 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F087019 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MIGELIGLGFVILFMLVSLTAVGFIIADSNYDKKRKDD |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.18 % |
| % of genes near scaffold ends (potentially truncated) | 20.00 % |
| % of genes from short scaffolds (< 2000 bps) | 75.45 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (38.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (37.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF03083 | MtN3_slv | 43.64 |
| PF13155 | Toprim_2 | 3.64 |
| PF00476 | DNA_pol_A | 1.82 |
| PF11753 | DUF3310 | 0.91 |
| PF10544 | T5orf172 | 0.91 |
| PF00268 | Ribonuc_red_sm | 0.91 |
| PF02867 | Ribonuc_red_lgC | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG4095 | Sugar transporter, SemiSWEET family, contains PQ motif | Carbohydrate transport and metabolism [G] | 43.64 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.82 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.91 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.55 % |
| Unclassified | root | N/A | 25.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 37.27% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 16.36% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.64% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.36% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.55% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.64% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.73% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 1.82% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.82% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.82% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.82% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.91% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.91% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001826 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM20, ROCA_DNA104_0.2um_23b | Environmental | Open in IMG/M |
| 3300001827 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013231 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101315273 | 3300000116 | Marine | IGLGFVILFMLVSLTAVGFLIADRNYDNKRKEDK* |
| DelMOSpr2010_101834732 | 3300000116 | Marine | MIGEIIGLVFVIGFMLFCLVGVGFIIADSNYDKKRKND* |
| DelMOSpr2010_102093462 | 3300000116 | Marine | MIGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD* |
| DelMOSpr2010_102419683 | 3300000116 | Marine | MIGEVIGLMLVIGFMLFCLVGVAFIIADSNYDKKRKXD* |
| DelMOWin2010_101047183 | 3300000117 | Marine | MIGEVIGLMFVIGFMLFCLVGVAFIIADRDYDKKNKDN* |
| ACM20_1016224 | 3300001826 | Marine Plankton | MIGEVIGLGFVILFMLVSLTAIGFIIADSDYDKKKKDD* |
| ACM21_10134294 | 3300001827 | Marine Plankton | MIGELIGLGFVILFMLVSLTAIGFIIADSDYDKKKKGRLIGI* |
| Ga0074648_10042262 | 3300005512 | Saline Water And Sediment | MIGEIIGLGFVILFMLVSLTAVGFIIADSDYDKKRKDD* |
| Ga0074648_100498416 | 3300005512 | Saline Water And Sediment | MIGEIIGLAFVTVFMLFCLIGVTFLIADRHYDKKRKDN* |
| Ga0074649_100516312 | 3300005613 | Saline Water And Sediment | MIGEIIGLGFVTVFMLFCLIGVTFLIADRHYDKKRKDN* |
