| Basic Information | |
|---|---|
| Family ID | F087079 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RELPEVVETDLNPVRCMTNGCVVLDMRLRIEHRRPIERVKTW |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.91 % |
| % of genes near scaffold ends (potentially truncated) | 97.27 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.455 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.727 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 9.09 |
| PF00501 | AMP-binding | 4.55 |
| PF00072 | Response_reg | 3.64 |
| PF00850 | Hist_deacetyl | 3.64 |
| PF13193 | AMP-binding_C | 2.73 |
| PF03640 | Lipoprotein_15 | 1.82 |
| PF00274 | Glycolytic | 1.82 |
| PF13549 | ATP-grasp_5 | 1.82 |
| PF10057 | MpsC | 1.82 |
| PF00108 | Thiolase_N | 1.82 |
| PF01144 | CoA_trans | 1.82 |
| PF04389 | Peptidase_M28 | 0.91 |
| PF07366 | SnoaL | 0.91 |
| PF00211 | Guanylate_cyc | 0.91 |
| PF02803 | Thiolase_C | 0.91 |
| PF00215 | OMPdecase | 0.91 |
| PF01212 | Beta_elim_lyase | 0.91 |
| PF12760 | Zn_Tnp_IS1595 | 0.91 |
| PF12840 | HTH_20 | 0.91 |
| PF02687 | FtsX | 0.91 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF13340 | DUF4096 | 0.91 |
| PF12697 | Abhydrolase_6 | 0.91 |
| PF01988 | VIT1 | 0.91 |
| PF08240 | ADH_N | 0.91 |
| PF00171 | Aldedh | 0.91 |
| PF04264 | YceI | 0.91 |
| PF03404 | Mo-co_dimer | 0.91 |
| PF02371 | Transposase_20 | 0.91 |
| PF00665 | rve | 0.91 |
| PF01184 | Gpr1_Fun34_YaaH | 0.91 |
| PF05899 | Cupin_3 | 0.91 |
| PF02833 | DHHA2 | 0.91 |
| PF05015 | HigB-like_toxin | 0.91 |
| PF01738 | DLH | 0.91 |
| PF12680 | SnoaL_2 | 0.91 |
| PF02775 | TPP_enzyme_C | 0.91 |
| PF13183 | Fer4_8 | 0.91 |
| PF00534 | Glycos_transf_1 | 0.91 |
| PF02627 | CMD | 0.91 |
| PF00206 | Lyase_1 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 7.27 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 2.73 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 1.82 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 1.82 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.82 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 1.82 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 1.82 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.82 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.91 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.91 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.91 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.91 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.91 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.91 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.91 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.91 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.91 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.91 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.91 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.91 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.91 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.91 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.91 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.91 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.91 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.91 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.91 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.91 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.91 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.91 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.91 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.91 |
