| Basic Information | |
|---|---|
| Family ID | F087090 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 45 residues |
| Representative Sequence | DALALIREIKDEVKEISLRTLIAVSKVRASNKDWKDLATYMLTA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 99.09 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (61.818 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (14.546 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 2.73 |
| PF04255 | DUF433 | 0.91 |
| PF07460 | NUMOD3 | 0.91 |
| PF06941 | NT5C | 0.91 |
| PF00004 | AAA | 0.91 |
| PF01653 | DNA_ligase_aden | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.91 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.91 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.55 % |
| Unclassified | root | N/A | 25.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001836|RCM27_1019605 | Not Available | 709 | Open in IMG/M |
| 3300001847|RCM41_1002234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300001848|RCM47_1064131 | Not Available | 598 | Open in IMG/M |
| 3300001851|RCM31_10023104 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300001851|RCM31_10205544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 514 | Open in IMG/M |
| 3300003393|JGI25909J50240_1032082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1148 | Open in IMG/M |
| 3300003412|JGI25912J50252_10030720 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300005527|Ga0068876_10591983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300005582|Ga0049080_10137698 | Not Available | 821 | Open in IMG/M |
| 3300005584|Ga0049082_10115889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300005585|Ga0049084_10215196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 653 | Open in IMG/M |
| 3300005662|Ga0078894_11118421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 671 | Open in IMG/M |
| 3300005662|Ga0078894_11275701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300005662|Ga0078894_11760928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 506 | Open in IMG/M |
| 3300006072|Ga0007881_1071025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
| 3300006116|Ga0007807_1052271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 801 | Open in IMG/M |
| 3300006127|Ga0007805_1144429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300006641|Ga0075471_10274120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300006805|Ga0075464_10668141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300007617|Ga0102897_1197350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 603 | Open in IMG/M |
| 3300007621|Ga0102872_1142739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300007632|Ga0102894_1165128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300008113|Ga0114346_1019578 | All Organisms → Viruses → Predicted Viral | 4167 | Open in IMG/M |
| 3300008259|Ga0114841_1187199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 767 | Open in IMG/M |
| 3300008266|Ga0114363_1122645 | Not Available | 901 | Open in IMG/M |
| 3300008267|Ga0114364_1087421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1003 | Open in IMG/M |
| 3300008961|Ga0102887_1202735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300008962|Ga0104242_1005997 | All Organisms → Viruses → Predicted Viral | 2203 | Open in IMG/M |
