| Basic Information | |
|---|---|
| Family ID | F087144 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLVDDGMMGAR |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 44.55 % |
| % of genes from short scaffolds (< 2000 bps) | 65.45 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (27.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.909 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 76.09% β-sheet: 0.00% Coil/Unstructured: 23.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01510 | Amidase_2 | 40.91 |
| PF13419 | HAD_2 | 24.55 |
| PF00877 | NLPC_P60 | 10.00 |
| PF00903 | Glyoxalase | 3.64 |
| PF07690 | MFS_1 | 2.73 |
| PF01380 | SIS | 2.73 |
| PF16123 | HAGH_C | 2.73 |
| PF03702 | AnmK | 1.82 |
| PF12681 | Glyoxalase_2 | 1.82 |
| PF01925 | TauE | 0.91 |
| PF00106 | adh_short | 0.91 |
| PF12697 | Abhydrolase_6 | 0.91 |
| PF13458 | Peripla_BP_6 | 0.91 |
| PF13561 | adh_short_C2 | 0.91 |
| PF03741 | TerC | 0.91 |
| PF13738 | Pyr_redox_3 | 0.91 |
| PF03480 | DctP | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 10.00 |
| COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573028|GS313G0146KB_1112079519660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 886 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10010031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 6145 | Open in IMG/M |
| 3300000224|SI34jun09_10mDRAFT_1055629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300001346|JGI20151J14362_10001798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 15374 | Open in IMG/M |
| 3300001353|JGI20159J14440_10181627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300001935|GOS2223_1014718 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300001941|GOS2219_1028225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 991 | Open in IMG/M |
| 3300003216|JGI26079J46598_1018664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1836 | Open in IMG/M |
| 3300003345|JGI26080J50196_1016840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1934 | Open in IMG/M |
| 3300003346|JGI26081J50195_1000101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 34842 | Open in IMG/M |
| 3300003410|JGI26086J50260_1008945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3980 | Open in IMG/M |
| 3300003427|JGI26084J50262_1007230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 4771 | Open in IMG/M |
| 3300003427|JGI26084J50262_1020903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2068 | Open in IMG/M |
| 3300003621|JGI26083J51738_10105475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300004279|Ga0066605_10238576 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300006025|Ga0075474_10021671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2323 | Open in IMG/M |
| 3300006027|Ga0075462_10059090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1213 | Open in IMG/M |
| 3300006027|Ga0075462_10119753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
| 3300006621|Ga0101441_107464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 7746 | Open in IMG/M |
| 3300007956|Ga0105741_1021997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1599 | Open in IMG/M |
| 3300008012|Ga0075480_10261382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 891 | Open in IMG/M |
| 3300009024|Ga0102811_1052511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1538 | Open in IMG/M |
| 3300009054|Ga0102826_1113919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300009071|Ga0115566_10361069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 844 | Open in IMG/M |
| 3300009080|Ga0102815_10442488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 724 | Open in IMG/M |
| 3300009172|Ga0114995_10034301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2958 | Open in IMG/M |
| 3300009442|Ga0115563_1112362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1144 | Open in IMG/M |
| 3300009472|Ga0115554_1287668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 652 | Open in IMG/M |
| 3300009507|Ga0115572_10120879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1555 | Open in IMG/M |
| 3300010389|Ga0136549_10119166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1219 | Open in IMG/M |
| 3300010883|Ga0133547_10034920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12265 | Open in IMG/M |
| 3300013010|Ga0129327_10011457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 4849 | Open in IMG/M |
| 3300013010|Ga0129327_10685438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300016742|Ga0182052_1388593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
| 3300016776|Ga0182046_1539227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 4419 | Open in IMG/M |
| 3300017783|Ga0181379_1265249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300017818|Ga0181565_10182224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1452 | Open in IMG/M |
| 3300017818|Ga0181565_10314603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1048 | Open in IMG/M |
| 3300017824|Ga0181552_10150222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1242 | Open in IMG/M |
| 3300017950|Ga0181607_10213792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1126 | Open in IMG/M |
| 3300017950|Ga0181607_10214712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1123 | Open in IMG/M |
| 3300017951|Ga0181577_10040518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3347 | Open in IMG/M |
| 3300017968|Ga0181587_10017725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 5516 | Open in IMG/M |
| 3300017985|Ga0181576_10435137 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300018036|Ga0181600_10265972 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300018041|Ga0181601_10214153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1121 | Open in IMG/M |
| 3300018048|Ga0181606_10189683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1203 | Open in IMG/M |
| 3300018049|Ga0181572_10262654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1106 | Open in IMG/M |
| 3300019756|Ga0194023_1029780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1108 | Open in IMG/M |
| 3300020051|Ga0181555_1002652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 14636 | Open in IMG/M |
| 3300020052|Ga0181554_1064140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1904 | Open in IMG/M |
| 3300020052|Ga0181554_1123186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1179 | Open in IMG/M |
| 3300020053|Ga0181595_10028838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3405 | Open in IMG/M |
| 3300020166|Ga0206128_1000541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 42490 | Open in IMG/M |
| 3300020168|Ga0181588_10082323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1772 | Open in IMG/M |
| 3300020176|Ga0181556_1121498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
| 3300020177|Ga0181596_10034765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3207 | Open in IMG/M |
| 3300020184|Ga0181573_10187735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1124 | Open in IMG/M |
| 3300020187|Ga0206130_10050800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2937 | Open in IMG/M |
| 3300020189|Ga0181578_10202880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 987 | Open in IMG/M |
| 3300020385|Ga0211677_10022429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3142 | Open in IMG/M |
| 3300020404|Ga0211659_10386910 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300021347|Ga0213862_10231350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300021371|Ga0213863_10049119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2200 | Open in IMG/M |
| 3300021373|Ga0213865_10417951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300021373|Ga0213865_10446304 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300021378|Ga0213861_10067287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2235 | Open in IMG/M |
| 3300021425|Ga0213866_10442273 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300021957|Ga0222717_10015524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 5187 | Open in IMG/M |
| 3300021957|Ga0222717_10440045 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300021960|Ga0222715_10004701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 11767 | Open in IMG/M |
| 3300021960|Ga0222715_10515511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300021961|Ga0222714_10654140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300022900|Ga0255771_1001938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 21482 | Open in IMG/M |
| 3300022907|Ga0255775_1007135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 8089 | Open in IMG/M |
| 3300022909|Ga0255755_1057476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 1879 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10077109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10164958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
| 3300022921|Ga0255765_1054336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2334 | Open in IMG/M |
| 3300023087|Ga0255774_10048884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2580 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10000804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 30091 | Open in IMG/M |
| 3300023273|Ga0255763_1043615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2343 | Open in IMG/M |
| 3300024191|Ga0228636_1134690 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300024250|Ga0228677_1041067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 873 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10447510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300024314|Ga0228657_1097842 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300024318|Ga0233400_1097960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300024335|Ga0228672_1044625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1411 | Open in IMG/M |
| 3300024348|Ga0244776_10961682 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025608|Ga0209654_1077509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300025621|Ga0209504_1055009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1195 | Open in IMG/M |
| 3300025636|Ga0209136_1001390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 16028 | Open in IMG/M |
| 3300025684|Ga0209652_1000606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 30375 | Open in IMG/M |
| 3300025694|Ga0209406_1006365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 6650 | Open in IMG/M |
| 3300025695|Ga0209653_1001369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 19719 | Open in IMG/M |
| 3300025803|Ga0208425_1011923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2397 | Open in IMG/M |
| 3300025822|Ga0209714_1019257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 2690 | Open in IMG/M |
| 3300025849|Ga0209603_1244921 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300025876|Ga0209223_10438440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300025886|Ga0209632_10122003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum | 1481 | Open in IMG/M |
| 3300025886|Ga0209632_10477088 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025897|Ga0209425_10087772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1889 | Open in IMG/M |
| 3300026479|Ga0228622_1071048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300027751|Ga0208304_10011358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum | 3722 | Open in IMG/M |
| 3300028115|Ga0233450_10002771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 16987 | Open in IMG/M |
| 3300028135|Ga0228606_1081390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300031519|Ga0307488_10636970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300031621|Ga0302114_10183716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300031773|Ga0315332_10413379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 860 | Open in IMG/M |
| 3300031851|Ga0315320_10919822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 27.27% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 12.73% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 11.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.27% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 5.45% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.55% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.55% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.55% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.73% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.91% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.91% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.91% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.91% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.91% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573028 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, CMGS313-FOS-0p8-ETM-15m | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000224 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10m | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001935 | Marine microbial communities from Northern Gulf of Maine, Canada - GS007 | Environmental | Open in IMG/M |