| COG1227 | Inorganic pyrophosphatase/exopolyphosphatase | Energy production and conversion [C] | 0.91 |
| COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 0.91 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.91 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.27 % |
| Unclassified | root | N/A | 32.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig15939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 798 | Open in IMG/M |
| 2124908043|A2_c1_ConsensusfromContig37060 | Not Available | 615 | Open in IMG/M |
| 2140918007|ConsensusfromContig163374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300002568|C688J35102_120734833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
| 3300005467|Ga0070706_101505883 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005526|Ga0073909_10216232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 836 | Open in IMG/M |
| 3300005921|Ga0070766_10405340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
| 3300005995|Ga0066790_10080792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300006046|Ga0066652_101753163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300006052|Ga0075029_100671975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 697 | Open in IMG/M |
| 3300006642|Ga0075521_10427240 | Not Available | 646 | Open in IMG/M |
| 3300006954|Ga0079219_12486307 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009400|Ga0116854_1012477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3912 | Open in IMG/M |
| 3300009521|Ga0116222_1172857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 930 | Open in IMG/M |
| 3300009672|Ga0116215_1309252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 687 | Open in IMG/M |
| 3300009683|Ga0116224_10075510 | Not Available | 1641 | Open in IMG/M |
| 3300009698|Ga0116216_10012933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5256 | Open in IMG/M |
| 3300009698|Ga0116216_10272891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1032 | Open in IMG/M |
| 3300009698|Ga0116216_10612745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 656 | Open in IMG/M |
| 3300009824|Ga0116219_10466323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 700 | Open in IMG/M |
| 3300010049|Ga0123356_10867224 | Not Available | 1074 | Open in IMG/M |
| 3300010343|Ga0074044_10422661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 872 | Open in IMG/M |
| 3300010379|Ga0136449_100904377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1438 | Open in IMG/M |
| 3300010379|Ga0136449_104590331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 506 | Open in IMG/M |
| 3300011003|Ga0138514_100143276 | Not Available | 530 | Open in IMG/M |
