| Basic Information | |
|---|---|
| Family ID | F087137 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 94.55 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (86.364 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.74% β-sheet: 19.57% Coil/Unstructured: 58.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.73 % |
| Unclassified | root | N/A | 7.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10167181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300001282|B570J14230_10166753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300002835|B570J40625_100919187 | Not Available | 755 | Open in IMG/M |
| 3300005418|Ga0068881_1030331 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
| 3300005418|Ga0068881_1496783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300005419|Ga0068883_1549268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300005420|Ga0068879_1687186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300005565|Ga0068885_1067460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1016 | Open in IMG/M |
| 3300005565|Ga0068885_1861077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
| 3300006025|Ga0075474_10230557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300006030|Ga0075470_10088540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300006637|Ga0075461_10010369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3079 | Open in IMG/M |
| 3300006637|Ga0075461_10022678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2071 | Open in IMG/M |
| 3300006637|Ga0075461_10106795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300006734|Ga0098073_1023621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300006802|Ga0070749_10636956 | Not Available | 573 | Open in IMG/M |
| 3300006875|Ga0075473_10312424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300007363|Ga0075458_10243862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
| 3300007534|Ga0102690_1722366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
| 3300007538|Ga0099851_1084821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1217 | Open in IMG/M |
| 3300007538|Ga0099851_1125975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300007541|Ga0099848_1319820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300007544|Ga0102861_1054054 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300007960|Ga0099850_1330260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300007960|Ga0099850_1372898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300007973|Ga0105746_1040487 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
| 3300008264|Ga0114353_1240674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300008266|Ga0114363_1145877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300008266|Ga0114363_1200874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300008450|Ga0114880_1148370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300008450|Ga0114880_1189260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
| 3300010300|Ga0129351_1158972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300010354|Ga0129333_10437349 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300010354|Ga0129333_10840690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300010354|Ga0129333_10909152 | Not Available | 744 | Open in IMG/M |
| 3300010368|Ga0129324_10367686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300010370|Ga0129336_10580262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300011381|Ga0102688_1046776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300012012|Ga0153799_1034314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300012017|Ga0153801_1049945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300012970|Ga0129338_1296478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1851 | Open in IMG/M |
| 3300013372|Ga0177922_10637428 | Not Available | 709 | Open in IMG/M |
| 3300013372|Ga0177922_11043973 | Not Available | 774 | Open in IMG/M |
| 3300017747|Ga0181352_1002099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7426 | Open in IMG/M |
| 3300017766|Ga0181343_1162113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300019784|Ga0181359_1183312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| 3300020516|Ga0207935_1014829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300020554|Ga0208599_1047704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300021962|Ga0222713_10729387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300022176|Ga0212031_1006765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1508 | Open in IMG/M |
