ga0208425_101192333300025803AqueousMNAAFTCAMICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR
Ga0209714_101925723300025822Pelagic MarineMNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGDKVNKNWTNESC
Ga0209603_124492113300025849Pelagic MarineWHEYFPMNAAFTCAMICLNEAGRLWHGITTKENAINQNCHMGLIYGGMMGARCDEYELDE
Ga0209223_1043844023300025876Pelagic MarineMNAAFTCAMICLNEAGRLWHGITTKENAINQNCHMGLIYGGMMGARCDEYELDE
Ga0209632_1012200313300025886Pelagic MarineCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGAQ
Ga0209632_1047708813300025886Pelagic MarinePMNAAFTCAMICSNATARLWHGFAAKENAINQNRHIGLIDNGIMGAR
Ga0209425_1008777213300025897Pelagic MarinePMNAAFTCAMICSNAAARLWHGFAAKENAINQNRHIGLIDNGIMGAR
Ga0228622_107104823300026479SeawaterMNAAFTCAMICLNAGGRLWHGFTTKENAINQNCHMSLIYGG
Ga0208304_1001135863300027751EstuarineCLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ
Ga0233450_1000277113300028115Salt MarshNAAFTCAIICLNVAARLLHGFTTKENAINQNCHIGHIDDGMMGAR
Ga0228606_108139033300028135SeawaterICLNAAARLWHGFAAKENTIDQNCHIGLIDGGMMGAMR
Ga0307488_1063697013300031519Sackhole BrineMNAAFTCAMICLNAATRLWHGFAAKENATNQNCHIGLIDNGMMGARCDEYELDE
Ga0302114_1018371623300031621MarineMNAAFTCAMICLNAATRLWHGFAAKENATNQNCHIGLIDNGIMGAR
Ga0315332_1041337913300031773SeawaterMNAAFTCAMICLNVAARLWHGFAAKENAIDQNCHIGLIDGGMMGAMR
Ga0315320_1091982223300031851SeawaterMNAAFTCAMICLNAAARLWHGFAAKENAINQSCHIGLVDDGMMGAR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.