| 3300011086|Ga0138564_1055657 | Not Available | 556 | Open in IMG/M |
| 3300012094|Ga0136638_10235753 | Not Available | 841 | Open in IMG/M |
| 3300012469|Ga0150984_110195529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2826 | Open in IMG/M |
| 3300012915|Ga0157302_10455767 | Not Available | 542 | Open in IMG/M |
| 3300014162|Ga0181538_10551069 | Not Available | 604 | Open in IMG/M |
| 3300014165|Ga0181523_10418496 | Not Available | 745 | Open in IMG/M |
| 3300014165|Ga0181523_10639357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300015077|Ga0173483_10883272 | Not Available | 524 | Open in IMG/M |
| 3300015358|Ga0134089_10276937 | Not Available | 692 | Open in IMG/M |
| 3300015371|Ga0132258_10742019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2473 | Open in IMG/M |
| 3300015374|Ga0132255_102635472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 768 | Open in IMG/M |
| 3300017932|Ga0187814_10074900 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300017932|Ga0187814_10098710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1077 | Open in IMG/M |
| 3300017939|Ga0187775_10174591 | Not Available | 782 | Open in IMG/M |
| 3300017939|Ga0187775_10309164 | Not Available | 626 | Open in IMG/M |
| 3300017939|Ga0187775_10383077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300017939|Ga0187775_10476540 | Not Available | 530 | Open in IMG/M |
| 3300017961|Ga0187778_10093691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1862 | Open in IMG/M |
| 3300017961|Ga0187778_10103098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1775 | Open in IMG/M |
| 3300017961|Ga0187778_10371965 | Not Available | 934 | Open in IMG/M |
| 3300017961|Ga0187778_10857610 | Not Available | 622 | Open in IMG/M |
| 3300017966|Ga0187776_10134140 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1508 | Open in IMG/M |
| 3300017966|Ga0187776_10504832 | Not Available | 828 | Open in IMG/M |
| 3300017973|Ga0187780_10181800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1464 | Open in IMG/M |
| 3300017974|Ga0187777_11422657 | Not Available | 512 | Open in IMG/M |
| 3300017975|Ga0187782_10249454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
| 3300017999|Ga0187767_10109257 | Not Available | 779 | Open in IMG/M |
| 3300018032|Ga0187788_10263156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 688 | Open in IMG/M |
| 3300018032|Ga0187788_10416307 | Not Available | 567 | Open in IMG/M |
| 3300018037|Ga0187883_10449977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 662 | Open in IMG/M |
| 3300018038|Ga0187855_10826717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 540 | Open in IMG/M |
| 3300018043|Ga0187887_10281142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 984 | Open in IMG/M |
| 3300018043|Ga0187887_10813663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300018058|Ga0187766_10260910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 1111 | Open in IMG/M |
| 3300018058|Ga0187766_10445128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300018064|Ga0187773_10479577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300018089|Ga0187774_11345785 | Not Available | 520 | Open in IMG/M |