| Ga0075474_100790984 | 3300006025 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVAFIIADSNYDKKRKDD* |
| Ga0075478_101749702 | 3300006026 | Aqueous | MIGEVIGLMLVIGFMLFCLVGVAFIIADSNYDKKRKDD* |
| Ga0098048_100249410 | 3300006752 | Marine | MIGELIGLAFVIGFMLVSLTAVGFIIADRNYDNKRKND* |
| Ga0070749_101100271 | 3300006802 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVAFIIADKNYDNKKKND*LV |
| Ga0070749_101409573 | 3300006802 | Aqueous | MIGEIIGLGFVILFMLVSLTAVGFLIADRNYDNKRKDD* |
| Ga0070754_101453702 | 3300006810 | Aqueous | MIGEIIGLVFVTVFMLFCLVGVGFIIADSNYDKKNKDN* |
| Ga0070754_103788003 | 3300006810 | Aqueous | MIGEIIGLVFVIGFMLFCLIGVGFLITDRDYDKKNKNN* |
| Ga0070754_105378742 | 3300006810 | Aqueous | MIGEIIGLGFVILFMLVSLTAVGFLIADRNYDKKRKDD* |
| Ga0075476_101885703 | 3300006867 | Aqueous | IGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD* |
| Ga0075475_103844611 | 3300006874 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD*LVFEM |
| Ga0070746_1002579911 | 3300006919 | Aqueous | MIGEIIGLVFVIGFMLFCLVGVGFIIADSNYDKKRKDD* |
| Ga0070746_100738481 | 3300006919 | Aqueous | EIIGLGFVILFMLVSLTAVGFLIADRNYDNKRKDD* |
| Ga0070753_12794401 | 3300007346 | Aqueous | MIGELIGLGFVILFMLVSLTAVGFIIADSNYDKKRKDD* |
| Ga0070753_13469083 | 3300007346 | Aqueous | MIAEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD*LVF |
| Ga0099849_11220665 | 3300007539 | Aqueous | MIGDLIGLVFVIGFMLFCLVGVRFIIADSNYDKKRKD |
| Ga0099849_13565932 | 3300007539 | Aqueous | MIGEIIGLGFVILFMLVSLTAVGFIIADRNYDNKRKDD* |
| Ga0099847_101535810 | 3300007540 | Aqueous | MIGEIIGLGFVILFMSVSLTAVGFLIADRNYDNKRKDD* |
| Ga0099847_10664635 | 3300007540 | Aqueous | MIGEIIGLGFVILFMSVSLTAVGFLIADSNYDKKRKDD* |
| Ga0099847_10685512 | 3300007540 | Aqueous | MIGELIGLALVIGFMLVSLTAVGFIIADRNYDNKKKND* |
| Ga0102963_10230999 | 3300009001 | Pond Water | MIGELIGLGFVILFMLVSLTAVGFIIADSDYDKKRKDD* |
| Ga0115572_100514175 | 3300009507 | Pelagic Marine | MIGEVIGLMFVIGFMLFCLVGVAFIIADKNYDNKKKND* |
| Ga0129348_10370377 | 3300010296 | Freshwater To Marine Saline Gradient | MIGDIIGLAFVILFMLVSLTAVGFIIADSNYDKKRKDD* |
| Ga0129348_12062133 | 3300010296 | Freshwater To Marine Saline Gradient | MIGEIIGLVFVIGFMLFCLVGVGFIIADSNYDKKRKDD*LVFEMG |
| Ga0129345_11629511 | 3300010297 | Freshwater To Marine Saline Gradient | MIGEIIGLGFVILFMLVSLTAVGFLIADRHYDDKRKEDK* |
| Ga0129345_11760812 | 3300010297 | Freshwater To Marine Saline Gradient | MIGEIIGLGFVILFMLVSLTAVGFLIADSNYDKKRKDD* |
| Ga0129351_13048892 | 3300010300 | Freshwater To Marine Saline Gradient | MIGEIIGLIFVTVFMLFCLVGVGFIIADSNYDKKKKDD* |
| Ga0129351_13358032 | 3300010300 | Freshwater To Marine Saline Gradient | MIGELIGLAFVILFMLVSLTAVGFIIADRNYDNKKKND* |
| Ga0136656_12173192 | 3300010318 | Freshwater To Marine Saline Gradient | MIGDLIGLTVVILFMLFCLVGVAFIIADSNYDKKRKDD* |
| Ga0136549_100607034 | 3300010389 | Marine Methane Seep Sediment | MIGEVIGLAFVIGFMLLCLVGVGLILADRNYDKKRKEDK* |
| Ga0129353_14931115 | 3300012525 | Aqueous | MIGEIIGLGFVILFMLVSLTAVGFIIADSNYDKKRKDD* |
| Ga0116832_10704702 | 3300013231 | Marine | MIGEIIGLGFVILFMLVSLTAVGFLIADRHYDDKRKDN* |
| Ga0180437_110390042 | 3300017963 | Hypersaline Lake Sediment | MIGELIGLGFVILFMLVSLTAVGFIIADSDYDKKKKDD |
