| Basic Information | |
|---|---|
| Family ID | F087088 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TSLVYFTDGECYTSVKPKSKVLWVLSERSSMNEDLPGQVIKLEL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.73 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.273 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (10.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (43.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.06% Coil/Unstructured: 81.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF07453 | NUMOD1 | 11.82 |
| PF01541 | GIY-YIG | 3.64 |
| PF00004 | AAA | 1.82 |
| PF07728 | AAA_5 | 1.82 |
| PF12705 | PDDEXK_1 | 1.82 |
| PF12684 | DUF3799 | 0.91 |
| PF13482 | RNase_H_2 | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.27 % |
| All Organisms | root | All Organisms | 22.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.09% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.36% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.45% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.45% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.73% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.82% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.82% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.82% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.91% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.91% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.91% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.91% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.91% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.91% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.91% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.91% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.91% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.91% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.91% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.91% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.91% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.91% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.91% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.91% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006988 | Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300011259 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.2 | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020511 | Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300024848 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027236 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027938 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_30-Apr-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029293 | Marine harbor viral communities from the Indian Ocean - SCH2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE02_21mDRAFT_101743291 | 3300000792 | Marine | TDGECSTSVKPRXRVLWVLSXRSEMNQDLPGQVIKLEL* |
| BBAY94_100113373 | 3300000949 | Macroalgal Surface | YFTDGEASTSVSPRAKVLWVHSEESDINEDLPGIKIKLEL* |
| JGI24766J26685_100653742 | 3300002161 | Freshwater And Sediment | ECGYSVKPRGNTLWVLSERSYMNTELPGKVIKLEL* |
| B570J29032_1098310424 | 3300002408 | Freshwater | SLVYFTDGECWTHVKPKGNVLWVISERSQMNNDLPGKVIKLEL* |
| B570J40625_1007019602 | 3300002835 | Freshwater | FTDGECWTEVKPRNPVLWVLSERSKINNDLPGKVIRLEL* |
| JGI25909J50240_10768312 | 3300003393 | Freshwater Lake | TSLVYFTDGECYTRVKPKGHVLWVLSERSQMNDELPGKVIKLEL* |
| Ga0068876_102609952 | 3300005527 | Freshwater Lake | QNLKKYTSLIYFTDGEWHTSVKPKSPVLWVLSERSHMNDDLPGKVIKLEL* |
| Ga0068876_104836021 | 3300005527 | Freshwater Lake | VYFTDGECYTSVVPRSNILWVLSERSNMNNDLPGKVIKLEL* |
| Ga0049084_101948941 | 3300005585 | Freshwater Lentic | GECSTSVTPKGKVLWVLSEQSYMNEDLPGKVIKLEI* |
| Ga0070723_105079192 | 3300005612 | Marine Sediment | FNEKKEFTSLIYFTDGEASVNLKPRKPVLWVLSERSSYNDELPGRQIKLEL* |
| Ga0070723_107070131 | 3300005612 | Marine Sediment | FTDGEATAYVKPRGHVLWVLSEQSYLNKDLPGKVIKLEL* |
| Ga0079957_13301782 | 3300005805 | Lake | YFTDGECTADVKPKAPVLWVLSEQSSMNDSLPGKVIKLEL* |
| Ga0075471_103208402 | 3300006641 | Aqueous | SLIYFTDGECYTKIKPKGKILWVLSERSSMNDSLPGKVIKLEL* |
| Ga0075471_104451062 | 3300006641 | Aqueous | KYTSLVYFTDGECYTSVVPKGNVLWVLSERSHMNEDLPGKVIKLEL* |
| Ga0098060_12190972 | 3300006921 | Marine | TSLIYFTDGEAWTDMKPRKPVLWVLSERSDFNNDLPGKQIRLEL* |
| Ga0098045_10391862 | 3300006922 | Marine | FTSLVYFTDGEAYTSVNPRAKVLWVHSEQSEINEDLPGLKIKLEL* |
| Ga0098064_1307491 | 3300006988 | Marine | GEAYTDMKPRKPVLWVLSERSEFNDSLPGKQIRLEL* |
| Ga0099850_12438621 | 3300007960 | Aqueous | KKYTSLVYFTDGECYTSVKPRNRVLWVLSERSEMNEDLPGQVIKLEL* |
| Ga0105746_11070191 | 3300007973 | Estuary Water | SLVYFTDGECYTSVKPRSKVLWVLSERSGMNEDLPGQVIKLEL* |
| Ga0114341_101898091 | 3300008108 | Freshwater, Plankton | DGECYTSVVPKGNVLWVLSERSSMNDSLPGRVIKLEL* |
| Ga0114350_10366123 | 3300008116 | Freshwater, Plankton | TSLIYFTDGEWSTSVKPKSPVLWVLSERSHMNDELPGKIIKLEL* |
| Ga0114841_11901441 | 3300008259 | Freshwater, Plankton | KYTSLVYFTDGECWTNVQPKAPVLWVLSERSSMNDSLPGKVIKLEL* |
| Ga0114841_12272951 | 3300008259 | Freshwater, Plankton | GECGYSVRPKGNTLWVLSEQSYMNEELPGKVIKLEL* |
| Ga0114841_12815332 | 3300008259 | Freshwater, Plankton | LKKYTSLIYFTDGEWHTSVKPKSPVLWVLSERSHMNDDLPGKVIKLEL* |
| Ga0114364_11383741 | 3300008267 | Freshwater, Plankton | ANIRKYTSLIYFTDGECYTRIKPKGKILWVLSERSSMNDSLPGKVIKLEL* |
| Ga0114364_11937542 | 3300008267 | Freshwater, Plankton | KKYTSLVYFTDGECYTSVRPRGKVLWVLSERSGMNEDLPGQVIKLEL* |
| Ga0105099_107840661 | 3300009082 | Freshwater Sediment | VYFTDGECDAHVKPKGNVLWVLSERSHMNNDLPGKVIKLEL* |
| Ga0105097_106887772 | 3300009169 | Freshwater Sediment | RKYTSLVYFTDGECTADVKPKAPVLWVISEQSELNTELPGKVIKLEL* |
| Ga0115008_103161892 | 3300009436 | Marine | FTDGEATANIKPRKPVLWVLSERSEFNDRLPGKQIRLEL* |
| Ga0114946_106110322 | 3300009504 | Sediment | QRFNSLIYFTDGECSARVKPRNPVLWVLSERSELNEDLPGKVIKLDL* |
| Ga0129336_105123621 | 3300010370 | Freshwater To Marine Saline Gradient | GECGYSVKPKGNTLWVLSEESYMNEELPGKVIKLEL* |
| Ga0133913_136307631 | 3300010885 | Freshwater Lake | TSLVYFTDGECGTRIKPKGKILWVLSERSSMNDRLPGKVIKLEL* |
| Ga0136709_10087981 | 3300011184 | Freshwater | YFTDGECYADVKPRGNVLWVLSERSQMNDSLPGKVIKLEL* |
| Ga0151662_12627263 | 3300011259 | Marine | LIYFTDGEAWTRINPRKPVLWVLSERSDFNDDLPGKQIRLEL* |
| Ga0153800_10375812 | 3300011995 | Freshwater | CNTSVTPKGNVLWVLSEQSYMNEDLPGKVIKLEL* |
| Ga0153799_10358292 | 3300012012 | Freshwater | YFTDGECYTSVKPKNRVLWVLSEQSSMNEDLPGQVIRLEL* |
| Ga0153805_10787752 | 3300012013 | Surface Ice | GECYTSIKPKGKILWVLSERSDMNDKLPGKIIKLEL* |
| Ga0157613_10513832 | 3300012720 | Freshwater | KYTSLVYFTDGECYTSVVPKGNVLWVLSERSSMNDSLPGRVIKLEL* |
| Ga0157611_12274891 | 3300012724 | Freshwater | YTSLVYFTDGECYTSVVPKGNVLWVLSERSSMNDSLPGRVIKLEL* |
| Ga0181350_11079801 | 3300017716 | Freshwater Lake | IYFTDGECSTSMKPSGKILWVLSERSNLNVALPGQVIKLEL |
| Ga0181373_10494171 | 3300017721 | Marine | TDGEAWTDMKPRKPVLWVLSERSDFNDSLPGKQIRLEL |
| Ga0181365_10205924 | 3300017736 | Freshwater Lake | KYTSLVYFTDGECYTSVIPKGNVLWVLSERSNMNESLPGKTIKLEL |
| Ga0181352_10675993 | 3300017747 | Freshwater Lake | LVYFTDGECWTNVQPKAPVLWVLSERSSMNDSLPGKVIKLEL |
| Ga0181420_11395292 | 3300017757 | Seawater | YFTDGEAWTDIKPKKQVLWVLSERSEFNDRLPGKQIRLEL |
| Ga0181357_11926261 | 3300017777 | Freshwater Lake | TSLVYFTDGECYTRVKPKGHVLWVLSERSNMNDELAGKVIKLEL |
| Ga0181380_11594832 | 3300017782 | Seawater | EQNRQFTSLIYFTDGEATANIKPRKPVLWVLSERSEFNDRLPGKQIRLEL |
| Ga0181577_104865493 | 3300017951 | Salt Marsh | LVYFTDGECGWSVKPRGNVLWVLSECSDMNKDLPGKVIRLEL |
| Ga0181585_107200831 | 3300017969 | Salt Marsh | TDGEAWASVRPKSRVLWVLSERSQMNEELPGKVIKLEL |
| Ga0181361_1049811 | 3300019783 | Freshwater Lake | FTDGECYTSVKPRNRVLWVLSEQSSMNEDLPGQVIRLEL |
| Ga0181361_1070151 | 3300019783 | Freshwater Lake | TSLVYFTDGECYTSVIPRGNVLWVLSERSNMNESLPGKIIKLEL |
| Ga0211734_103774931 | 3300020159 | Freshwater | SLVYFTDGEASAYTKPRGPILWVLSERSHMNESLPGKVIKLEL |
| Ga0208593_10396101 | 3300020511 | Freshwater | FTDGECYTSVRPKGKVLWVLSERSGMNEDLPGQVIKLEL |
| Ga0208857_10013291 | 3300020542 | Freshwater | KKFTSLVYFTDGEAHASIKPRGNVLWVISERSSLNTSLPGKVIKLEL |
| Ga0222713_101867291 | 3300021962 | Estuarine Water | NLKKYTSLVYFTDGECYTSVRPRGKVLWVLSERSGMNEDLPGQVIKLEL |
| Ga0222713_106064351 | 3300021962 | Estuarine Water | PVLEYYQQHKEFTSLIYFTDGECNTSLKPNKDILWVLSEKSELNNSLPGKVIKLEL |
| Ga0196899_10754401 | 3300022187 | Aqueous | NTSYTSLVYFTDGEASTSVSPRAKVLWVHSEESDINEDLPGIKIKLEL |
| Ga0196899_11252242 | 3300022187 | Aqueous | FTDGEAYTSIKPRKPILWVLSERSDFNDSLPGKQIRLEI |
| Ga0224504_100030121 | 3300022308 | Sediment | YFTDGEATAYVKPRGHVLWVLSEQSYLNKDLPGKVIKLEL |
| (restricted) Ga0233410_102528751 | 3300023276 | Seawater | DGEAWTNVKPRKPVLWVLSERSDFNDDLPGRQIKLEL |
| (restricted) Ga0255040_102458981 | 3300024059 | Seawater | GEAYTELKPNKNILWVLSERSDMNNELPGKVIKLEI |
| Ga0228655_11172001 | 3300024236 | Seawater | NENTSYTSLVYFTDGEASTSINPRAKVLWVHSEQSDINENLPGLKIKLEL |
| Ga0228631_10269373 | 3300024329 | Seawater | NTSYTSLVYFTDGEASTSVSPRAKVLWVHSEQSDINEDLPGLKIKLEL |
| (restricted) Ga0255046_102464051 | 3300024519 | Seawater | FTSLIYFTDGEAWTNVKPRKPVLWVLSERSDFNDDLPGRQIKLEL |
| (restricted) Ga0255045_101514981 | 3300024528 | Seawater | NTSYTSLVYFTDGEASTSVNPRAKVLWVHSEQSDINEDLPGLKIKLEL |
| (restricted) Ga0255044_104411281 | 3300024529 | Seawater | SYTSLVYFTDGEASTSINPRAKVLWVHSEQSDINEDLPGLKIKLEL |
| Ga0255229_10441201 | 3300024848 | Freshwater | KYTSLVYFTDGECYTSVKPKSKVLWVLSERSSMNEDLPGQVIKLEL |
| Ga0209756_13354002 | 3300025141 | Marine | ERKEFTSLIYFTDGEAWTNVKPRKPVLWVLSERSEFNDNLPGRQIRLEL |
| Ga0208161_11143702 | 3300025646 | Aqueous | NEHPQYTSLIYFTDGEASTSTMPNKKVLWVLSEESYLHEDLPGKVIKLEL |
| Ga0208161_11291272 | 3300025646 | Aqueous | KYTSLVYFTDGECYTSVVPKGNVLWVLSERSSMNESLPGKVIKLEL |
| Ga0208161_11551141 | 3300025646 | Aqueous | TSLVYFTDGECYTSVVPKGNVLWVLSERSSMNDSLPGRVIKLEL |
| Ga0208899_12281571 | 3300025759 | Aqueous | TDGEAYTSIKPRKPILWVLSERSDFNDSLPGKQIRLEI |
| Ga0255166_10859752 | 3300026473 | Freshwater | KKYTSLVYFTDGECYTSVVPKGNVLWVLSERSSMNENLPGRVIKLEL |
| Ga0255064_10457971 | 3300027138 | Freshwater | LVYFTDGECYTSVRPRGKVLWVLSERSGMNEDLPGQVIKLEL |
| Ga0208026_10548521 | 3300027236 | Estuarine | TDGECYTSVKPKSKVLWVLSERSSMNEDLPGQVIKLEL |
| Ga0208950_10213953 | 3300027413 | Marine | YFNENTSYTSLVYFTDGEASTSINPRAKVLWVHSEQSDINEDLPGLKIKLEL |
| Ga0255077_10375633 | 3300027529 | Freshwater | NQKKYTSLVYFTDGECCTSVVPKGNVLWVLSERSHMNEDLPGRVIKLEL |
| Ga0209383_10663732 | 3300027672 | Marine | KYYMENPKFTSLIYFTDGECSTSLTPNKNILWVLSERSEMNESLPGRVIKLEL |
| Ga0209492_12768962 | 3300027721 | Freshwater Sediment | FTDGECSTSVRPKAPILWVLSERSSMNTDLPGKTIKLEL |
| Ga0209442_13024872 | 3300027732 | Freshwater Lake | ECRADVKPKAPVLWVISEQSELNTELPGKVIKLEL |
| Ga0209297_11255512 | 3300027733 | Freshwater Lake | NKKYTSLVYFTDGECNARVKPKGNVLWVLSERSNMNEGLPGKVIKLEL |
| Ga0209355_10088877 | 3300027744 | Freshwater Lake | ENQGLYTSLVYFTDGECNTSVTPKGNVLWVLSEQSYMNEDLPGKVIKLEI |
| Ga0209596_12495672 | 3300027754 | Freshwater Lake | GECNTSVTPKGKVLWVLSEQSYMNEDLPGKVIKLEL |
| Ga0209972_100657393 | 3300027793 | Freshwater Lake | FTDGECTADVKPKAPVLWVLSEQSHMNDSLPGKVIKLEL |
| Ga0209668_100529441 | 3300027899 | Freshwater Lake Sediment | TSLVYFTDGECYTSVKPKSKVLWVLSERSSMNEDLPGQVIKLEL |
| Ga0209866_10169043 | 3300027938 | Sand | FMENRQFTSLIYFTDGECSTSMKPSGKILWVLSERSNLNESLPGQVIKLEL |
| Ga0209079_101845972 | 3300027972 | Freshwater Sediment | YFTDGECYTSVKPKSKVLWVLSERSSMNEDLPGQVIKLEL |
| Ga0256335_10404611 | 3300028112 | Freshwater | ECYASVKPKGNVLWVISERSSMNDSLPGKVIKLEL |
| Ga0256368_10601862 | 3300028125 | Sea-Ice Brine | KEFTSLIYFTDGEAWTDVKPRKPVLWVLSERSSYNDELPGRQIRLEL |
| Ga0304730_10185814 | 3300028394 | Freshwater Lake | YFTDGECNASVRPKGNILWVLSEQSSMNDELPGKVIKLEL |
| Ga0135211_10244243 | 3300029293 | Marine Harbor | EATAYVKPRGNVLWVLSEESHLNEDLPGKVIKLEL |
| Ga0315291_112644341 | 3300031707 | Sediment | DGECTTEVVPKGNVLWVLSERSYMNDSLPGRVIKLEL |
| Ga0315907_103600711 | 3300031758 | Freshwater | VYFTDGECWTNVQPKAPVLWVLSERSSMNDSLPGKVIKLEL |
| Ga0315907_111268672 | 3300031758 | Freshwater | TSLVYFTDGECYTSVRPRGKVLWVLSERSGMNEDLPGQVIKLEL |
| Ga0315288_105379561 | 3300031772 | Sediment | SLVYFTDGECDTDVKPRGNVLWVLSERSSMNTDLPGKVIKLEL |
| Ga0315288_112512531 | 3300031772 | Sediment | TDGECNASVRPKGNILWVLSEQSSMNDELPGKVIKLEL |
| Ga0315909_103289291 | 3300031857 | Freshwater | KYTSLVYFTDGECWTNVQPKAPVLWVLSERSSMNDSLPGKVIKLEL |
| Ga0315909_108247191 | 3300031857 | Freshwater | SLVYFTDGEGYPRIKPKGNMLWVLSEQSYMNEELPGKVIKLEL |
| Ga0315297_116135131 | 3300031873 | Sediment | LVYFTDGECNTSVTPKGNVLWVLSEQSYMNEDLPGKVIKLEL |
| Ga0315901_105005641 | 3300031963 | Freshwater | SLVYFTDGECTADVKPKAPVLWVLSEQSHMNDSLPGKVIKLEL |
| Ga0315289_112402752 | 3300032046 | Sediment | GECYTRVKPKGHVLWVLSERSEMNDELPGKVIKLEL |
| Ga0315284_106381812 | 3300032053 | Sediment | NNTRKYTSLVYFTDGECNASVKPKGKVLWVISERSDMNQDLPGQVIKLEL |
| Ga0315903_102889611 | 3300032116 | Freshwater | SLVYFTDGECWTNVQPKAPVLWVLSERSSMNDSLPGKVIKLEL |
| Ga0315903_104841571 | 3300032116 | Freshwater | VYFTDGECTADVKPKAPVLWVLSEQSHMNDSLPGKVIKLEL |
| Ga0315277_102145043 | 3300032118 | Sediment | ECNTYVKPKSPVLWVLSERSHMNEDLPGKTIKLEL |
| Ga0334998_0283235_868_990 | 3300034019 | Freshwater | YFTDGECYTSIKPKGKILWVLSERSSMNDRLPGKVIKLEL |
| Ga0310130_0189749_514_636 | 3300034073 | Fracking Water | YFTDGECYTSVKPKSKVLWVLSEQSHMNEDLPGQVIKLEL |
| Ga0335061_0135207_2_154 | 3300034168 | Freshwater | ENIRKFTSLVYFTDGECYTDVKPKAPVLWVLSEQSHMNNDLPGKVIKLEI |
| Ga0335065_0787941_401_532 | 3300034200 | Freshwater | SLIYFTDGECYTSIKPKGKILWVLSERSSMNDRLPGKVIKLEL |
| Ga0335013_0458742_2_115 | 3300034284 | Freshwater | DGECSTSVKPKGNTLWVLSEQSGMNEDLPGKVIKLEL |
| Ga0348336_005681_8441_8575 | 3300034375 | Aqueous | TSLIYFTDGEAPANVKPRNRMLWVLSERSYMNDALPGHVIRLEL |
| ⦗Top⦘ |