| 3300019245|Ga0187791_1187039 | Not Available | 681 | Open in IMG/M |
| 3300021403|Ga0210397_10013313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4978 | Open in IMG/M |
| 3300021403|Ga0210397_10990866 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300025427|Ga0208077_1005040 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300025427|Ga0208077_1058347 | Not Available | 539 | Open in IMG/M |
| 3300025464|Ga0208076_1004125 | Not Available | 2311 | Open in IMG/M |
| 3300025475|Ga0208478_1008200 | Not Available | 2405 | Open in IMG/M |
| 3300025527|Ga0208714_1004778 | All Organisms → cellular organisms → Bacteria | 3678 | Open in IMG/M |
| 3300025527|Ga0208714_1026233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acidicola | 1383 | Open in IMG/M |
| 3300025703|Ga0208357_1036937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1684 | Open in IMG/M |
| 3300025878|Ga0209584_10364856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Rhodoferax → Rhodoferax lacus | 557 | Open in IMG/M |
| 3300025906|Ga0207699_11062563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 599 | Open in IMG/M |
| 3300026294|Ga0209839_10032135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1983 | Open in IMG/M |
| 3300026294|Ga0209839_10091417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1047 | Open in IMG/M |
| 3300027696|Ga0208696_1216597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 603 | Open in IMG/M |
| 3300027902|Ga0209048_10703892 | Not Available | 665 | Open in IMG/M |
| 3300028747|Ga0302219_10339942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300028811|Ga0307292_10194149 | Not Available | 832 | Open in IMG/M |
| 3300029951|Ga0311371_10303291 | Not Available | 2250 | Open in IMG/M |
| 3300029951|Ga0311371_10660119 | Not Available | 1326 | Open in IMG/M |
| 3300030002|Ga0311350_11967973 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300030007|Ga0311338_10511819 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1256 | Open in IMG/M |
| 3300030056|Ga0302181_10405102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300030114|Ga0311333_11201079 | Not Available | 648 | Open in IMG/M |
| 3300030494|Ga0310037_10130461 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300030520|Ga0311372_12214249 | Not Available | 632 | Open in IMG/M |
| 3300030520|Ga0311372_12757466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300030524|Ga0311357_10083222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3220 | Open in IMG/M |
| 3300030618|Ga0311354_10857268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
| 3300031234|Ga0302325_10480617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1888 | Open in IMG/M |
| 3300031234|Ga0302325_12500274 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031548|Ga0307408_100450058 | Not Available | 1117 | Open in IMG/M |
| 3300031640|Ga0318555_10579415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300031726|Ga0302321_103116926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300031902|Ga0302322_100704015 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300032160|Ga0311301_10075857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 6996 | Open in IMG/M |
| 3300032261|Ga0306920_103416726 | Not Available | 589 | Open in IMG/M |
| 3300032782|Ga0335082_10813834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300032783|Ga0335079_10101227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3265 | Open in IMG/M |
| 3300032805|Ga0335078_10241657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2471 | Open in IMG/M |
| 3300032805|Ga0335078_12135352 | Not Available | 593 | Open in IMG/M |
| 3300032828|Ga0335080_11326356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 718 | Open in IMG/M |
| 3300032892|Ga0335081_10039959 | All Organisms → cellular organisms → Bacteria | 7457 | Open in IMG/M |
| 3300032892|Ga0335081_10042148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7236 | Open in IMG/M |
| 3300032892|Ga0335081_11231499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 850 | Open in IMG/M |
| 3300032892|Ga0335081_12514119 | Not Available | 531 | Open in IMG/M |
| 3300032893|Ga0335069_11802913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 650 | Open in IMG/M |
| 3300033158|Ga0335077_10975444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 847 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 18.18% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 8.18% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.64% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.64% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.91% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.91% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_01241200 | 2124908043 | Soil | RFALLLREAPEIAEADLNPVRCMTHGCAVLDTHLRIDRVRPIDRVKTW |
| A2_c1_00725780 | 2124908043 | Soil | VVEADLNSVRCMTSGCVVLDMRLRIEPRRPVERVKTW |
| A_all_C_01083350 | 2140918007 | Soil | RELPEVVETDLNPVRCMTNGCVVLDMRLRIEHRRPIERVKTW |
| C688J35102_1207348332 | 3300002568 | Soil | GAAPEIVEADLNPVRCTPAGCTVLDMRLRVERRRPAERIKTW* |
| Ga0070706_1015058832 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SPEIAEADLNPVRCMPEGCVVLDLRVRIERHRPSERVKTW* |
| Ga0073909_102162322 | 3300005526 | Surface Soil | EVPELVEADLNSVRCTTTGCVVLDMRLRIEEQRPLERVKTW* |
| Ga0070766_104053401 | 3300005921 | Soil | EVVETDLNPVRCMTSGCVVLDMRLRIEPRRPVERVQTW* |
| Ga0066790_100807924 | 3300005995 | Soil | LVLRFALLLREAPEIAEADLNPVRCMTHGCAVLDTHLRIDRVRPIDRVKTW* |
| Ga0066652_1017531631 | 3300006046 | Soil | PEIAEADLNPVRCMTAGCAVLDLRLRVEPRRAHERVKTW* |
| Ga0075029_1006719752 | 3300006052 | Watersheds | FTLLLAQVPEVVEADLNPVRCMTRGCLVLDMRLRIEHRRSTGRIKTW* |
| Ga0075521_104272402 | 3300006642 | Arctic Peat Soil | LRNTPEIAEADLNPVRCMANGCVVLDTRLRLERARPIERVKTW* |
| Ga0079219_124863072 | 3300006954 | Agricultural Soil | EADLNSVRCTATACLVLDMRLRIEPQSPVERVKTW* |
| Ga0116854_10124773 | 3300009400 | Soil | MLRFALLLREVPEVVETDLNPVRCLTTGCVVLDMRLRIEHRPPVERLQTW* |
| Ga0116222_11728571 | 3300009521 | Peatlands Soil | RETPEIVEADLNPVRCMANGCVVLDIRLRIERPQPTERIKTW* |
| Ga0116215_13092521 | 3300009672 | Peatlands Soil | LMLRFALLLREVPEVVETDLNPVRCMTSGCVVLDMRLRIEHRRPIERVKTW* |