| Ga0181590_100460232 | 3300017967 | Salt Marsh | MIGEIIGLGFVILFMLVSLTAVGFLIADRHYDDKRKDN |
| Ga0181590_110291962 | 3300017967 | Salt Marsh | MIGEVIGLGFVILFMLVCLTAVGFIIADSDYDKKRKDD |
| Ga0181576_104229933 | 3300017985 | Salt Marsh | MIGEIIGLGFVILFMLVSLTAVGFLIADRHYDDKRKDD |
| Ga0181569_104139392 | 3300017986 | Salt Marsh | MIGELIGLAFVILFMLVSLTAVGFLIADRHYDDKRKDN |
| Ga0181601_105405922 | 3300018041 | Salt Marsh | MIGELIGLAFVIGFMLFCIAGVGLILADKNYDNKRKDD |
| Ga0180433_108894423 | 3300018080 | Hypersaline Lake Sediment | MIGELIGLAFVIGFMLFCIAGVGLILADRNYDKKRKDD |
| Ga0181553_105868283 | 3300018416 | Salt Marsh | MIGELIGLAVVILFMLVSLTAVGFIIADSNYDKKRKDD |
| Ga0181563_103555782 | 3300018420 | Salt Marsh | MIGELIGLAFVIGFMLFCIAGVGIILADKNYDNKRKDD |
| Ga0181563_107678292 | 3300018420 | Salt Marsh | MIGELIGLAFVILFMLVSLTAVGFIIADSNYDKKRKDD |
| Ga0181566_105554023 | 3300018426 | Salt Marsh | MIGQIIGLGFVILFMLVSLTAVGFLIADRHYDDKRKDN |
| Ga0181564_106345531 | 3300018876 | Salt Marsh | MIGELIGLALVILFMLVSLTAVGFIIADSNYDKKRKDD |
| Ga0181575_105791802 | 3300020055 | Salt Marsh | MIGQIIGLGFVILFMLVSLTAVGFLIADRHYDDKRKEDK |
| Ga0181604_100617301 | 3300020191 | Salt Marsh | IGELIGLAFVIGFMLFCIAGVGLILADKNYDNKRKDD |
| Ga0211558_100127953 | 3300020439 | Marine | MIGELIGLAFVILFMLVSLTAVGFLILDRDYDKKKKDD |
| Ga0211558_101866852 | 3300020439 | Marine | MIGELIGLGFVILFMLVSLTAVGIILADKNYDKKRKDD |
| Ga0211558_102089402 | 3300020439 | Marine | MIGELIGLGFVILFMLVSLTAVGFIIADSDYDKKRKDDK |
| Ga0213858_1000113012 | 3300021356 | Seawater | MIGELIGLGFVILFMLVSLTAVGFIIADSNYDKKRKEDK |
| Ga0213858_100158993 | 3300021356 | Seawater | MISELIGLGFVILFMLVSLTAVGFIIADSDYDKKRKDD |
| Ga0213858_105998643 | 3300021356 | Seawater | MIGELIGLGLVILFMLVSLTAVGFIIADSDYDKKRKKDK |
| Ga0213859_100569589 | 3300021364 | Seawater | MIGELIGLGFVILFMLVSLTAVGFIIADSNYDNKKKND |
| Ga0213860_100304827 | 3300021368 | Seawater | MIGDIIGLAFVILFMLVSLTAVGFIIADSNYDKKRKDD |
| Ga0213860_105045772 | 3300021368 | Seawater | MIGELIGLGFVILFMLVSLTAVGFLIADRHYDDKRKDD |
| Ga0213863_100172493 | 3300021371 | Seawater | MIGELIGLTFVIGFMLFCIAGVGLILADKNYDNKRKDD |
| Ga0213863_1003666610 | 3300021371 | Seawater | MIGDIIGLGLVILFMLVSLTAVGFIIADSNYDKKRKDD |
| Ga0213865_100202458 | 3300021373 | Seawater | MIGDLIGLGFVILFMLVSLTAVGFIIADSDYDKKRKDD |
| Ga0213865_100287362 | 3300021373 | Seawater | MIGELIGLALVIGFMLVSLTAVGFIIADRNYDNKKKND |
| Ga0213865_101855542 | 3300021373 | Seawater | MIGELIGLAFVIGFILFCIAGVGIILADSNYDKKKKND |
| Ga0213865_102196813 | 3300021373 | Seawater | MIGELIGLAFVIGFMLFCIIGVGLILADKNYDNKRKDD |
| Ga0213868_103515693 | 3300021389 | Seawater | MIGEIIGLGFVILFMLVSLTAVGFLIADRNYDNKRKDD |
| Ga0213866_100284273 | 3300021425 | Seawater | MIGELIGLAFVILFMLVSLTAVGFLILDRDYDKKKKEDK |
| Ga0213866_101678931 | 3300021425 | Seawater | MIGELIGLAFVILFMLVSLTAVGFIIADRDYDKKRKEDKXTYF |
| Ga0213866_102036993 | 3300021425 | Seawater | MIGELIGLAFVILFMLVSLTAVGFIIADSDYDKKRKDD |
| Ga0213866_103434043 | 3300021425 | Seawater | MIGELIGLAVVILFMLVSLTAVGFIIADSNYDKKRKDDK |
| Ga0213866_105982052 | 3300021425 | Seawater | MIGQIIGLAFVTVFMLFCLIGVTFLIADRHYDKKRKDN |
| Ga0222718_100310174 | 3300021958 | Estuarine Water | MIGELIGLGFIILFMLVSLTAVGFIIADSDYDKKRKDD |