| 3300001941 | Marine microbial communities from Browns Bank, Gulf of Maine - GS003 | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003410 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006621 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time point | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300016742 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020052 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020168 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023273 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG | Environmental | Open in IMG/M |
| 3300024191 | Seawater microbial communities from Monterey Bay, California, United States - 45D | Environmental | Open in IMG/M |
| 3300024250 | Seawater microbial communities from Monterey Bay, California, United States - 58D_r | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024318 | Seawater microbial communities from Monterey Bay, California, United States - 46D | Environmental | Open in IMG/M |
| 3300024335 | Seawater microbial communities from Monterey Bay, California, United States - 90D | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025694 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028135 | Seawater microbial communities from Monterey Bay, California, United States - 7D | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS313G0146KB_00016700 | 2189573028 | Marine Estuarine | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGAQ |
| DelMOSum2010_100100315 | 3300000101 | Marine | MNAAFTCAMICLNVAARLWHGFAAKENALNQNCHIGLVDDGMMGAR* |
| SI34jun09_10mDRAFT_10556291 | 3300000224 | Marine | MNAAFTCAMICLNVAARLWHEFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ* |
| JGI20151J14362_1000179815 | 3300001346 | Pelagic Marine | MNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLVDDGMMGAR* |
| JGI20159J14440_101816272 | 3300001353 | Pelagic Marine | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR* |
| GOS2223_10147183 | 3300001935 | Marine | MNAAFICAMICMNEAGRLWHGFTTKENAINQNCHMGLIYGGMMGARCDEYELDE* |
| GOS2219_10282252 | 3300001941 | Marine | MNAAFTCAMICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR* |
| JGI26079J46598_10186644 | 3300003216 | Marine | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYG |
| JGI26080J50196_10168402 | 3300003345 | Marine | MNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGAR* |
| JGI26081J50195_100010114 | 3300003346 | Marine | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ* |
| JGI26086J50260_10089455 | 3300003410 | Marine | MNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGRAIR* |
| JGI26084J50262_10072301 | 3300003427 | Marine | PMNAAFTCAMICLNXAARLWHGFATKENAINQNCHIGLVDDGMMGAR* |
| JGI26084J50262_10209034 | 3300003427 | Marine | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGAQ* |
| JGI26083J51738_101054752 | 3300003621 | Marine | MNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGM |
| Ga0066605_102385761 | 3300004279 | Marine | MNAAFTCAMICLNLAGRLWHGFTTKENAINQNCHMGLISGGMMGARCDEYELDE* |
| Ga0075474_100216712 | 3300006025 | Aqueous | MNAAFTCAMICLNVAARLWHGFAAKENAMNQNCHIGLVDDCMMGAR* |
| Ga0075462_100590901 | 3300006027 | Aqueous | ICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA* |
| Ga0075462_101197531 | 3300006027 | Aqueous | MNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGVKVNKNWTNESC* |
| Ga0101441_1074643 | 3300006621 | Marine Surface Water | MNAAFTCAMICLNAAARLWHGIAAKENAINKNCHIGLINDGMMGAR* |
| Ga0105741_10219972 | 3300007956 | Estuary Water | MNAAFTCAMICLNAAGRLWHGFTTKENAINQNCHMGRIYGGMMGARCDEYELDE* |
| Ga0075480_102613822 | 3300008012 | Aqueous | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA* |
| Ga0102811_10525113 | 3300009024 | Estuarine | MNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLADDGMMGAR* |
| Ga0102826_11139191 | 3300009054 | Estuarine | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNWHIALIYGGMMGVYGGMMGAQ* |
| Ga0115566_103610692 | 3300009071 | Pelagic Marine | MICLNVAARLWHGFAAKENAINQNCHIGLIDGGMMGARCDEYELDE* |
| Ga0102815_104424882 | 3300009080 | Estuarine | MNAAFTCAMICLNVAARLWHEFAAKENVINQNCHIGLVDDGMIGGAIW* |
| Ga0114995_100343013 | 3300009172 | Marine | MNAAFTCAMICLNAATRLWHGFAAKENATNQNCHIGLIDDGMMGARCDEYELDE* |
| Ga0115563_11123623 | 3300009442 | Pelagic Marine | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHTALIYGGMMGVYGGMMGAQ* |