| 3300022176|Ga0212031_1051542 | Not Available | 692 | Open in IMG/M |
| 3300022179|Ga0181353_1092377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300022190|Ga0181354_1054507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
| 3300022198|Ga0196905_1191127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300022200|Ga0196901_1024833 | All Organisms → Viruses → Predicted Viral | 2378 | Open in IMG/M |
| 3300024355|Ga0255157_1021942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
| 3300024481|Ga0256330_1080275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300024484|Ga0256332_1035120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1077 | Open in IMG/M |
| 3300024490|Ga0255185_1009882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1374 | Open in IMG/M |
| 3300024503|Ga0255152_1045707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300024506|Ga0255168_1038828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300024550|Ga0255266_1043644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1090 | Open in IMG/M |
| 3300024557|Ga0255283_1027780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
| 3300024563|Ga0255236_1099905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300024570|Ga0255276_1053449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
| 3300024573|Ga0256337_1049268 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
| 3300024855|Ga0255281_1012836 | Not Available | 1668 | Open in IMG/M |
| 3300024857|Ga0256339_1056413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300024860|Ga0256344_1044489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
| 3300024865|Ga0256340_1054360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
| 3300024867|Ga0255267_1051911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300025075|Ga0209615_108727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300025630|Ga0208004_1070771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300025630|Ga0208004_1075442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300025759|Ga0208899_1253367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300025815|Ga0208785_1140662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300025889|Ga0208644_1343936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300026455|Ga0255155_1052624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300026569|Ga0255277_1057450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
| 3300026571|Ga0255289_1051846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300027131|Ga0255066_1060247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300027785|Ga0209246_10243013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300027798|Ga0209353_10234247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300027808|Ga0209354_10021426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2578 | Open in IMG/M |
| 3300028530|Ga0255279_1029108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300029930|Ga0119944_1009905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1441 | Open in IMG/M |
| 3300031758|Ga0315907_10459037 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300031787|Ga0315900_10696095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300031787|Ga0315900_10796535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300031857|Ga0315909_10487311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300031857|Ga0315909_10562447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300031857|Ga0315909_10628041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300031951|Ga0315904_10041613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5220 | Open in IMG/M |
| 3300031951|Ga0315904_10719432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300031951|Ga0315904_11154198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300032116|Ga0315903_10850599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300033995|Ga0335003_0456144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300034022|Ga0335005_0255403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300034062|Ga0334995_0424277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300034066|Ga0335019_0469817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300034073|Ga0310130_0123718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300034073|Ga0310130_0131395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300034073|Ga0310130_0170880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300034093|Ga0335012_0305957 | Not Available | 805 | Open in IMG/M |