| 3300008996|Ga0102831_1016962 | All Organisms → Viruses → Predicted Viral | 2509 | Open in IMG/M |
| 3300009080|Ga0102815_10480593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300009158|Ga0114977_10476512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 686 | Open in IMG/M |
| 3300009164|Ga0114975_10535122 | Not Available | 629 | Open in IMG/M |
| 3300009164|Ga0114975_10619298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 576 | Open in IMG/M |
| 3300009182|Ga0114959_10511336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300009183|Ga0114974_10666890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 568 | Open in IMG/M |
| 3300009684|Ga0114958_10251544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 873 | Open in IMG/M |
| 3300010158|Ga0114960_10486594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 594 | Open in IMG/M |
| 3300010370|Ga0129336_10590951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 593 | Open in IMG/M |
| 3300011011|Ga0139556_1011985 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300011268|Ga0151620_1233646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 549 | Open in IMG/M |
| 3300012012|Ga0153799_1047436 | Not Available | 795 | Open in IMG/M |
| 3300012665|Ga0157210_1011421 | All Organisms → Viruses → Predicted Viral | 1554 | Open in IMG/M |
| 3300012779|Ga0138284_1283081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300012933|Ga0157211_1014318 | Not Available | 806 | Open in IMG/M |
| 3300012933|Ga0157211_1020954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 644 | Open in IMG/M |
| 3300012933|Ga0157211_1022753 | Not Available | 614 | Open in IMG/M |
| 3300013014|Ga0164295_10647434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 815 | Open in IMG/M |
| 3300013295|Ga0170791_11460598 | Not Available | 3863 | Open in IMG/M |
| 3300013372|Ga0177922_10065724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 525 | Open in IMG/M |
| 3300014811|Ga0119960_1003189 | Not Available | 1075 | Open in IMG/M |
| 3300014962|Ga0134315_1064416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 563 | Open in IMG/M |
| 3300017761|Ga0181356_1242219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 517 | Open in IMG/M |
| 3300017774|Ga0181358_1286370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 506 | Open in IMG/M |
| 3300017774|Ga0181358_1291366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 500 | Open in IMG/M |
| 3300017777|Ga0181357_1124303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 966 | Open in IMG/M |
| 3300017777|Ga0181357_1136832 | Not Available | 910 | Open in IMG/M |
| 3300020151|Ga0211736_10464541 | Not Available | 614 | Open in IMG/M |
| 3300020172|Ga0211729_10672427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 627 | Open in IMG/M |
| 3300020601|Ga0181557_1029042 | All Organisms → Viruses → Predicted Viral | 3572 | Open in IMG/M |
| 3300020601|Ga0181557_1065091 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300020731|Ga0214170_1008319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2153 | Open in IMG/M |
| 3300021125|Ga0214211_1014740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 764 | Open in IMG/M |
| 3300021602|Ga0194060_10253755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 883 | Open in IMG/M |