| Ga0222718_100895956 | 3300021958 | Estuarine Water | MIGEVIGLMFVIGFMLFCLVGVALIIADKNYDNKKKND |
| Ga0222718_104248232 | 3300021958 | Estuarine Water | MIGELIGLGFVILFMLVSLTAVGFIIADSNYDKKRKDN |
| Ga0222718_104538782 | 3300021958 | Estuarine Water | MIGDLIGLTVVILFMLFCLVGVAFIIADSNYDKKRKDD |
| Ga0196883_10001849 | 3300022050 | Aqueous | MIGEIIGLVFVIGFMLFCLIGVGFLITDRDYDKKNKNN |
| Ga0212021_10457033 | 3300022068 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVAFIIADSNYDKKRKDD |
| Ga0212028_10429672 | 3300022071 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVAFIIADRDYDKKNKDN |
| Ga0212027_10521251 | 3300022168 | Aqueous | MIGEIIGLVFVTVFMLFCLVGVGFIIADSNYDKKNKDNXLV |
| Ga0196891_10270843 | 3300022183 | Aqueous | MIGEIIGLVFVIGFMLFCLVGVGFIIADSNYDKKRKDD |
| Ga0196899_10746445 | 3300022187 | Aqueous | MIGEIIGLGFVILFMLVSLTAVGFLIADRNYDKKRKDD |
| Ga0196899_11158464 | 3300022187 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD |
| Ga0196899_11339172 | 3300022187 | Aqueous | MIGEVIGLMLVIGFMLFCLVGVAFIIADSNYDKKRKDD |
| Ga0196901_10748971 | 3300022200 | Aqueous | RGGQMIGDLIGLTVVILFMLFCLVGVAFIIADSNYDKKRKDD |
| Ga0196901_11225954 | 3300022200 | Aqueous | MIGDLIGLTVVILFMLFCLVGVAFIIADSNYDKKRKDDXLV |
| Ga0255752_100132822 | 3300022929 | Salt Marsh | MIGELIGLAVVILFMLVSLTAVGFIIADSNYDKKKKDD |
| Ga0255752_100927807 | 3300022929 | Salt Marsh | MIGELIGLGFVILFMLVSLTAVGFIIADSNYDKKRKDD |
| Ga0255751_100574623 | 3300023116 | Salt Marsh | MIGEIIGLGFVILFMLVSLTAVGFIIADRHYDDKRKDN |
| Ga0210003_11146644 | 3300024262 | Deep Subsurface | MIGDIIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD |
| Ga0208667_100011323 | 3300025070 | Marine | MIGELIGLAFVIGFMLVSLTAVGFIIADRNYDNKRKND |
| Ga0208898_10979613 | 3300025671 | Aqueous | MIGEIIGLVFVTVFMLFCLVGVGFIIADSNYDKKNKDN |
| Ga0208898_11484193 | 3300025671 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVAFLIADRNYDNKRKDD |
| Ga0208162_11795092 | 3300025674 | Aqueous | MIGEIIGLGFVILFMLVSLTAVGFLIADRHYDDKRKEDK |
| Ga0208899_10491721 | 3300025759 | Aqueous | MIGEIIGLGFVILFMLVSLTAVGFLIADRNYDNKRKD |
| Ga0208427_11541871 | 3300025771 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDDXLVFEMGCK |
| Ga0208427_12583033 | 3300025771 | Aqueous | IGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD |
| Ga0208645_11055513 | 3300025853 | Aqueous | MIREVIGLIFVISFMLFCLAGVGFLIADSNYDNKKKDD |
| Ga0208645_12019803 | 3300025853 | Aqueous | MIGEIIGLMLVIGFMLFCLVGVGFIIADSNYDKKRKDD |
| Ga0208645_13018953 | 3300025853 | Aqueous | MIAEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD |
| Ga0209951_10156852 | 3300026138 | Pond Water | MIGELIGLGFVILFMLVSLTAVGFIIADSDYDKKRKDN |
| Ga0183755_100327011 | 3300029448 | Marine | MIGEVIGLMLVIGFMLFCLVGVAFIIADKNYDNKKKND |
| Ga0307376_100080901 | 3300031578 | Soil | SRMIGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDD |
| Ga0348335_141262_2_124 | 3300034374 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDDWLV |
| Ga0348337_033011_2_139 | 3300034418 | Aqueous | MIGEVIGLMFVIGFMLFCLVGVGFIIADSNYDKKRKDDWLVFEMGC |
| Ga0348337_189914_210_326 | 3300034418 | Aqueous | MIGEVIGLIFVISFMLFCLAGVGFLIADSNYDNKKKDD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |