| Basic Information | |
|---|---|
| Family ID | F087109 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MAFLAWHIIAILTVMAGSFLIGYSIGKKDERVNYKFADKLKNIFKK |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 70.64 % |
| % of genes near scaffold ends (potentially truncated) | 38.18 % |
| % of genes from short scaffolds (< 2000 bps) | 76.36 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (90.909 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 67.39% β-sheet: 0.00% Coil/Unstructured: 32.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02839 | CBM_5_12 | 6.36 |
| PF01126 | Heme_oxygenase | 2.73 |
| PF04984 | Phage_sheath_1 | 0.91 |
| PF06841 | Phage_T4_gp19 | 0.91 |
| PF01391 | Collagen | 0.91 |
| PF05118 | Asp_Arg_Hydrox | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG3230 | Heme oxygenase | Inorganic ion transport and metabolism [P] | 2.73 |
| COG5398 | Heme oxygenase | Coenzyme transport and metabolism [H] | 2.73 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.91 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 90.91 % |
| All Organisms | root | All Organisms | 9.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 30.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 13.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.64% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 9.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.73% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.73% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1001113875 | 3300002835 | Freshwater | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKDIFKK* |
| JGI25908J49247_100071292 | 3300003277 | Freshwater Lake | MAFLTWHLIAIITVMAASFLIGYSTGKKDEKVNYKFVDKLKNIFRK* |
| JGI25908J49247_100180022 | 3300003277 | Freshwater Lake | MAFLAWHIIAILTVMAVSFLIGYSLSKKEDRINYNYIDRLKNLFKR* |
| JGI25910J50241_100002395 | 3300003388 | Freshwater Lake | MXFLTWHLIAIITVMAASFLIGYSTGKKDEKVNYKFVDKLKNIFRK* |
| JGI25910J50241_100490112 | 3300003388 | Freshwater Lake | MAFLAWHIIAILTVMAVSFLIGYSLSKKEDRINYNYIDRLKNLFKRIIYYDNCI* |
| JGI25910J50241_101351262 | 3300003388 | Freshwater Lake | MAFLTWHILAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLKDIFKK* |
| JGI25910J50241_101464241 | 3300003388 | Freshwater Lake | NKWFSSNNNNRRRNILMVFLTWHLIAIITVMAASFLIGYSIGKKDEKVNYKFVDKLKNIFKK* |
| JGI25909J50240_11135662 | 3300003393 | Freshwater Lake | KWFSSNNNNRRRNILMAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKDIFKK* |
| JGI25907J50239_10173881 | 3300003394 | Freshwater Lake | MAFLTWHLIAIITVMAASFLIGYSTGKKDEKVNYKFVDKLKNIFRK |
| JGI25920J50251_100234252 | 3300003404 | Freshwater Lake | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRKNYNYIDRLKDIFKK* |
| JGI25914J50564_101525911 | 3300003429 | Freshwater Lake | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKNIFKK* |
| Ga0063233_102802851 | 3300003986 | Freshwater Lake | IIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNILKK* |
| Ga0066177_100031871 | 3300004096 | Freshwater Lake | FLTWHLIAIITVMAASFLIGYSTGKKDEKVNYKFVDKLKNIFRK* |
| Ga0066182_100836972 | 3300004125 | Freshwater Lake | MAFLTWHLIAIITVMAASFLIGYSTGKKDEKVNYKFVDKL |
| Ga0007746_13871302 | 3300004763 | Freshwater Lake | IIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKNIFKK* |
| Ga0007752_111669282 | 3300004789 | Freshwater Lake | MAFLTWHILAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLKNIFKK* |
| Ga0007751_114062781 | 3300004794 | Freshwater Lake | HIIAILTVMAVSFLIGYSLSKKEDRINYNYIDRLKNLFKR* |
| Ga0070374_102405823 | 3300005517 | Freshwater Lake | MVFLTWHLIAIITVMAVSFLIGYSIGKKDEKVNYKFVDKLKNIFKK* |
| Ga0070374_105320872 | 3300005517 | Freshwater Lake | MAFLTWHILAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLKDIF |
| Ga0049083_100036687 | 3300005580 | Freshwater Lentic | MVFLTWHLIAIITVMAASFLIGYSIGKKDEKVNYKFVDKLKNIFKK* |
| Ga0049081_100021152 | 3300005581 | Freshwater Lentic | MIFLTWHLIAILTVMAASFLIGYSVGKKQDRRNYNYIDRLKNLFK* |
| Ga0049081_100187095 | 3300005581 | Freshwater Lentic | FLAWHILAILTVMAGSFLIGYSIGKKDERVNYKFADKLKNIFKK* |
| Ga0049081_101156674 | 3300005581 | Freshwater Lentic | ILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKNIFKK* |
| Ga0049081_101827663 | 3300005581 | Freshwater Lentic | AFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKDIFKK* |
| Ga0049081_103018982 | 3300005581 | Freshwater Lentic | MAFLAWHIIAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLKNIFKK* |
| Ga0049080_100397302 | 3300005582 | Freshwater Lentic | MAFLAWHIIAILTVMAVSFLIGYSLSKKEDRRNYNYIDRLKNIFKK* |
| Ga0049080_101121142 | 3300005582 | Freshwater Lentic | MAFLAWHIIAILTVMAGSFLIGYSIGKKDERVNYKFADKLKNIFKK* |
| Ga0049080_102747451 | 3300005582 | Freshwater Lentic | MAFLAWHILAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLKNIFKK* |
| Ga0079957_10395064 | 3300005805 | Lake | MAFLAWHLIAILTVMAGSFLIGYSVGKKEDRRNYNYIDKLKNLFKR* |
| Ga0079957_10879455 | 3300005805 | Lake | ILMAFLAWHIIAILTVMAGSFIIGYSIGKKDERINYKFTDKIKNILRK* |
| Ga0079957_11516054 | 3300005805 | Lake | ILMAFLAWHIIAILTVMAGSFIIGYSIGKKDERVNYKFADKLKNIFKK* |
| Ga0079301_10021476 | 3300006639 | Deep Subsurface | MVFLTWHLIAILTVMAVSFLIGYSVGKKEDRRNYNYIDRLKNLFKK* |
| Ga0079301_10069743 | 3300006639 | Deep Subsurface | MAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNIFKK* |
| Ga0079301_10163653 | 3300006639 | Deep Subsurface | MAFLAWHIIAILTVMAGSFIIGYSIGKKDEKLNYRFADKLKNIFKK* |
| Ga0079301_12168841 | 3300006639 | Deep Subsurface | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDR |
| Ga0079300_100490963 | 3300007162 | Deep Subsurface | MAFLAWHILAILTVMAGSFLIGYSIGKKDEKLNYRFADKLKNIFKK* |
| Ga0114351_11563893 | 3300008117 | Freshwater, Plankton | MAFLAWHIIAILTVMAGSFIIGYSIGKKDEKVNYKFADKLKNIFKK* |
| Ga0114974_100224252 | 3300009183 | Freshwater Lake | MAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNIFRK* |
| Ga0133913_100676345 | 3300010885 | Freshwater Lake | MAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNILKK* |
| Ga0133913_100868269 | 3300010885 | Freshwater Lake | LMAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNIFRK* |
| Ga0164293_103322492 | 3300013004 | Freshwater | MTFLTWHLIAILTVMAASFLIGYSIGKKDEKVNYKFVDKLKNIFKK* |
| Ga0164292_102795643 | 3300013005 | Freshwater | MAFLAWHIIAILTVMAASFLIGYSVGKKQDRVNYNYIDRLKDIFKK* |
| (restricted) Ga0172367_100311475 | 3300013126 | Freshwater | MAFLTWHIIAILTVMAGSFIIVYSIDKKDEKLNYRFADKLKNIFKK* |
| (restricted) Ga0172367_101194441 | 3300013126 | Freshwater | NNRRRNILMAFLAWHIIAILTVMAGSFIIGYSIGKKDERLNYKFTDKLKNILRK* |
| (restricted) Ga0172367_104042522 | 3300013126 | Freshwater | MAFLTWHIIAILTVMAGSFIIGYSIGKKDEKVNYKFTDKLKNILR |
| (restricted) Ga0172364_108107942 | 3300013129 | Sediment | NNNRRRNILMAFLTWHIIAILTVMAGSFIIGYSIGKKDEKVNYKFTDKLKNILRK* |
| (restricted) Ga0172373_101495801 | 3300013131 | Freshwater | MAFLAWHIIAILTVMAGSFIIGYSIGKKDERLNYKFTDKLKNILRK* |
| (restricted) Ga0172373_106432281 | 3300013131 | Freshwater | RNILMAFLAWHIIAILTVMAGSFIIGYSIGKKDERLNYKFTDKLKNILRK* |
| (restricted) Ga0172373_109325512 | 3300013131 | Freshwater | MAFLAWHIIAILTVMAGSFIIGYSIGKKDEKLNYKFTDKLKNILRK* |
| (restricted) Ga0172375_104329272 | 3300013137 | Freshwater | MAFLTWHIIAILTVMAGSFIIGYSIGKKDERLNYKFTDKLKNILRK* |
| Ga0181365_11687592 | 3300017736 | Freshwater Lake | SNHYNRWRNILMAFLAWHIIAILTVMAVSFLIGYSLSKKEDRINYNYIDRLKNLFKR |
| Ga0181349_12847342 | 3300017778 | Freshwater Lake | LAWHIIAILTVMAGSFLIGYSLGKKEDRKNYNYIDRLKDIFKK |
| Ga0181349_12855471 | 3300017778 | Freshwater Lake | KLFSNSWFSSNHYNRWRNILMAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNILKK |
| Ga0181348_10718652 | 3300017784 | Freshwater Lake | MAFLTWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKNIFKK |
| Ga0181348_10821312 | 3300017784 | Freshwater Lake | MVFLTWHLIAIITVMAASFLIGYSTGKKDEKVNYKFVDKLKNIFRK |
| Ga0181348_12314072 | 3300017784 | Freshwater Lake | AWHIIAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLKDIFKK |
| Ga0181355_13823452 | 3300017785 | Freshwater Lake | MVFLTWHLIAIITVMAASFLIGYSTGKKDEKVNYKFVDKLKNIFKK |
| Ga0181359_10137775 | 3300019784 | Freshwater Lake | MAFLTWHILAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLKDIFKK |
| Ga0194113_100086162 | 3300020074 | Freshwater Lake | MAFLTWHLIAILTVMAGSFLIGYSIGKKDEKSNYKFTDKIKNIFRK |
| Ga0211732_11624152 | 3300020141 | Freshwater | MAFLAWHIIAILTVMAVSFLIGYSIGKKDEKVNYKFIDKVKNILKK |
| Ga0211736_100695112 | 3300020151 | Freshwater | MIFLTWHLIAILTVMAASFLIGYSVGKKQDRRNYNYIDRLKNLFK |
| Ga0211736_100998882 | 3300020151 | Freshwater | MAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFIDKVKNILKK |
| Ga0211736_107524832 | 3300020151 | Freshwater | NRRRNILMAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNIFKK |
| Ga0211736_108201593 | 3300020151 | Freshwater | MAFLAWHILAILTVMAGSFIIGYSIGKKDERLNYKFTDKLKNILRK |
| Ga0211734_108639291 | 3300020159 | Freshwater | LTVMAGSFLIGYSLGKKEDRRNYDYINRLKNIFKK |
| Ga0211733_103603895 | 3300020160 | Freshwater | MAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFTDKLKNILRK |
| Ga0211733_104868122 | 3300020160 | Freshwater | MVFLTWHLIAIITVMAASFLIGYSIGKKDEKVNYKFVDKLKNIFKK |
| Ga0211733_105026611 | 3300020160 | Freshwater | NRRRNILMAFLAWHIIAILTVMAVSFLIGYSLSKKEDRINYNYIDRLKNLFKR |
| Ga0211733_107711411 | 3300020160 | Freshwater | AWHIIAILTVMAGSFLIGYSLGKKEDRRNYDYINRLKNIFKK |
| Ga0211726_100727252 | 3300020161 | Freshwater | MAFLAWHILAILTVMAGSFLIGYSIGKKDERVNYKFIDRFKNILRK |
| Ga0211735_108609922 | 3300020162 | Freshwater | MAFLTWHIIAILTVMAGSFIIGYSIGKKDERLNYKFTDKLKNILRK |
| Ga0211729_106731872 | 3300020172 | Freshwater | MTFLAWHILAILTVMAGSFLIGYSIGKKDERVNYKFIDRFKNILRK |
| Ga0211729_111695912 | 3300020172 | Freshwater | MVFLAWHLIAILTVMIASFLIGYSVGKKQDRRNYNYIDRLKNLFK |
| Ga0194124_103366052 | 3300020196 | Freshwater Lake | MAFLAWHIIAILTVMAGSFIIGYSIGKKDERLNYKFTDKLKNFLRK |
| Ga0211731_103705011 | 3300020205 | Freshwater | NRRRNILMAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFTDKLKNILRK |
| Ga0211731_110726521 | 3300020205 | Freshwater | MAFLTWHIIAILTVMAVSFLIGYSLSKKEDRINYNYIDRLKNLFKR |
| Ga0211731_112070891 | 3300020205 | Freshwater | WFSSYNNNRRRNILMAFLAWHIIAILTVMAVSFLIGYSMSKKEDRRNYNYIDRLKNIFKK |
| Ga0211731_115918811 | 3300020205 | Freshwater | RRRNILMAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFIDKVKNILKK |
| Ga0208090_10378501 | 3300020513 | Freshwater | FSSNNNNRRRNILMAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKDIFKK |
| Ga0208858_10194712 | 3300020524 | Freshwater | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDKLKDIFKK |
| Ga0208601_10352131 | 3300020532 | Freshwater | MAFLAWHIIAILTVMAASFLIGYSVGKKQDRVNYNYIDRLKDIFKK |
| Ga0194130_100023877 | 3300021376 | Freshwater Lake | MAFLAWHIIAILTVMAGSFIIGYSIGKKDERLNYKFTDKLKNILRK |
| Ga0181354_10676392 | 3300022190 | Freshwater Lake | MAFLAWHIIAILTVMAVSFLIGYSLSKKEDRINYNYIDRLKNLFKR |
| Ga0208009_10010725 | 3300027114 | Deep Subsurface | MVFLTWHLIAILTVMAVSFLIGYSVGKKEDRRNYNYIDRLKNLFKK |
| Ga0208009_10068473 | 3300027114 | Deep Subsurface | MAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNIFKK |
| Ga0255102_10197102 | 3300027144 | Freshwater | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKNIFKK |
| Ga0208788_10106905 | 3300027499 | Deep Subsurface | MAFLAWHIIAILTVMAGSFIIGYSIGKKDEKLNYRFADKLKNIFKK |
| Ga0208788_11398091 | 3300027499 | Deep Subsurface | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNY |
| Ga0208787_10457683 | 3300027518 | Deep Subsurface | MAFLAWHILAILTVMAGSFLIGYSIGKKDEKLNYRFADKLKNIFKK |
| Ga0209651_10739812 | 3300027581 | Freshwater Lake | MAFLTWHILAILTVMAVSFLIGYSLGKKEDRRNYN |
| Ga0208966_10203085 | 3300027586 | Freshwater Lentic | TWHILAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLKNIFKK |
| Ga0208966_10459394 | 3300027586 | Freshwater Lentic | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKDIFKK |
| Ga0208974_10257382 | 3300027608 | Freshwater Lentic | MAFLAWHIIAILTVMAVSFLIGYSLSKKEDRRNYNYIDRLKNIFKK |
| Ga0208974_10818183 | 3300027608 | Freshwater Lentic | IAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLKDIFKK |
| Ga0208942_11096281 | 3300027627 | Freshwater Lentic | MAFLTWHLIAIITVMAASFLIGYSTGKKDEKVNYKFVDKLKNIFKK |
| Ga0209135_10960161 | 3300027642 | Freshwater Lake | MAFLTWHILAILTVMAVSFLIGYSLGKKEDRRNYNYIDRLK |
| Ga0209356_10858411 | 3300027644 | Freshwater Lake | ITVMAASFLIGYSTGKKDEKVNYKFVDKLKNIFRK |
| Ga0209357_10483222 | 3300027656 | Freshwater Lake | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRRNYNYIDRLK |
| Ga0208975_10331815 | 3300027659 | Freshwater Lentic | ILAILTVMAGSFLIGYSIGKKDERVNYKFADKLKNIFKK |
| (restricted) Ga0247833_10198892 | 3300027730 | Freshwater | MAFLAWHILAILSVMAGSFIIGYSIGKKDEKLNYRFADKLKNIFKK |
| Ga0209355_12671323 | 3300027744 | Freshwater Lake | VFLTWHLIAIITVMAASFLIGYSIGKKDEKVNYKFVDKLKNIFKK |
| Ga0209355_12901512 | 3300027744 | Freshwater Lake | MAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNILKK |
| Ga0209296_11679163 | 3300027759 | Freshwater Lake | MAFLAWHIIAILTVMAGSFLIGYSIGKKDEKVNYKFADKLKNIFRK |
| Ga0209086_100026368 | 3300027770 | Freshwater Lake | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRKNYNYIDRLKDIFKK |
| (restricted) Ga0247843_11034071 | 3300028569 | Freshwater | MAFLAWHILAILTVMAGSFIIGYSIGKKDERLNYKFTDKIKNILRK |
| (restricted) Ga0247843_11336572 | 3300028569 | Freshwater | MAFLAWHILAILTVMAGSFIIGYSIGKKDERVNYKF |
| Ga0315909_100019507 | 3300031857 | Freshwater | MAFLAWHIIAILTVMAGSFIIGYSIGKKDEKVNYKFADKLKNIFKK |
| Ga0334996_0228555_669_809 | 3300033994 | Freshwater | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRVNYNYIDRLKNIFKK |
| Ga0335022_0604371_386_526 | 3300034095 | Freshwater | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRINYNYIDRLKNIFKK |
| Ga0335027_0377701_2_130 | 3300034101 | Freshwater | MAFLAWHIIAILTVMAGSFLIGYSLGKKEDRVNYNYIDRLKNI |
| ⦗Top⦘ |