NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086991

Metagenome / Metatranscriptome Family F086991

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086991
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 41 residues
Representative Sequence LLQAAGAVTARAAKEIFSKPAALGLIDEIAGRADLVVEALAD
Number of Associated Samples 90
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.82 %
% of genes near scaffold ends (potentially truncated) 97.27 %
% of genes from short scaffolds (< 2000 bps) 91.82 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.364 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(40.909 % of family members)
Environment Ontology (ENVO) Unclassified
(47.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.818 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.43%    β-sheet: 0.00%    Coil/Unstructured: 68.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00472RF-1 24.55
PF13561adh_short_C2 5.45
PF12802MarR_2 2.73
PF13602ADH_zinc_N_2 1.82
PF05050Methyltransf_21 1.82
PF00406ADK 1.82
PF13193AMP-binding_C 0.91
PF08386Abhydrolase_4 0.91
PF06197DUF998 0.91
PF01872RibD_C 0.91
PF13649Methyltransf_25 0.91
PF13520AA_permease_2 0.91
PF04672Methyltransf_19 0.91
PF05988DUF899 0.91
PF00877NLPC_P60 0.91
PF00067p450 0.91
PF01717Meth_synt_2 0.91
PF03640Lipoprotein_15 0.91
PF01832Glucosaminidase 0.91
PF01842ACT 0.91
PF07992Pyr_redox_2 0.91
PF00578AhpC-TSA 0.91
PF14492EFG_III 0.91
PF00106adh_short 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 24.55
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 24.55
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 1.82
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.91
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.91
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 0.91
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.91
COG2124Cytochrome P450Defense mechanisms [V] 0.91
COG3371Uncharacterized membrane proteinFunction unknown [S] 0.91
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.91
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.36 %
UnclassifiedrootN/A3.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002907|JGI25613J43889_10019584All Organisms → cellular organisms → Bacteria1903Open in IMG/M
3300005541|Ga0070733_11147711All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005560|Ga0066670_10209842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1172Open in IMG/M
3300005764|Ga0066903_105066064All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300006057|Ga0075026_100744529All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300006755|Ga0079222_11686246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales606Open in IMG/M
3300006755|Ga0079222_12579012Not Available511Open in IMG/M
3300006914|Ga0075436_100165869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1558Open in IMG/M
3300009089|Ga0099828_11341935All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300009090|Ga0099827_10127870All Organisms → cellular organisms → Bacteria2054Open in IMG/M
3300009090|Ga0099827_11490564Not Available589Open in IMG/M
3300009092|Ga0105250_10283469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300009792|Ga0126374_10121577All Organisms → cellular organisms → Bacteria → Terrabacteria group1528Open in IMG/M
3300009792|Ga0126374_10724530All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300010046|Ga0126384_11099651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae729Open in IMG/M
3300010047|Ga0126382_11027841All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300010047|Ga0126382_11259017All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300010048|Ga0126373_12709749All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300010359|Ga0126376_12052529Not Available614Open in IMG/M
3300010361|Ga0126378_10907126All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300010362|Ga0126377_11097905All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300010366|Ga0126379_10426422All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300010376|Ga0126381_100693280All Organisms → cellular organisms → Bacteria1456Open in IMG/M