| 3300034093|Ga0335012_0522806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300034103|Ga0335030_0596098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
| 3300034110|Ga0335055_0299443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300034122|Ga0335060_0332526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300034284|Ga0335013_0863931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300034357|Ga0335064_0870314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.91% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 19.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.09% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.64% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.73% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.82% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.91% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.91% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.91% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.91% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005418 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005419 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300024550 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024563 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024855 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024860 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_101671813 | 3300000117 | Marine | LEASSIDYTIGTFSAPAVLAGTVGDLLSGEVSISVLSDWS* |
| B570J14230_101667533 | 3300001282 | Freshwater | KLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| B570J40625_1009191872 | 3300002835 | Freshwater | LINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0068881_10303314 | 3300005418 | Freshwater Lake | VNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0068881_14967832 | 3300005418 | Freshwater Lake | NIVNKLEASSLAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0068883_15492681 | 3300005419 | Freshwater Lake | NKLEASSIAYSIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS* |
| Ga0068879_16871861 | 3300005420 | Freshwater Lake | KLEASSIAYSIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS* |
| Ga0068885_10674601 | 3300005565 | Freshwater Lake | LEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0068885_18610775 | 3300005565 | Freshwater Lake | SSIAYSIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS* |
| Ga0075474_102305571 | 3300006025 | Aqueous | LINIEDFYLNLVNKLEASSIAYSIGTFSAPAVLTGTAGDLLTGEVSISVLSDWS* |
| Ga0075470_100885401 | 3300006030 | Aqueous | NIVNKLEASNLAYSISTFSPPRVLTGTAGELLAGEVTISILSDWS* |
| Ga0075461_100103691 | 3300006637 | Aqueous | LEASNIAYTLGTFSSPAVLAGNTGDLLTGEVNISVLSDWS* |
| Ga0075461_100226786 | 3300006637 | Aqueous | NKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0075461_101067954 | 3300006637 | Aqueous | LNIVNKLEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS* |
| Ga0098073_10236214 | 3300006734 | Marine | EDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0070749_106369561 | 3300006802 | Aqueous | TAPMFDNQGNMINIEDFYLKIVTKLEASSIAYTIGTFSAPAVLTGTAGDLLTGEVSISVLSDWS* |
| Ga0075473_103124243 | 3300006875 | Aqueous | NIEDYYLAIVNKLEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS* |
| Ga0075458_102438623 | 3300007363 | Aqueous | NIEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGIAGDLLSGEVSISVLSDWS* |
| Ga0102690_17223664 | 3300007534 | Freshwater Lake | SIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0099851_10848215 | 3300007538 | Aqueous | EDYYLNIVNKLEASSIDYTIGTFSAPAVLAGTVGDLLSGEVSISVLSDWS* |
| Ga0099851_11259754 | 3300007538 | Aqueous | YLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0099848_13198203 | 3300007541 | Aqueous | IAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0102861_10540544 | 3300007544 | Estuarine | LINIEDFYLNIVNKLEASNLAYSLGNFTAPAVLQGTAGDLLSGEVTISVLSDWS* |
| Ga0099850_13302602 | 3300007960 | Aqueous | MFDNQGNLTNIEDFYLKIVQKLEASAIAYSIGNFSAPAVLTATAGDLLSGEVQISVLSDWS* |
| Ga0099850_13728983 | 3300007960 | Aqueous | NQGNLINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0105746_10404871 | 3300007973 | Estuary Water | NIEDFYLNIVNKLEASNLAYSLGNFTAPAVLQGTAGDLLSGEVTISVLSDWS* |
| Ga0114353_12406741 | 3300008264 | Freshwater, Plankton | DYYLNIVNKLEASSLAYTIGTFSAPAVLTGTVGDLLSGEVSISILSDWS* |
| Ga0114363_11458773 | 3300008266 | Freshwater, Plankton | DYYLNIVNKLEASNLAYSLGTFTAPAVLQGTAGELLSGEVTISILSDWS* |
| Ga0114363_12008741 | 3300008266 | Freshwater, Plankton | IEDFYLNVVNKLEASSIAYSIGNFSAPAVLTGTVGDLLSGEVQISVLSDWS* |
| Ga0114880_11483701 | 3300008450 | Freshwater Lake | EASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS* |
| Ga0114880_11892601 | 3300008450 | Freshwater Lake | IVNKLEASSIAYTIGTFSAPAVLTGTVGDLLSGEVQISVLSDWS* |
| Ga0129351_11589721 | 3300010300 | Freshwater To Marine Saline Gradient | IEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0129333_104373494 | 3300010354 | Freshwater To Marine Saline Gradient | EDYYLNIVNKLEASSIAYSIGTFSAPAVLTGVAGDLLSGEVTISVLSDWS* |
| Ga0129333_108406901 | 3300010354 | Freshwater To Marine Saline Gradient | IVLAPMFDNAGNLINIEDFYLNIVNKLETSSIAYTIGTFSAPAVLTGTVGDLLSGEVNISVLSDWS* |
| Ga0129333_109091524 | 3300010354 | Freshwater To Marine Saline Gradient | ASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0129324_103676863 | 3300010368 | Freshwater To Marine Saline Gradient | ANIEDYYLNIVNKLEASSIDYTIGTFSAPAVLAGTVGDLLSGEVSISVLSDWS* |
| Ga0129336_105802621 | 3300010370 | Freshwater To Marine Saline Gradient | SIAYSIGNFSAPAVLTGTVGDLLSGEVQISVLSDWS* |
| Ga0102688_10467761 | 3300011381 | Freshwater Lake | VNKLEASSLAYSIGTFTAPAVLQGTAGELLSGEVTISILSDWS* |
| Ga0153799_10343144 | 3300012012 | Freshwater | NIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0153801_10499453 | 3300012017 | Freshwater | LINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTTGDLLSGEVSISVLSDWS* |
| Ga0129338_12964781 | 3300012970 | Aqueous | KLEASNLAYSLGTFTAPAVLQGTAGELLSGEVTISILSDWS* |
| Ga0177922_106374281 | 3300013372 | Freshwater | LNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS* |
| Ga0177922_110439733 | 3300013372 | Freshwater | YYLNIVNKLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS* |
| Ga0181352_10020991 | 3300017747 | Freshwater Lake | NIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0181343_11621131 | 3300017766 | Freshwater Lake | INIEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0181359_11833121 | 3300019784 | Freshwater Lake | DYYLNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0207935_10148291 | 3300020516 | Freshwater | LEASSIAYSIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS |
| Ga0208599_10477041 | 3300020554 | Freshwater | VNKLEASTIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0222713_107293871 | 3300021962 | Estuarine Water | LNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0212031_10067655 | 3300022176 | Aqueous | ANIEDYYLNIVNKLEASSIDYTIGTFSAPAVLAGTVGDLLSGEVSISVLSDWS |
| Ga0212031_10515423 | 3300022176 | Aqueous | VNKLEASSIAYTIGTFSAPAVLSGAAGDLLTGEVSISVLSDWS |
| Ga0181353_10923771 | 3300022179 | Freshwater Lake | RKLEASNLAYSLGTFTAPAVLQGTAGELLSGEVTISILSDWS |
| Ga0181354_10545071 | 3300022190 | Freshwater Lake | GIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0196905_11911271 | 3300022198 | Aqueous | LEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0196901_10248334 | 3300022200 | Aqueous | MFDNQGNLTNIEDFYLRLVQLLDASSIAYTLGDFSAPAVLTATAGDLLSGEVTISVLSDW |
| Ga0255157_10219425 | 3300024355 | Freshwater | IAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS |
| Ga0256330_10802751 | 3300024481 | Freshwater | GNLINIEDFYLNIVNKLEASNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS |
| Ga0256332_10351201 | 3300024484 | Freshwater | EASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0255185_10098825 | 3300024490 | Freshwater | SSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0255152_10457071 | 3300024503 | Freshwater | LEASNIAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS |
| Ga0255168_10388284 | 3300024506 | Freshwater | YLNIVNKLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS |
| Ga0255266_10436444 | 3300024550 | Freshwater | EASNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS |
| Ga0255283_10277801 | 3300024557 | Freshwater | ENFYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0255236_10999051 | 3300024563 | Freshwater | KLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0255276_10534494 | 3300024570 | Freshwater | VNKLEASNLAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS |
| Ga0256337_10492685 | 3300024573 | Freshwater | LAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS |
| Ga0255281_10128365 | 3300024855 | Freshwater | DNQGTLINIEDYYLNIVNKLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS |
| Ga0256339_10564133 | 3300024857 | Freshwater | NLINIEDFYLNIVNKLEASNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS |
| Ga0256344_10444894 | 3300024860 | Freshwater | SNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS |
| Ga0256340_10543601 | 3300024865 | Freshwater | KLEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS |
| Ga0255267_10519111 | 3300024867 | Freshwater | KLEASNIAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS |
| Ga0209615_1087273 | 3300025075 | Freshwater | SIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0208004_10707714 | 3300025630 | Aqueous | DYYLNIVNKLEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS |
| Ga0208004_10754424 | 3300025630 | Aqueous | LEASNIAYTLGTFSSPAVLAGNTGDLLTGEVNISVLSDWS |
| Ga0208899_12533673 | 3300025759 | Aqueous | TNIEDFYLNIVNKLEASSLAYTIGTFSAPAVLTGTVGDLLSGEVSISVLSDWS |
| Ga0208785_11406621 | 3300025815 | Aqueous | LINIEDFYLNLVNKLEASSIAYSIGTFSAPAVLTGTAGDLLTGEVSISVLSDWS |
| Ga0208644_13439361 | 3300025889 | Aqueous | YLNIVNKLEASNLAYSLGNFTAPAVLQGTAGDLLSGEVTISVLSDWS |
| Ga0255155_10526243 | 3300026455 | Freshwater | NQGNLINIENYYLNIVNKLEASNIAYSLGTFTAPAVLSNTAGELLSGEVTISVLSDWS |
| Ga0255277_10574504 | 3300026569 | Freshwater | LEASNIAYSLGTFAAPAVLSNTAGELLSGEVTISVLSDWS |
| Ga0255289_10518461 | 3300026571 | Freshwater | NKLEASNLAYSLGTFTAPAVLNGTAGDLLSGEVTISVLSDWS |
| Ga0255066_10602471 | 3300027131 | Freshwater | LEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0209246_102430131 | 3300027785 | Freshwater Lake | YLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0209353_102342471 | 3300027798 | Freshwater Lake | DYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0209354_100214261 | 3300027808 | Freshwater Lake | LNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0255279_10291084 | 3300028530 | Freshwater | LEASNIAYSIGSFSAPAVLTGVAGDLLSGEVSISVLSDWS |
| Ga0119944_10099051 | 3300029930 | Aquatic | YLNIVNKLEASSLAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0315907_104590371 | 3300031758 | Freshwater | NIEDFYLNIVNKLEASNLAYSLGTFTAPAVLQGTAGDLLSGEVTISVLSDWS |
| Ga0315900_106960953 | 3300031787 | Freshwater | EASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS |
| Ga0315900_107965351 | 3300031787 | Freshwater | TNIEDFYLNIVNKLEASSIAYTIGTFSAPAVLTGTVGDLLSGEVQISVLSDWS |
| Ga0315909_104873114 | 3300031857 | Freshwater | QGNLINIEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0315909_105624471 | 3300031857 | Freshwater | SNLAYSLGTFTAPAVLQGTAGDLLSGEVTISVLSDWS |
| Ga0315909_106280413 | 3300031857 | Freshwater | QGNLINIEDYYLAIVNKLEASSIAYTIGTFSAPAVLTGVAGDLLSGEVSISVLSDWS |
| Ga0315904_100416138 | 3300031951 | Freshwater | INIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0315904_107194321 | 3300031951 | Freshwater | INIEDYYLNIVNKLEASNLAYSLGTFTAPAVLQGTAGELLSGEVTISILSDWS |
| Ga0315904_111541983 | 3300031951 | Freshwater | LNIVNKLEASSIAYTIGTFSAPAVLTGIAGDLLSGEVSISVLSDWS |
| Ga0315903_108505993 | 3300032116 | Freshwater | ASTLAYTIGTFSAPAVLSGTVGDLLSGEVQISVLSDWS |
| Ga0335003_0456144_371_535 | 3300033995 | Freshwater | LINIEDYYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0335005_0255403_914_1060 | 3300034022 | Freshwater | YYLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0334995_0424277_2_157 | 3300034062 | Freshwater | IEDYYLNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0335019_0469817_2_172 | 3300034066 | Freshwater | GNLINIEDYYLNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0310130_0123718_2_148 | 3300034073 | Fracking Water | FYLNIVNKLEASSLAYTIGTFSAPTVLTATAGDLLSGEVTISILSDWS |
| Ga0310130_0131395_1_132 | 3300034073 | Fracking Water | VQKLDASTIQYSLGTFSAPAVLSGTAGEMLTGEVTISVLSDWS |
| Ga0310130_0170880_1_117 | 3300034073 | Fracking Water | ASTLAYSIGTFSSPSVLTGTAGELLTGEVTISILSDWS |
| Ga0335012_0305957_633_803 | 3300034093 | Freshwater | GNLINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0335012_0522806_438_557 | 3300034093 | Freshwater | EASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0335030_0596098_515_679 | 3300034103 | Freshwater | LINIEDYYLNIVNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0335055_0299443_556_684 | 3300034110 | Freshwater | NKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0335060_0332526_678_821 | 3300034122 | Freshwater | YLNIVNKLEASSIAYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0335013_0863931_367_498 | 3300034284 | Freshwater | VNKLEASSIVYSIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| Ga0335064_0870314_2_175 | 3300034357 | Freshwater | QGNLINIEDYYLNIVNKLEASSIAYTIGTFSAPAVLTGTAGDLLSGEVSISVLSDWS |
| ⦗Top⦘ |