| Ga0115554_12876682 | 3300009472 | Pelagic Marine | MNAAFTCAMICLNVAARLWHGFAAKENAINHDCYIGLIDGGMMGARCDEYELDE* |
| Ga0115572_101208791 | 3300009507 | Pelagic Marine | WHEYFPINAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLIDGGMMGAMR* |
| Ga0136549_101191662 | 3300010389 | Marine Methane Seep Sediment | MNAAFTCAMICLNAACRLWHGFAAKENAICQNCHIALIYGGMMGAQ* |
| Ga0133547_100349203 | 3300010883 | Marine | MNAAFTCAMICLNAATRLWHGFAAKENATNQNCHIGLIDNGMMGARCDEYELDE* |
| Ga0129327_100114574 | 3300013010 | Freshwater To Marine Saline Gradient | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGAQ* |
| Ga0129327_106854382 | 3300013010 | Freshwater To Marine Saline Gradient | MNAAFTCAMICLNVAARLLHGFTAKENAINQNCHIDHIDDGMMGAR* |
| Ga0182052_13885933 | 3300016742 | Salt Marsh | LNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR |
| Ga0182046_15392274 | 3300016776 | Salt Marsh | MNAAFTCAIICLNVAAGLLHGFTAKENAINQNCHIGHIDDGMMGAR |
| Ga0181379_12652492 | 3300017783 | Seawater | MNAAFTCAMICLNAAARLWHGFAAKENAINLNRHIGLVDGGIMGA |
| Ga0181565_101822241 | 3300017818 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHI |
| Ga0181565_103146031 | 3300017818 | Salt Marsh | HEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA |
| Ga0181552_101502222 | 3300017824 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR |
| Ga0181607_102137921 | 3300017950 | Salt Marsh | EYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR |
| Ga0181607_102147121 | 3300017950 | Salt Marsh | EYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR |
| Ga0181577_100405183 | 3300017951 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA |
| Ga0181587_100177258 | 3300017968 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR |
| Ga0181576_104351373 | 3300017985 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTTKENAINQNCHIGHIDDGMMGAR |
| Ga0181600_102659723 | 3300018036 | Salt Marsh | MNAAFTCAMICLNAAGRLWHGFTAKENAINQNCHIALIYGGMMGVYGGMMGAQ |
| Ga0181601_102141531 | 3300018041 | Salt Marsh | AFTCAIICLNVAARLLHGFTAKENAINQNCHISLVDDGMMRA |
| Ga0181606_101896831 | 3300018048 | Salt Marsh | MNAAFTCAMICLNAAARLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ |
| Ga0181572_102626543 | 3300018049 | Salt Marsh | AAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR |
| Ga0194023_10297802 | 3300019756 | Freshwater | MNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLVDDGMMGAR |
| Ga0181555_100265210 | 3300020051 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGRIDDGMMGAR |
| Ga0181554_10641401 | 3300020052 | Salt Marsh | WHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR |
| Ga0181554_11231863 | 3300020052 | Salt Marsh | WHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR |
| Ga0181595_100288381 | 3300020053 | Salt Marsh | WHEYVPMNAAFTCAIICLNVAARLLHGFTTKENAINQNCHIGHIDDGMMGAR |
| Ga0206128_100054127 | 3300020166 | Seawater | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGAQ |
| Ga0181588_100823233 | 3300020168 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHVGLIDDGMMGAR |
| Ga0181556_11214981 | 3300020176 | Salt Marsh | WHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA |
| Ga0181596_100347655 | 3300020177 | Salt Marsh | NAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGHIDDGMMGAR |
| Ga0181573_101877353 | 3300020184 | Salt Marsh | HEYFPMNAAFTCAIICLNVAARLLHGFTTKENAINQNCHIGHIDDGMMGAR |
| Ga0206130_100508004 | 3300020187 | Seawater | MNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGVKVNKNWTR |
| Ga0181578_102028801 | 3300020189 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGM |
| Ga0211677_100224294 | 3300020385 | Marine | MNAAFTCAMICLNAAGRLWHGFTTKENATNQNCHMGLIYGGMMGTRCDEYELDE |
| Ga0211659_103869102 | 3300020404 | Marine | MNAAFTCAMICLNVAAQLWHGFAAKENAINQNCHIGLIDDGMLGAR |
| Ga0213862_102313502 | 3300021347 | Seawater | MNAAFTCAMICLNVAARLWHGFAAKENALNQNCHIGLVDDGMM |
| Ga0213863_100491192 | 3300021371 | Seawater | MICLNVAARLWHGFAAKENAINQNCHIGLIDGGMMGARCDEYELDE |
| Ga0213865_104179512 | 3300021373 | Seawater | MNAAFTCAMICLNVAARLWHGFAAKENALNQNCHIGLVDDGMMGAR |
| Ga0213865_104463042 | 3300021373 | Seawater | AFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA |
| Ga0213861_100672872 | 3300021378 | Seawater | MNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGVKVNKNWTNESC |
| Ga0213866_104422732 | 3300021425 | Seawater | MNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGA |
| Ga0222717_100155243 | 3300021957 | Estuarine Water | MNAAFTCAMICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGAR |
| Ga0222717_104400451 | 3300021957 | Estuarine Water | CLNTAARLWHGFAAKENAINQSCHIGLVDDGMMGAR |
| Ga0222715_1000470114 | 3300021960 | Estuarine Water | ICLNAAARLWHGFATKENAINQNCHIGLVDDGMMGAR |
| Ga0222715_105155111 | 3300021960 | Estuarine Water | MNAAFTCAMIWLNAAARLWHGFAAKENAINQNCHIGLIG |
| Ga0222714_106541402 | 3300021961 | Estuarine Water | MNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGDK |
| Ga0255771_10019381 | 3300022900 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIG |
| Ga0255775_100713511 | 3300022907 | Salt Marsh | AAFTCAIICLNVAAGLLHGFTAKENAINQNCHIGHIDDGMMGAR |
| Ga0255755_10574764 | 3300022909 | Salt Marsh | YCPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLVDDGMMGA |
| (restricted) Ga0233426_100771093 | 3300022920 | Seawater | MNAAFTCAMICLNAAGRLWHGFTTKENAINQNCHMGRIDGGMMGARCDEYELDE |
| (restricted) Ga0233426_101649583 | 3300022920 | Seawater | AAFTCAMICSNAAARLWHGFAAKENAINQNRHIGLIDNGIMGAR |
| Ga0255765_10543361 | 3300022921 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMM |
| Ga0255774_100488844 | 3300023087 | Salt Marsh | WHEYFPMNAAFTCAIICLNVAARLLHGFTAKENAINQNCHLGLVDDGMMGA |
| (restricted) Ga0233432_1000080416 | 3300023109 | Seawater | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ |
| Ga0255763_10436155 | 3300023273 | Salt Marsh | MNAAFTCAIICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGA |
| Ga0228636_11346902 | 3300024191 | Seawater | MNAAFTCAMICLNVAARLWHGFAAKENAINQNYHIGLIDGGMMGAMR |
| Ga0228677_10410672 | 3300024250 | Seawater | LHEYFPINAAFTCAMICLNVAARLWHGFAAKENAINQNYHIGLIDGGMMGAMR |
| (restricted) Ga0233444_104475101 | 3300024264 | Seawater | MNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIG |
| Ga0228657_10978422 | 3300024314 | Seawater | MNAAFTCAMICLNAAARLWHGFAAKENAINQSCHIGLVDDGIMGARLGKYELDE |
| Ga0233400_10979601 | 3300024318 | Seawater | MNAAFTCAMICLNAAARLWHGFAAKENAINQSCHIGLVDDG |
| Ga0228672_10446253 | 3300024335 | Seawater | MNAAFTCAMICLNAAGRLWHGFTTKENAINQNCHMGRIYGGMMGARCDEYELDE |
| Ga0244776_109616822 | 3300024348 | Estuarine | MNAAFTCAMICLNVAARLWHEFAAKENAINQNCHIGLVDDGMIGGAIW |
| Ga0209654_10775091 | 3300025608 | Marine | AMICLNAACRLWHGFAAKENAIHQNCHIALIYGDMMGAQ |
| Ga0209504_10550093 | 3300025621 | Pelagic Marine | HEYFPMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ |
| Ga0209136_100139016 | 3300025636 | Marine | FPMNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGAQ |
| Ga0209652_100060629 | 3300025684 | Marine | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGGMMG |
| Ga0209406_10063653 | 3300025694 | Pelagic Marine | MNAAFTCAMICLNVAARLWHGFAAKENAINQNCHIGLVDDCMMGAR |
| Ga0209653_100136916 | 3300025695 | Marine | MNAAFTCAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGVYGGMMGAQ |
| Ga0208425_10119233 | 3300025803 | Aqueous | MNAAFTCAMICLNVAARLLHGFTAKENAINQNCHIGLIDDGMMGAR |
| Ga0209714_10192572 | 3300025822 | Pelagic Marine | MNAAFTCAMICSNAAARLWHGFAAKENAINQNCHIGLIDNGIMGGDKVNKNWTNESC |
| Ga0209603_12449211 | 3300025849 | Pelagic Marine | WHEYFPMNAAFTCAMICLNEAGRLWHGITTKENAINQNCHMGLIYGGMMGARCDEYELDE |
| Ga0209223_104384402 | 3300025876 | Pelagic Marine | MNAAFTCAMICLNEAGRLWHGITTKENAINQNCHMGLIYGGMMGARCDEYELDE |
| Ga0209632_101220031 | 3300025886 | Pelagic Marine | CAMICLNAACRLWHGFAAKENAIRQNCHIALIYGDMMGAQ |
| Ga0209632_104770881 | 3300025886 | Pelagic Marine | PMNAAFTCAMICSNATARLWHGFAAKENAINQNRHIGLIDNGIMGAR |
| Ga0209425_100877721 | 3300025897 | Pelagic Marine | PMNAAFTCAMICSNAAARLWHGFAAKENAINQNRHIGLIDNGIMGAR |
| Ga0228622_10710482 | 3300026479 | Seawater | MNAAFTCAMICLNAGGRLWHGFTTKENAINQNCHMSLIYGG |
| Ga0208304_100113586 | 3300027751 | Estuarine | CLNAACRLWHGFAAKENAIRQNCHIALIYGGMMGVYGGMMGAQ |
| Ga0233450_100027711 | 3300028115 | Salt Marsh | NAAFTCAIICLNVAARLLHGFTTKENAINQNCHIGHIDDGMMGAR |
| Ga0228606_10813903 | 3300028135 | Seawater | ICLNAAARLWHGFAAKENTIDQNCHIGLIDGGMMGAMR |
| Ga0307488_106369701 | 3300031519 | Sackhole Brine | MNAAFTCAMICLNAATRLWHGFAAKENATNQNCHIGLIDNGMMGARCDEYELDE |
| Ga0302114_101837162 | 3300031621 | Marine | MNAAFTCAMICLNAATRLWHGFAAKENATNQNCHIGLIDNGIMGAR |
| Ga0315332_104133791 | 3300031773 | Seawater | MNAAFTCAMICLNVAARLWHGFAAKENAIDQNCHIGLIDGGMMGAMR |
| Ga0315320_109198222 | 3300031851 | Seawater | MNAAFTCAMICLNAAARLWHGFAAKENAINQSCHIGLVDDGMMGAR |
| ⦗Top⦘ |