| Ga0116224_100755102 | 3300009683 | Peatlands Soil | EADLNPVRCMANGCVVLDMRLRIERPQPTDRVKTW* |
| Ga0116216_100129335 | 3300009698 | Peatlands Soil | ALLLRETPQIVEADLNPVRCMANGCVVLDMRLRIERPQPTERVKTW* |
| Ga0116216_102728912 | 3300009698 | Peatlands Soil | LLRETPQIVEADLNPVRCMANGCVVLDMRLRIERPQPTDRVKTW* |
| Ga0116216_106127451 | 3300009698 | Peatlands Soil | ILRFTLLLAEVPEVVEADLNPVRCMTSGCLVLDMRLRIEHRRSIDRVKTW* |
| Ga0116219_104663232 | 3300009824 | Peatlands Soil | ILRFALLLGEVPEVVEADLNTVRCTTNSCVVLDMRLRIERQRPVERVQTW* |
| Ga0123356_108672242 | 3300010049 | Termite Gut | LRTCPEIVEGDLNPVRCMPGGCVVIDFRLRVERRTVRERVKTW* |
| Ga0074044_104226612 | 3300010343 | Bog Forest Soil | ALLVRAVPEVIEADLNPVRCMASGCLVLDMRLRIEHRRPVERVKTW* |
| Ga0136449_1009043771 | 3300010379 | Peatlands Soil | ALLLGHCPEIVEADLNPVRCMSSGCVVLDGRVRTERREAPVRVKTW* |
| Ga0136449_1045903311 | 3300010379 | Peatlands Soil | RFTLLLAEVPEVVEADLNPVRCMTSGCLVLDMRLRIEHRRPIDRVKTW* |
| Ga0138514_1001432762 | 3300011003 | Soil | LLGEVPEVVEADLNPVRCTTNGCVVLDMRLRIERQRPLARVKTW* |
| Ga0138564_10556572 | 3300011086 | Peatlands Soil | ELPEVVETDLNPVRCTTNGCVVLDMRMRIERRRPVERVKTL* |
| Ga0136638_102357531 | 3300012094 | Polar Desert Sand | LLLREVPEIVEADLNPVRAMATGAIVLDMRLSLEHRRRFEAVKTW* |
| Ga0150984_1101955291 | 3300012469 | Avena Fatua Rhizosphere | EVVEADLNPVRCMAQGCTVLDMRLRVERRRPVERVRTW* |
| Ga0157302_104557672 | 3300012915 | Soil | EVVETDLNPVRCMTHGCVVLDMRMRIEHRAPVERIQTW* |
| Ga0181538_105510692 | 3300014162 | Bog | LLDEVPELVEADLNSVRCTTNGCVVLDMRMRIERRRPVERIKTW* |
| Ga0181523_104184961 | 3300014165 | Bog | LILRFALLLRSTPDVVEVDLNPIRCMASGCVVLDTRLRIEHRAPIERVKTW* |
| Ga0181523_106393572 | 3300014165 | Bog | ALRELILRFALLLGKIPEVVEADLNSVRCMTDGCVVLDMRVRIERRRPAERVKTW* |
| Ga0173483_108832721 | 3300015077 | Soil | LNREALRELILRFARLLEEVSELVEADLNSVRCSTTGCVVLDMRLRIEQQSPVERVKTW* |
| Ga0134089_102769371 | 3300015358 | Grasslands Soil | EVDLNPVRVLRQGCVVLDARMRAERRQPRPRVKTW* |
| Ga0132258_107420194 | 3300015371 | Arabidopsis Rhizosphere | ILRFAMLLEEVPELVEADLNSVRTTTTGCVVLDMRLRIAQHSPVERVKTW* |
| Ga0132255_1026354722 | 3300015374 | Arabidopsis Rhizosphere | VEADLNSVRTTTTGCVVLDMRLRIARHSPVERVKTW* |
| Ga0187814_100749001 | 3300017932 | Freshwater Sediment | VPEVVEADLNPVRCMTSGCLVLDMRLRIEHRRPMDRVKTW |
| Ga0187814_100987101 | 3300017932 | Freshwater Sediment | LLLAQVPEVVEADLNPVRCMTSGCLVLDMRLRIEHRRPIDRVKTW |
| Ga0187775_101745911 | 3300017939 | Tropical Peatland | QVPEVVEADLNPIRCMTTGCVVLDARLRIQRRAPIERVKTW |
| Ga0187775_103091642 | 3300017939 | Tropical Peatland | VPEVVEADLNPIRCMTAGCAVLDMRLRIERVRPSERVKTW |
| Ga0187775_103830772 | 3300017939 | Tropical Peatland | PELAEADLNPARCMPDGCVVLDARVRVGLHHVPERIKTW |
| Ga0187775_104765402 | 3300017939 | Tropical Peatland | LLLNETPEIAEADLNPVRCTTHGCVVLDPRMRIEPRRAVERAKTW |
| Ga0187778_100936911 | 3300017961 | Tropical Peatland | ALNRETLRELILRFALLLEEIPELVEADLNSVRCTTTASLVLDMRLRIEHQSPVERVKTW |
| Ga0187778_101030984 | 3300017961 | Tropical Peatland | FALLLEETPELVEADLNSLCCTTTASLVLDMRLQIERERVKTW |
| Ga0187778_103719651 | 3300017961 | Tropical Peatland | LLREVPEIIEADLNPIRCTTKGCLVLDLRLLLQPRRAVERVKTW |
| Ga0187778_108576102 | 3300017961 | Tropical Peatland | EVPEVVEVDLNPIRCTTDTSIVLDTQMRIEPRRPVKRVKTW |
| Ga0187776_101341401 | 3300017966 | Tropical Peatland | LVEADLNSVRCTAAGCLVLDMRLRIERQDPVERIKTW |
| Ga0187776_105048323 | 3300017966 | Tropical Peatland | LILRFAHLLRAAPEVVEADLDVRCTSHGCLVLNQRLRIEHTRPLERIKTW |
| Ga0187780_101818001 | 3300017973 | Tropical Peatland | VPEVVEADLNPVRCMASGCLVLDTRLRIEHRRPTERVKTW |
| Ga0187777_114226571 | 3300017974 | Tropical Peatland | ELVEADLNSVRCTTTGCVVLDMRMRIELQSPIERVKTW |
| Ga0187782_102494541 | 3300017975 | Tropical Peatland | QVPEVVEADLNPVRCMTSGCLVLDTRLRIEHRRPTERVKTW |
| Ga0187767_101092571 | 3300017999 | Tropical Peatland | MLHEVPEVVEADLNPVRCTLDSSLVLDVRLRVERPSPGERVKTW |
| Ga0187788_102631562 | 3300018032 | Tropical Peatland | LRETPEIVEADLNPVRCMANGAVVLDTRLRIERPRPTERVKTW |
| Ga0187788_104163071 | 3300018032 | Tropical Peatland | TPEIVEADLNPVRCTTHGCIVLDTRLRVEPRHPAERAKTW |
| Ga0187883_104499771 | 3300018037 | Peatland | RFALLLVEVPEIVEADLNPVRCNTNAAIVLNTRLRIEHHSPTQRVKTW |
| Ga0187855_108267172 | 3300018038 | Peatland | VEADLNPVRCMASECVVLDMRLRIEQRRPVERVKTW |
| Ga0187887_102811422 | 3300018043 | Peatland | RELILRFALLLREVPEVVETDLNSVRCMTSGCVVLDTRLRVEHPRAVERVKTW |
| Ga0187887_108136631 | 3300018043 | Peatland | EADLNPVRCTARGASVLDVRVRIEPQRPVERVKTW |
| Ga0187766_102609101 | 3300018058 | Tropical Peatland | RFTLLVRAVPEVVEADLNPVRCMASGCLVLDTRLRIEHRRPTERVKTW |
| Ga0187766_104451281 | 3300018058 | Tropical Peatland | SEVVEADLNPIRCMTTGCVVLEVRMRIQRRAPVERVKTW |
| Ga0187773_104795771 | 3300018064 | Tropical Peatland | VEADLNPVRCMTSGCLVLDMRLRIEHRRPIDRVKTW |
| Ga0187774_113457851 | 3300018089 | Tropical Peatland | VEADLNPVRCMANGCVALDMRLRIERPRPTERVKTW |
| Ga0187791_11870391 | 3300019245 | Peatland | PEIVEADLNPVRCTTSGCIVLDTQVRVAPRRPVQRVKTW |
| Ga0210397_100133131 | 3300021403 | Soil | EVPEVVETDLNPVRCMTSGCVVLDMRLRIEPRRPVERVQTW |
| Ga0210397_109908661 | 3300021403 | Soil | FALLLREVPEVVETDLNPVRCMTRGCVVLDMRLRVEPRRPVERVQTW |
| Ga0208077_10050403 | 3300025427 | Arctic Peat Soil | PEIAEADLNPVRCMRNGCAVLDTRLRVERARPIERVKTW |
| Ga0208077_10583472 | 3300025427 | Arctic Peat Soil | PEVVEADLNPVRCTSEGSVVLDMRVRIESRRRSKRVKTW |
| Ga0208076_10041251 | 3300025464 | Arctic Peat Soil | ELPEVVETDLNPVRCMTSGCVVLDMRVRIEPRRPVERVKTW |
| Ga0208478_10082004 | 3300025475 | Arctic Peat Soil | VPEVVEADLNPVRCTSEGSVVLDMRVRIESRRRSKRVKTW |
| Ga0208714_10047781 | 3300025527 | Arctic Peat Soil | LRELPEVVETDLNPVRCMPSGCVVLDMRLRIEHRRPVERVKTW |
| Ga0208714_10262334 | 3300025527 | Arctic Peat Soil | LRELPEVVETDLNPVRCMPSGCVVLDMRLRIEQRRPVERVKTW |
| Ga0208357_10369373 | 3300025703 | Arctic Peat Soil | VLDRQALLELILRFALLVREAPEVVEADLNSVRCMTSGCVVLDMQLRIEPRRPVERVKTW |
| Ga0209584_103648561 | 3300025878 | Arctic Peat Soil | LILRFALLLSAAPEVVEADLNPVRCMTSGCVVLDMRLRIEHRRPTERVKTW |
| Ga0207699_110625632 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | EADLNPIRCMATGCVVLDTRLRIESRGPIERVKTW |
| Ga0209839_100321351 | 3300026294 | Soil | PEVVETDLNPVRSMTRGCVVLDMRLRIEHRRPVERVKTW |
| Ga0209839_100914172 | 3300026294 | Soil | PEIAEADLNPVRCMLNGCAVLDTRLRVERARPIERVKTW |
| Ga0208696_12165971 | 3300027696 | Peatlands Soil | EGDLNPVRCTTNGCVVLDARVRIERRRPVERVKTW |
| Ga0209048_107038922 | 3300027902 | Freshwater Lake Sediment | LRFALLLRQVPEIVEADPNPVRCMANGCAVLGARIRVERVRPIERVEETT |
| Ga0302219_103399421 | 3300028747 | Palsa | FRGSAVLDRQALRELILRFALLLRESPELVEADLNSVRCMTTGCVVLDMQLRIEPRRPVERVKTW |
| Ga0307292_101941491 | 3300028811 | Soil | LRELILRFAILLEEVPELVEADLNSVRCTATGCVVLDMRLRIEQQSPVERVKTW |
| Ga0311371_103032914 | 3300029951 | Palsa | RELILRFALLLRESPEVVEADLNSVRCMTSGCVVLDLQLRVEPRRPVERVKTW |
| Ga0311371_106601191 | 3300029951 | Palsa | VETDLNPVRCMTSGCVVLDMRLRIEPRRPVEHVKTW |
| Ga0311350_119679731 | 3300030002 | Fen | LRFALLLRDLPEVVETDLNPVRCMTTGCVVLDMSLRIEPRRPVERVQTW |
| Ga0311338_105118192 | 3300030007 | Palsa | RDLPEVVETDLNPVRCMTSGCVVLDMRLRIEPRRPVEHVKTW |
| Ga0302181_104051021 | 3300030056 | Palsa | LLREIPEVVEADLNPVRCMTDGCVVLDMRLRVQHRHPVERIKTW |
| Ga0311333_112010792 | 3300030114 | Fen | ALLAQTVPELAEADLNTIRCTTHGCSVLDMRVRIEPLHAIERIKTW |
| Ga0310037_101304611 | 3300030494 | Peatlands Soil | ILRFVLLLEAVPEVVEVDLNPIRCTTASSLVLDMRLRIVPRRPSKRVKTW |
| Ga0311372_122142491 | 3300030520 | Palsa | ETDLNPVRCMPTSCIVLDLRLRIEPRHPVEHVKTW |
| Ga0311372_127574661 | 3300030520 | Palsa | RFALLLREAPELVEADLNSVRCMTTGCVVLDMQLRIEPRRPVERVKTW |
| Ga0311357_100832221 | 3300030524 | Palsa | ALLDRQALRELILRFALLLRQAPEVVEADLNSVRCMIEGCVVLDMQLRIEPRRPVERVKT |
| Ga0311354_108572683 | 3300030618 | Palsa | DRQALRELILRFALLIREAPQVVEADLNSVRCMTSGCVVLDMQLRIEPRRPVERVKTW |
| Ga0302325_104806173 | 3300031234 | Palsa | LRELVLRFALLLREAPELVEADLNSVRCMTSGCVVLDMQLRIELRHPVERVKTW |
| Ga0302325_125002741 | 3300031234 | Palsa | ELPEVVEADLNPVRCTTNGCVVLDMRLRIEPARPIERVKTW |
| Ga0307408_1004500581 | 3300031548 | Rhizosphere | LRELILRFALLLQAVPEIVETDLNPIRCTPTTCITLDLRLRAERRRPVERVKTW |
| Ga0318555_105794152 | 3300031640 | Soil | ALLVRAVPELSEADLNPVRCTASGCVVLDLRVRIGQHHAPGRVKTW |
| Ga0302321_1031169261 | 3300031726 | Fen | VAVPEVVEADLNPFRCMTNGCVVLDMRLRIEHRRPVERVKT |
| Ga0302322_1007040152 | 3300031902 | Fen | MRELILRFTLLLVAVPEVVEADLNPFRCMTNGCVVLDMRLRIEHRRPVERVKTW |
| Ga0311301_100758579 | 3300032160 | Peatlands Soil | RFALLLREVPEVVEADLNPVRCMTSGCVVLDMRLRIEHRRPI |
| Ga0306920_1034167261 | 3300032261 | Soil | EVPELVEADLNPIRCTTSGCTVLDLQVRIAPRRPVERVKTW |
| Ga0335082_108138341 | 3300032782 | Soil | LRFALLLREAPEIAEADLNPVRCMANGCAVLDARLRVQRVRPTERVKTW |
| Ga0335079_101012275 | 3300032783 | Soil | EVPELVEADLNPVRCMTSGCLVLDTRLRFEHRRPTESVKTW |
| Ga0335078_102416573 | 3300032805 | Soil | VEADLNPTRCTTTGCVVLDTRVRIERRGPIERVKTW |
| Ga0335078_121353522 | 3300032805 | Soil | LQETPEIAEADLNPVRCTTHGCVVLDTRLRIEPRHQVERAKTW |
| Ga0335080_113263562 | 3300032828 | Soil | FTLLVRAVPEVVEADLNPVRCMTSGCLVLDTRLRIEHRRPTERVKTW |
| Ga0335081_100399591 | 3300032892 | Soil | LLLAAIPEVAEADLNPVRWTPNGCQVLDVRMRIEHLRPFEHVKTW |
| Ga0335081_100421481 | 3300032892 | Soil | LRFTLLARAVPELVEADLNPVRCMTSGCLVLDSRLRIEHRRPTERVKTW |
| Ga0335081_112314992 | 3300032892 | Soil | QGTPEIAEADLNPVRCTTHGCVVLDTRLRIEPRHQVERAKTW |
| Ga0335081_125141192 | 3300032892 | Soil | EVPEVIEADLNPVRCMTSGCLVLDMRLRIEPRRLTDRVKTW |
| Ga0335069_118029131 | 3300032893 | Soil | ILRFTLLVRAVPEVVEADLNPVRCMTSGCLVLDTRLRIEHRRPTERVKTW |
| Ga0335077_109754442 | 3300033158 | Soil | LARAVPELVEADLNPVRCMTSGCLVLDSRLRIEHRRPTDRVKTW |
| ⦗Top⦘ |