3300010376|Ga0126381_102658412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300012200|Ga0137382_11331134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium506Open in IMG/M
3300012211|Ga0137377_11882283All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012357|Ga0137384_10328559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1269Open in IMG/M
3300012976|Ga0134076_10226607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300016319|Ga0182033_10513712All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300016357|Ga0182032_11008640All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300016404|Ga0182037_10522359Not Available998Open in IMG/M
3300016422|Ga0182039_11526433All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300017926|Ga0187807_1179899All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300017932|Ga0187814_10395526All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300017973|Ga0187780_10155389All Organisms → cellular organisms → Bacteria1587Open in IMG/M
3300018007|Ga0187805_10579549All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300018058|Ga0187766_11032411All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300020002|Ga0193730_1090750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300021374|Ga0213881_10524113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300021402|Ga0210385_10126637All Organisms → cellular organisms → Bacteria1808Open in IMG/M
3300021404|Ga0210389_10479895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia978Open in IMG/M
3300021407|Ga0210383_11265085All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300021478|Ga0210402_10992553All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300021560|Ga0126371_12028523All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300025910|Ga0207684_10017064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6234Open in IMG/M
3300026095|Ga0207676_10914097All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300027725|Ga0209178_1050933All Organisms → cellular organisms → Bacteria → Terrabacteria group1328Open in IMG/M
3300027725|Ga0209178_1364350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300027846|Ga0209180_10275339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae966Open in IMG/M
3300027857|Ga0209166_10210920All Organisms → cellular organisms → Bacteria → Terrabacteria group1041Open in IMG/M
3300027857|Ga0209166_10427234All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300028379|Ga0268266_12078168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300028884|Ga0307308_10330060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300030706|Ga0310039_10247525All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300030740|Ga0265460_12825974All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300030917|Ga0075382_11459928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1218Open in IMG/M
3300031544|Ga0318534_10847504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300031573|Ga0310915_10022383All Organisms → cellular organisms → Bacteria3858Open in IMG/M
3300031640|Ga0318555_10068815All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300031680|Ga0318574_10207675All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300031680|Ga0318574_10371176All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300031708|Ga0310686_105675354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1536Open in IMG/M
3300031718|Ga0307474_11137121All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300031719|Ga0306917_10040384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3073Open in IMG/M
3300031719|Ga0306917_10546338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300031719|Ga0306917_11183909All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300031723|Ga0318493_10444025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300031736|Ga0318501_10369226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300031747|Ga0318502_10454041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300031769|Ga0318526_10013985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2676Open in IMG/M
3300031770|Ga0318521_10584786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300031770|Ga0318521_10652936All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300031771|Ga0318546_10685912All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300031778|Ga0318498_10040967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2035Open in IMG/M