| 3300021961|Ga0222714_10115680 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300021961|Ga0222714_10297612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 886 | Open in IMG/M |
| 3300021961|Ga0222714_10664369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300021963|Ga0222712_10020040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5594 | Open in IMG/M |
| 3300021963|Ga0222712_10283532 | Not Available | 1045 | Open in IMG/M |
| 3300021963|Ga0222712_10349430 | Not Available | 912 | Open in IMG/M |
| 3300023174|Ga0214921_10462182 | Not Available | 620 | Open in IMG/M |
| 3300024351|Ga0255141_1021539 | Not Available | 988 | Open in IMG/M |
| 3300024510|Ga0255187_1047783 | Not Available | 578 | Open in IMG/M |
| 3300024561|Ga0255288_1123329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300024564|Ga0255237_1002948 | All Organisms → Viruses → Predicted Viral | 3645 | Open in IMG/M |
| 3300024567|Ga0256307_1113161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 628 | Open in IMG/M |
| 3300024866|Ga0255272_1069941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300024866|Ga0255272_1181261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 521 | Open in IMG/M |
| 3300024866|Ga0255272_1184108 | Not Available | 517 | Open in IMG/M |
| 3300025426|Ga0208739_1003329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3610 | Open in IMG/M |
| 3300025635|Ga0208147_1085402 | Not Available | 776 | Open in IMG/M |
| 3300025896|Ga0208916_10357556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 637 | Open in IMG/M |
| 3300026568|Ga0255240_1079539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 733 | Open in IMG/M |
| 3300027128|Ga0255099_1064046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 564 | Open in IMG/M |
| 3300027141|Ga0255076_1060156 | Not Available | 638 | Open in IMG/M |
| 3300027206|Ga0208023_1074902 | Not Available | 539 | Open in IMG/M |
| 3300027254|Ga0208177_1108389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300027608|Ga0208974_1057773 | Not Available | 1100 | Open in IMG/M |
| 3300027608|Ga0208974_1135103 | Not Available | 636 | Open in IMG/M |
| 3300027708|Ga0209188_1285759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 555 | Open in IMG/M |
| 3300027732|Ga0209442_1019421 | All Organisms → Viruses → Predicted Viral | 3171 | Open in IMG/M |
| 3300027744|Ga0209355_1168486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300027744|Ga0209355_1289559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300027746|Ga0209597_1136751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
| 3300027785|Ga0209246_10112826 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300027805|Ga0209229_10225453 | Not Available | 836 | Open in IMG/M |
| 3300027805|Ga0209229_10507266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300027808|Ga0209354_10336515 | Not Available | 596 | Open in IMG/M |
| 3300027969|Ga0209191_1178937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 848 | Open in IMG/M |
| 3300028393|Ga0304728_1283166 | Not Available | 543 | Open in IMG/M |
| 3300031784|Ga0315899_10673467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300031857|Ga0315909_10430315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 935 | Open in IMG/M |
| 3300031951|Ga0315904_11452109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300031963|Ga0315901_10784866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → unclassified Sulfitobacter → Sulfitobacter sp. R18_1 | 693 | Open in IMG/M |
| 3300031963|Ga0315901_10917245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 621 | Open in IMG/M |
| 3300031963|Ga0315901_11097018 | Not Available | 547 | Open in IMG/M |
| 3300032116|Ga0315903_10766696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300032116|Ga0315903_10924346 | Not Available | 620 | Open in IMG/M |
| 3300033993|Ga0334994_0437498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300033994|Ga0334996_0038530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3021 | Open in IMG/M |
| 3300034105|Ga0335035_0365858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 829 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.55% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.91% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 10.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.27% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.36% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.45% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.55% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 4.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.64% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.64% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.82% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.82% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.82% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.91% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.91% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012933 | Freshwater microbial communities from Tributary to Mariposa, Ontario, Canada - S7 | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300021125 | Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024564 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024866 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027254 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM27_10196051 | 3300001836 | Marine Plankton | LIREVKDEAKEISLRTLISVAKIRAANPKDYKDLATYVLTN* |
| RCM41_10022344 | 3300001847 | Marine Plankton | LALIREVKDEASEISLRTLISVSKIRASNKDWKDLARYVLTN* |
| RCM47_10641311 | 3300001848 | Marine Plankton | FTTEYKRDALDLIRSLKEDAKEISLRTLISVTKIRASGNKNWKGMATYILCN* |
| RCM31_100231045 | 3300001851 | Marine Plankton | MDALALIREIANDAKEISLRTLISVTKIRSANKDWKEMATYLLTA* |
| RCM31_102055442 | 3300001851 | Marine Plankton | MPRCKSDALALIREIKDDVKEISLRTLIAVCKIRASNKDYRDLATYMLTA* |
| JGI25909J50240_10320826 | 3300003393 | Freshwater Lake | YDASIKSDALALIRAIKDDCKEISLRTLIAVSKVRASNPTDYKDLATYMLTA* |
| JGI25912J50252_100307201 | 3300003412 | Freshwater Lake | IRTIKNECSEISLRTLIAVAKIRASNKEWKDLATYMLTA* |
| Ga0068876_105919831 | 3300005527 | Freshwater Lake | DALALIRKIKSECKEISPRTLIAVSKVRASNKDWKDLATYMLTA* |
| Ga0049080_101376981 | 3300005582 | Freshwater Lentic | DALALIREVKDQAKEISLRTLISVAKIRAANPSDYKDLATYVLTN* |
| Ga0049082_101158894 | 3300005584 | Freshwater Lentic | PEYDTTIKADALKLIRSIKDDCSEISLRTLIAVAKIRASNKEWKDLATYMLTA* |
| Ga0049084_102151961 | 3300005585 | Freshwater Lentic | EYDTTIKNDALKLIRSIKDDCSEISLRTLIAVAKIRASNKEWKDLATYMLTA* |
| Ga0078894_111184211 | 3300005662 | Freshwater Lake | KKVKTDALALIRDIKEDCKEISLRTLIAVSKVRASNKDWKDLATYMLTV* |
| Ga0078894_112757011 | 3300005662 | Freshwater Lake | FLPEYDKECKVDALALIREIKDECKEISLRTLISVTKVRASNKDWKDLATYMLTA* |
| Ga0078894_117609281 | 3300005662 | Freshwater Lake | PEYDAKIKSDALALIREVGKEAKEISLRTLIAVSKVRASNKEWKDLATYMLTA* |
| Ga0007881_10710254 | 3300006072 | Freshwater | IREIKDEVKEISLRTLIAVSKIRASNKDWKDLATYMLTA* |
| Ga0007807_10522715 | 3300006116 | Freshwater | KDDVKEISLRTLIAVAKVRASNKDWKDLATYMLTA* |
| Ga0007805_11444291 | 3300006127 | Freshwater | DEVKEISLRTLIAVSKIRASNKDWKDLATYMLTA* |
| Ga0075471_102741204 | 3300006641 | Aqueous | REIKDECKEISLRTLISVTKVRASNKDWKDLATYMLTA* |
| Ga0075464_106681411 | 3300006805 | Aqueous | FLPEYDAKIKSDALALIREIKDDCKEISLRTLIAVCKIRASNKEYKDLATYMLTA* |
| Ga0102897_11973502 | 3300007617 | Estuarine | FLPEYSAEIKADALALIREIKEEVKEISLRTLISVAKVRASNKEWKDLATYMLVA* |
| Ga0102872_11427392 | 3300007621 | Estuarine | FLPEYDAKVKKDALGLIREIKDDVAEISLRTLISVSKIRAANTDWKDLATYMLTA* |
| Ga0102894_11651281 | 3300007632 | Estuarine | DEVKEISLRTLIAVAKVRASNKDWKDLATYMLTA* |
| Ga0114346_101957813 | 3300008113 | Freshwater, Plankton | ALIREIKDDCKEVSLRTLISVCKIRAANKDYKDLATYMLTA* |
| Ga0114841_11871993 | 3300008259 | Freshwater, Plankton | KLIDTLKTECKEISLRTLIAVSKIRANNKDWKDLATYMLTA* |
| Ga0114363_11226454 | 3300008266 | Freshwater, Plankton | KLIRSIKTECKEISLRTLIAVSKVRASNKDWKDLATYMLTA* |
| Ga0114364_10874211 | 3300008267 | Freshwater, Plankton | PEYDAKIKSDALALIREVKSEAKEISLRTLIAVSKVRASNKDWKDLATYMLTA* |
| Ga0102887_12027353 | 3300008961 | Estuarine | DALALIREIKDEVKEISLRTLIAVSKVRASNKDWKDLATYMLTA* |
| Ga0104242_10059971 | 3300008962 | Freshwater | PEYDKNIVKDALGLIRDISKDCKEISLRTLISVSKVRAANSDWKDLATYMLTA* |
| Ga0102831_10169621 | 3300008996 | Estuarine | SDALGLIREIKDDVSEISLRTLISVSKIRAANTDWKDLATYMLTA* |
| Ga0102815_104805931 | 3300009080 | Estuarine | IREIKDEVKEISLRTLIAVSKVRASNKDWKDLATYMLTA* |
| Ga0114977_104765123 | 3300009158 | Freshwater Lake | TIKSDALKLIRSIKDECTEISLRTLIAVAKIRASNKEWKDLATYMLTA* |
| Ga0114975_105351221 | 3300009164 | Freshwater Lake | LGLIREIKDDVKEVSLRTLIAVSKIRAANKEWKDLATYMLTA* |
| Ga0114975_106192981 | 3300009164 | Freshwater Lake | TIKSDALGLIRAIKDECSEISLRTLIAVAKIRASNKEWKDLATYMLTA* |
| Ga0114959_105113363 | 3300009182 | Freshwater Lake | IRAIKDDCKEISLRTLIAVAKVRASNKDWKDLATYMLTA* |
| Ga0114974_106668901 | 3300009183 | Freshwater Lake | RDIKDEAKEISLRTLISVTKIRASNDDWKDLATYMLTA* |
| Ga0114958_102515443 | 3300009684 | Freshwater Lake | DALSLIREIKDDCKEISLRTLISVTKVRASNKDWKDLATYMLTA* |
| Ga0114960_104865943 | 3300010158 | Freshwater Lake | KDDCKEISLRTLISVTKVRASNKDWKDLATYMLTA* |
| Ga0129336_105909511 | 3300010370 | Freshwater To Marine Saline Gradient | DALSLIREIKEECKEISLRTLISVSKVRASNTEWKELASYMLTA* |
| Ga0139556_10119859 | 3300011011 | Freshwater | VQKQDALALIREIKDEVTEISLRTLISVTKIRASNDDWKDLATYMLTA* |
| Ga0151620_12336461 | 3300011268 | Freshwater | LIREIKDDCKEISLRTLISVAKVRASNKDWKDLATYMLTA* |
| Ga0153799_10474363 | 3300012012 | Freshwater | NKDIAKEINLRTLINITKIRTDGGSNWKDLATYMLVN* |
| Ga0157210_10114217 | 3300012665 | Freshwater | ALALIRAIKDDCKEISLRTLIAVAKVRASNPTDYKDLATYMLTA* |
| Ga0138284_12830811 | 3300012779 | Freshwater Lake | DKSVKADALALIRAIKDDCKEISLRTLIAVAKVRASNPTDYKDLATYMLTA* |
| Ga0157211_10143184 | 3300012933 | Freshwater | DALDLIRSLKDECKEISMRTLISVTKIRSANKEWKSLAEYMLTA* |
| Ga0157211_10209541 | 3300012933 | Freshwater | IKTDALALIREIKNEAKEISLRTLIAVAKVRASNKEWKDLATYMLTA* |
| Ga0157211_10227531 | 3300012933 | Freshwater | DALDLIRSLKDECKEISMRTLISITKIRASNKEWKQLAEYMLTC* |
| Ga0164295_106474342 | 3300013014 | Freshwater | ALSLIRELKDEVSEISLRTLISVSKIRASNKDWKDLATYMLTA* |
| Ga0170791_114605981 | 3300013295 | Freshwater | KDECKEISLRTLIAVCKIRASNKDYKDLATYMLTA* |
| Ga0177922_100657241 | 3300013372 | Freshwater | KKIKTDALSLIREIKDEVSEISLRTLISVSKIRASNKDWKDLATYMLTA* |
| Ga0119960_10031891 | 3300014811 | Aquatic | FPSHDPEIKDECKEISLRTLISVAKIRAANPKDYKDLAVYVLTN* |
| Ga0134315_10644161 | 3300014962 | Surface Water | AKADALALIREVGTDAKEISLRTLISVTKIRASNKDWKDLATYMLTA* |
| Ga0181356_12422193 | 3300017761 | Freshwater Lake | GIKADALGLIRTIKNECSEISLRTLIAVSKIRASNKEWKDLATYMLTA |
| Ga0181358_12863703 | 3300017774 | Freshwater Lake | IKADALGLIRTIKNECSEISLRTLIAVAKIRASNKEWKDLATYMLTA |
| Ga0181358_12913661 | 3300017774 | Freshwater Lake | TIKSDALGLIRTIKNECSEISLRTLIAVAKIRASNKEWKDLATYMLTA |
| Ga0181357_11243031 | 3300017777 | Freshwater Lake | EFMPEYTKAQKQDALALIRDIKDEAKEISLRTLISVTKIRASNDEWKDLATYMLTA |
| Ga0181357_11368321 | 3300017777 | Freshwater Lake | PEYTKAQKQDALALIRDIKDECKEISLRTLISVTKIRASNDDWKDLATYMLTA |
| Ga0211736_104645411 | 3300020151 | Freshwater | KDDAKEISLRTLISVTKIRASGNKNWKGMATYILCN |
| Ga0211729_106724273 | 3300020172 | Freshwater | DATIKADALALIRKIKSECKEISLRTLIAVAKIRASNKEWKDLATYMLTA |
| Ga0181557_102904212 | 3300020601 | Salt Marsh | FLPNYPVEYKTDALALIRELKDDVKEISLRTLISVTKIRAANTDGWKDLATYMLTL |
| Ga0181557_10650911 | 3300020601 | Salt Marsh | AEIKTDALNLLREIKDDVKEISLRTLIAVAKIRASNTDWKDLATYMLTA |
| Ga0214170_10083191 | 3300020731 | Freshwater | SDALALIREIKDEVKEISLRTLIAVSKIRASNTDWKDLATYMLTA |
| Ga0214211_10147404 | 3300021125 | Freshwater | LIRAIKDDVKEISLRTLIAVAKVRASNKDWKDLATYMLTA |
| Ga0194060_102537551 | 3300021602 | Anoxic Zone Freshwater | YDAQCKKDALALIREIASECKEITLRTLISVTKVRASNKDWKDLATYMLTA |
| Ga0222714_101156807 | 3300021961 | Estuarine Water | YDATIKTDALKLIRSIKTECKEISLRTLIAVSKVRASNKDWKDLATYMLTA |
| Ga0222714_102976121 | 3300021961 | Estuarine Water | DTLKTECKEISLRTLIAVSKIRANNKDWKDLATYMLTA |
| Ga0222714_106643691 | 3300021961 | Estuarine Water | TIKADALALIRKIKSECKEISLRTLIAVSKVRASNKDWKDLATYMLTA |
| Ga0222712_100200401 | 3300021963 | Estuarine Water | ALGLIREIKEECKEISLRTLISVSKVRASNKDWKDLATYMLTI |
| Ga0222712_102835321 | 3300021963 | Estuarine Water | PEYTTEIKADALALIREVKDQAKEISLRTLISVAKIRAANPSDYKDLATYVLTN |
| Ga0222712_103494301 | 3300021963 | Estuarine Water | SLKEDAKEISLRTLISVTKIRASGNKNWKGMATYILCN |
| Ga0214921_104621823 | 3300023174 | Freshwater | LGLIRDISKDCKEISLRTLISVSKVRAANSDWKDLATYMLTA |
| Ga0255141_10215391 | 3300024351 | Freshwater | REISKDCKEISLRTLISVSKVRAANSDWKDLATYMLTA |
| Ga0255187_10477833 | 3300024510 | Freshwater | SLKDDAKEISLRTLISVTKIRASGNKNWKGMATYILCN |
| Ga0255288_11233291 | 3300024561 | Freshwater | EFLPEYEAKVKTDALALIREIKDDCKEISLRTLISVAKIRASNKDWKELATYILTN |
| Ga0255237_100294812 | 3300024564 | Freshwater | RSIKTECKEISLRTLIAVSKIRASNKDWKDLASYMLTA |
| Ga0256307_11131613 | 3300024567 | Freshwater | DATVKSDALKLIRSIKTECKEISLRTLIAVSKIRASNKDWKDLASYMLTA |
| Ga0255272_10699411 | 3300024866 | Freshwater | LPEYNAEAKADAISLIRELKDTAKEISLRTLISVTKIRSANDDWKDLATYMLTA |
| Ga0255272_11812613 | 3300024866 | Freshwater | DKNIVKDALGLIREISKECKEISLRTLISVSKVRASNTEWKDLATYMLTA |
| Ga0255272_11841083 | 3300024866 | Freshwater | LIREISKDCKEISLRTLISVSKVRAANNDWKDLATYMLTA |
| Ga0208739_10033291 | 3300025426 | Freshwater | LALIREIKDEVKEISLRTLIAVSKIRASNKDWKDLATYMLTA |
| Ga0208147_10854024 | 3300025635 | Aqueous | ELANEAKEISLRTLISVTKIRSANKDWKEMATYLLTA |
| Ga0208916_103575561 | 3300025896 | Aqueous | TDCKEVSLRTLISVAKVRAANPTDYEDLATYMLTA |
| Ga0255240_10795393 | 3300026568 | Freshwater | PEYDATVKADALKLIRSIKSECKEISLRTLIAVSKIRASNKDWKDLASYMLTA |
| Ga0255099_10640461 | 3300027128 | Freshwater | LIREISAECKEISLRTLISVSKVRASNTDWKDLATYMLTA |
| Ga0255076_10601561 | 3300027141 | Freshwater | IRDISKDCKEISLRTLISVSKVRAANSDWKDLATYMLTA |
| Ga0208023_10749021 | 3300027206 | Estuarine | FLPEYTAEIKADALALIREIKEEVKEISLRTLISVAKVRASNKDWKDLAEYMLVA |
| Ga0208177_11083893 | 3300027254 | Estuarine | IKSDALALIREIKDEVKEISLRTLIAVSKVRASNKDWKDLATYMLTA |
| Ga0208974_10577735 | 3300027608 | Freshwater Lentic | LIKEIKDECKEISLRTLISVSKVRASNKDWKDLAAYMLTA |
| Ga0208974_11351033 | 3300027608 | Freshwater Lentic | DALALIREVKDQAKEISLRTLISVAKIRAANPSDYKDLATYVLTN |
| Ga0209188_12857593 | 3300027708 | Freshwater Lake | VDALSLIREIKDDCKEISLRTLISVTKVRASNKDWKDLATYMLTA |
| Ga0209442_10194211 | 3300027732 | Freshwater Lake | IKNECSEISLRTLIAVAKIRASNKEWKDLATYMLTA |
| Ga0209355_11684864 | 3300027744 | Freshwater Lake | KLIRSIKDDCSEISLRTLIAVAKIRASNKEWKDLATYMLTA |
| Ga0209355_12895591 | 3300027744 | Freshwater Lake | PEYDTTVKSDALALIRSIKTECKEINLRTLIAVCKIRASNKNYKDLATYMLTA |
| Ga0209597_11367515 | 3300027746 | Freshwater Lake | EYDATIKADALALIRKIKSECKEISLRTLIAVSKIRASNKEWKDLATYMLTA |
| Ga0209246_101128261 | 3300027785 | Freshwater Lake | GLIRTIKNECSEISLRTLIAVAKIRASNKEWKDLATYMLTA |
| Ga0209229_102254531 | 3300027805 | Freshwater And Sediment | DALALIREVKSEAKEISLRTLIAVSKVRASNKDWKDLATYMLTA |
| Ga0209229_105072661 | 3300027805 | Freshwater And Sediment | PDFLPEYDAKIKSDALALIRDIKEDCKEINLRTLIAVCKIRASNKDYKDLATYMLTA |
| Ga0209354_103365153 | 3300027808 | Freshwater Lake | LALIRAIKDDCKEISLRTLIAVSKVRASNPNDYKDLATYMLTA |
| Ga0209191_11789373 | 3300027969 | Freshwater Lake | RIRKVGKEAKEISLRTLIAVAKIRASNKEWKDLATYMLTA |
| Ga0304728_12831662 | 3300028393 | Freshwater Lake | VKADALALIRAIKDDVKEISLRTLIAVAKVRASNKDWKDLATYMLTA |
| Ga0315899_106734671 | 3300031784 | Freshwater | SKEIIADALGLIREIKEEVKEISLRTLISVSKVRASNDQWKDLATYMLTA |
| Ga0315909_104303151 | 3300031857 | Freshwater | GIINDALGLIREIKEECKEISLRTLISVSKVRASNTEWKELASYMLTA |
| Ga0315904_114521092 | 3300031951 | Freshwater | LPEYDATIKADALALIRKIKSECKEISLRTLIAVSKVRASNKDWKDLATYMLTA |
| Ga0315901_107848661 | 3300031963 | Freshwater | LKSDCKEISLRTLIAVSKIRASNKDWKDLATYMLTA |
| Ga0315901_109172453 | 3300031963 | Freshwater | REIKEECKEISLRTLISVSKVRASNKDWKDLATYMLTI |
| Ga0315901_110970183 | 3300031963 | Freshwater | DLIRSLKDDAKEISLRTLISVTKIRASGNKNWKGMATYILCN |
| Ga0315903_107666961 | 3300032116 | Freshwater | KEIIADALGLIREIKEEVKEISLRTLISVSKVRASNDQWKDLATYMLTA |
| Ga0315903_109243463 | 3300032116 | Freshwater | KIKSECKEISLRTLIAVSKVRASNKDWKDLATYMLTA |
| Ga0334994_0437498_1_123 | 3300033993 | Freshwater | LIRKIKSECKEISLRTLIAVSKVRASNKDWKDLATYMLTA |
| Ga0334996_0038530_1_108 | 3300033994 | Freshwater | KEEVKEISLRTLISVAKVRASNKDWKDLATYMLTA |
| Ga0335035_0365858_2_163 | 3300034105 | Freshwater | PEYDATIKSDALGLIRTIKNECSEISLRTLIAVAKIRASNKEWKDLATYMLTA |
| ⦗Top⦘ |