3300031778|Ga0318498_10531403All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031779|Ga0318566_10524719All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031781|Ga0318547_10888842All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031782|Ga0318552_10655304All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031794|Ga0318503_10213066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300031799|Ga0318565_10198664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300031799|Ga0318565_10271388All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300031805|Ga0318497_10196418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1114Open in IMG/M
3300031859|Ga0318527_10373563All Organisms → cellular organisms → Bacteria → Terrabacteria group608Open in IMG/M
3300031879|Ga0306919_11367760All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031893|Ga0318536_10549025All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031910|Ga0306923_11299768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300031910|Ga0306923_12092090All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300031959|Ga0318530_10444951All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300032039|Ga0318559_10401440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300032041|Ga0318549_10192886All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300032043|Ga0318556_10557390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300032044|Ga0318558_10045500All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300032054|Ga0318570_10393924All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300032054|Ga0318570_10484790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300032065|Ga0318513_10023988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2581Open in IMG/M
3300032066|Ga0318514_10244800All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300032066|Ga0318514_10673450All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300032089|Ga0318525_10718164All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300032090|Ga0318518_10120029All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300032205|Ga0307472_102201974All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300032261|Ga0306920_100747971All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300032261|Ga0306920_103062965All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300032261|Ga0306920_103397788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300032954|Ga0335083_10123500All Organisms → cellular organisms → Bacteria2498Open in IMG/M
3300033134|Ga0335073_10487143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1413Open in IMG/M
3300033289|Ga0310914_10645402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria952Open in IMG/M
3300033289|Ga0310914_11635189All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300033290|Ga0318519_10002097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae6606Open in IMG/M
3300033290|Ga0318519_10348538All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300033475|Ga0310811_10580811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella1135Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil40.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.82%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.64%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.73%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.73%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.82%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.82%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030917Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25613J43889_1001958413300002907Grasslands SoilIESQLNQAGAVTFRSAKEIFSKPAAPALIDEIAARADLVVEALAD*
Ga0070733_1114771133300005541Surface SoilTARVAKEIFSKPAALGLIDEIASGGGLVVEALAD*
Ga0066670_1020984243300005560SoilAGATTARVTKEIFSKPAALSLIDEIAGGGGLVVEALAD*
Ga0066903_10506606433300005764Tropical Forest SoilGASTARVTKEIFSKPAALGLIDEIASGGGLVVEALAD*
Ga0075026_10074452913300006057WatershedsAGAVTIRWTKEIFSKPAALALVDEIAGRADLVVEALAD*
Ga0079222_1168624633300006755Agricultural SoilTLLQAAGAATARTTKEIFSKPAALALIGDITGQADLVVEALAD*
Ga0079222_1257901223300006755Agricultural SoilVGTLLTAAGAVRARGTKEIFSKPAAHSLIGEIASGGGLVVEALAA*
Ga0075436_10016586913300006914Populus RhizosphereRAEGAVTARSAKEIFSKPAALDLIDDIAGRADLVVEALAD*
Ga0099828_1134193513300009089Vadose Zone SoilTIRWTKEIFSKPAALALIDEIAGRADLVVEALAD*
Ga0099827_1012787053300009090Vadose Zone SoilSQLNQAGAVTFRSAKEIFSKPAAPALIDEIAARADLVVEALAD*
Ga0099827_1149056413300009090Vadose Zone SoilLSATTARTAKEIFSKPAALALMDDIARDADLVVEALAD*
Ga0105250_1028346933300009092Switchgrass RhizosphereIETLLQAAGAATARTTKEIFSKPAALALIGDITGQADLVVEALAD*
Ga0126374_1012157743300009792Tropical Forest SoilLDRVETLLTAAGAATARVTKEIFSKPAALSLIDEIASGGGLVVEALAD*
Ga0126374_1072453033300009792Tropical Forest SoilAAGASTARVTKEIFSKPAALGLIDEIAGGGGLVVEALAD*
Ga0126384_1109965123300010046Tropical Forest SoilSQLKQAGAVSFRSAKEIFSKPAVPTLIDDIAARADLVVEALAD*
Ga0126382_1102784133300010047Tropical Forest SoilLAAGATTSRSAKEIFSKPAAPGVIDAVCGRADLVVEGLAD*
Ga0126382_1125901723300010047Tropical Forest SoilAGARTIRWTKEIFSKPAALALIDEIAGRADLVVEALAD*
Ga0126373_1270974923300010048Tropical Forest SoilLLQAAGAVTARAAKEIFSKPAALGLIDEIAGRADLVVEALAD*
Ga0126376_1205252933300010359Tropical Forest SoilSRLRAAGAGTSRYSKEIFSKPAAADVIDQIVARSDLAVEALAD*
Ga0126378_1090712613300010361Tropical Forest SoilDLEAAGARTIRWTKEIFSKPAALALIDEIAGRADLVVEALAD*
Ga0126377_1109790533300010362Tropical Forest SoilAEGAATERSAKEIFSKPAALGLIDEITGRADLVVEALAD*
Ga0126379_1042642213300010366Tropical Forest SoilLDRMETLLRSAGAVTVRAVKEIFSKPAALGLIDEIAGRADLVVEALAD*
Ga0126381_10069328033300010376Tropical Forest SoilLLQAAGAIITRETKEIFSKPAALDLIDHITRVSDAVVEALAD*
Ga0126381_10265841213300010376Tropical Forest SoilDRIETLLGAAGARTARRTKEIFSKPASLTLIDEIAGNADLVIEALAD*
Ga0137382_1133113433300012200Vadose Zone SoilLDRVETLLRAAGATTERVTKEIFSKPAALGLIEEIAGHGGLVVEALAD*
Ga0137377_1188228323300012211Vadose Zone SoilAEGAVTARSAKEIFSKPAAPALIDDIAGRADLVVEALAD*
Ga0137384_1032855913300012357Vadose Zone SoilDRVETLLVAAGATTSRAAKEIFSKPAAPEVIDEVARRADLVVEALAD*
Ga0134076_1022660733300012976Grasslands SoilLQAAGAATARTTKEIFSKPAALALIGDIAGQADLVVEALAD*
Ga0182033_1051371233300016319SoilRAAGAVTAREAKEIFSKPAALGLIDEIAGRADLVVEALAD
Ga0182032_1100864033300016357SoilDRVETLLQAAGASTARVTKEIFSKPAALGLIEEIAGGAGLVVEALAD
Ga0182037_1052235913300016404SoilQAAGAATARTTKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0182039_1152643333300016422SoilAGAVTARAAKEIFSKPAALELIDEIAGRADLVVEALAD
Ga0187807_117989913300017926Freshwater SedimentTLLQAAGAATARATKEIFSRPAALALIGDIAGQADLVVEALAD
Ga0187814_1039552613300017932Freshwater SedimentRIETLLQAAGAATARTTKEIFSKPAALALIGGIAGQADLVVEALAD
Ga0187780_1015538913300017973Tropical PeatlandATARTTKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0187805_1057954933300018007Freshwater SedimentTAAGAETTRAAKEIFSKPAALGLIDQIASHSDAVVQALAD
Ga0187766_1103241113300018058Tropical PeatlandARLAAAGARTRRSAKEIFSKPAALSLIDDIAARSDLVVEALAD
Ga0193730_109075033300020002SoilAGAATARTTKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0213881_1052411333300021374Exposed RockETLLQAAGAVTARRAKEIFSKPAALALVDEIADGAELVVEALAD
Ga0210385_1012663713300021402SoilDRIEVLRRDAGATTSRVVKEIFSKPAALDLLDDVATHSHAVVEALAD
Ga0210389_1047989533300021404SoilRVETVLQQAGATTSRETKEIFSKPAALDLIDRITSVSDAVVEALAD
Ga0210383_1126508513300021407SoilAGAVTARAVKEIFSKPAALDLIDEIAGRADLVVEALAD
Ga0210402_1099255333300021478SoilEFLYRIETLLESAGAITTRETKEIFSKPAALDLIESITSVSDAVVEALAD
Ga0126371_1202852323300021560Tropical Forest SoilAEGADTARSAKEIFSKPAALALIDDIAGRADLVVEALAD
Ga0207684_1001706413300025910Corn, Switchgrass And Miscanthus RhizosphereQAAGVNTARVTKEIFSKPAALGLIDEIASGAGLVVEALAD
Ga0207676_1091409733300026095Switchgrass RhizosphereAGAATSRTTKEIFSKPAALALIGDITGQADLVVEALAD
Ga0209178_105093313300027725Agricultural SoilETLLQEAGASTARMTKEIFSKPAALGLIDEIAGGGGLVVEALAD
Ga0209178_136435033300027725Agricultural SoilLLRAEGASTARVTKEIFSKPAALGLIDEIASGGGLVVEALAD
Ga0209180_1027533913300027846Vadose Zone SoilQAGAVTFRSAKEIFSKPAAPALIDEIAARADLVVEALAD
Ga0209166_1021092043300027857Surface SoilAVTARVAKEIFSKPAALGLIDEIASGGGLVVEALAD
Ga0209166_1042723413300027857Surface SoilLDRVEFHLSAAGAETVRWTKEIFSKPAALALIDEIAARADLVVEALAD
Ga0268266_1207816833300028379Switchgrass RhizosphereEGAVTARSAKEIFSKPAALALIDDIAGRADLVVEALAD
Ga0307308_1033006033300028884SoilTLLQAAGAATARTTKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0310039_1024752523300030706Peatlands SoilAAGAATARTTKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0265460_1282597423300030740SoilAEFLDRLEVLLQQAGVTTTRVAKEIFSKPAALDLVDEIASHSHAVVQALAD
Ga0075382_1145992833300030917SoilAGATTSRETKEIFSKPAALDLIDRITSVSDAVVEALAD
Ga0318534_1084750433300031544SoilAAGAITARATKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0310915_1002238333300031573SoilVETLLQAAGASTARVTKEIFSKPAALGLIEEIAGGAGLVVEALAD
Ga0318555_1006881543300031640SoilRVETLLQAAGASTARVTKEIFSKPAALGLIEEIAGGAGLVVEALAD
Ga0318574_1020767533300031680SoilLRAAGADTARSAKEIFSKPAAPALIDDIAGRADLVVEALAD
Ga0318574_1037117633300031680SoilTRLRAEGAQTERAAKEIFSKPAALGLIDEIAGQADLVVEALAD
Ga0310686_10567535413300031708SoilLLQQSGAVTTRAVKEIFSKPAALDLMDQIAGHSHAVVQALAD
Ga0307474_1113712113300031718Hardwood Forest SoilLLQAAGAATARTTKEIFSKPAALALIGDITGQADLVVEALAD
Ga0306917_1004038413300031719SoilLDRVETLLTAAGAATARVTKEIFSKPAALSLIDEIASGGGLVVEALAD
Ga0306917_1054633813300031719SoilTLLRAAGAGTARVTKEIFSKPAALGLIDEIASGGGLVVEALAD
Ga0306917_1118390933300031719SoilVSADPERTAKEIFSKPAALGLIDEIAGRADLVVEALAD
Ga0318493_1044402533300031723SoilAATARLTKEIFSKPAALSLIDEIASGGGLVVEALAD
Ga0318501_1036922613300031736SoilLLRAAGAGTARVTKEIFSKPAALGLIDEIASGGGLVVEALAD
Ga0318502_1045404133300031747SoilSTARAAKEIFSKPAALALIDEITGRADLVVEALAD
Ga0318526_1001398513300031769SoilDRIETLLQAAGAATARATKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0318521_1058478633300031770SoilDPVETLLTAAGAATARVTKEIFSKPAALSLIDEIASGGGLVVEALAD
Ga0318521_1065293633300031770SoilTLLQAAGASTARVTKEIFSKPAALELIEEIADGAGLVVEALAD
Ga0318546_1068591213300031771SoilLLQEAGAVTARTAKEIFSKPAALGLIDQIAGQADLVVEALAD
Ga0318498_1004096733300031778SoilATVRTTKEIFSKPAALTLIGDIAGQADLVVEALAD
Ga0318498_1053140313300031778SoilLLQSAGAVTARAAKEIFSKPAALELIDEIAGRADLVVEALAD
Ga0318566_1052471913300031779SoilMETLLQAAGAVTARAVKEIFSKPAALDLIDEIAGRADAVVEALAD
Ga0318547_1088884223300031781SoilAAGAVTARAVKEIFSKPAALDLIDEIAGRADAVVEALAD
Ga0318552_1065530413300031782SoilLQAAGAATARVTKEIFSKPAALALTGDIAGQADVVVEALAD
Ga0318503_1021306613300031794SoilTTARVTKEIFSKPAALGLIDEIARGGGLVVEALAD
Ga0318565_1019866413300031799SoilLLTAAGATTARVTKEIFSKPAALSLIDEIARGGGLVVEALAD
Ga0318565_1027138833300031799SoilLQAAGAVTARAVKEIFSKPAALDLIDEIAGRADAVVEALAD
Ga0318497_1019641833300031805SoilVTARVAKEIFSKPAALGLIDEIAGRADLVVEALAD
Ga0318527_1037356313300031859SoilAGAATARVTKEIFSKPAALSLIDEIASGGGLVVEALAD
Ga0306919_1136776023300031879SoilETLLQAAGAVTARAVKEIFSKPAALDLIDEIAGRADAVVEALAD
Ga0318536_1054902513300031893SoilETLLQAAGAATARATKEIFSKPAALALIGDIAGRADLVVEALAD
Ga0306923_1129976813300031910SoilQAAGASTARTAKEIFSKPAALALIDEITGRADLVVEALAD
Ga0306923_1209209033300031910SoilTLLQAAGASTARVTKEIFSKPAALELIDEIASGAGLVVEALAD
Ga0318530_1044495133300031959SoilRIETLLQAAGATTARSAKEIFSKPAALALIDAIAGQADLVVEALAD
Ga0318559_1040144033300032039SoilLLTAVVAPAARVTKEIFSKPAALSLIDEIARGGGLVVEALAD
Ga0318549_1019288613300032041SoilGAATARATKEIFSKSAALALIGDIAGRADLVVEALAD
Ga0318556_1055739033300032043SoilTRAAGATTARVTKEIFSKPAALSLIDEIARGGGLVVEALAD
Ga0318558_1004550023300032044SoilVAADYVSPFDDRMETLLRAEGAQTERAAKEIFSKPAALGLIDEIAGQADLVVEALAD
Ga0318570_1039392413300032054SoilLQAAGASTARVTKEIFSKPAALELIDEIASGAGLVVEALAD
Ga0318570_1048479033300032054SoilETLLAGAGAATARLTKEIFSKPAALSLIDEIASGGGLVVEALAD
Ga0318513_1002398843300032065SoilDTARVTKEIFSKPAALGLIDEIASGGGLVVEALAD
Ga0318514_1024480013300032066SoilGASTARVTKEIFSKPAALGLIQEIASGAGLVVEALAD
Ga0318514_1067345033300032066SoilAAGAVTARTTKEIFSKPATLALIGDIAGQADLVVEALAD
Ga0318525_1071816423300032089SoilETLLQTAGAATARVTKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0318518_1012002933300032090SoilDRMETLLQAAGAVTARAAKEIFSKPAALGLIDEIASRADLVVEALAD
Ga0307472_10220197423300032205Hardwood Forest SoilDRIETLLQAAGAATARTTKEIFSKPAALALIGDITGQADLVVEALAD
Ga0306920_10074797143300032261SoilQAAGASTARVTKEIFSKPAALELIEEIADGAGLVVEALAD
Ga0306920_10306296533300032261SoilQAAGAVTARATKEIFSKPAALDLIDEIAGRADAVVEALAD
Ga0306920_10339778813300032261SoilRIETLLQAAGAATARVTKEIFSKPAALVLIGDIAGQADLVVEALAD
Ga0335083_1012350013300032954SoilLQAAGAATARTTKEIFSKPAALALIGDIAGQADLVVEALAD
Ga0335073_1048714313300033134SoilETLLQAAGAATARTTKEIFSKPAALALIGDIASRADLVVEALAD
Ga0310914_1064540213300033289SoilVETLLTAAGAATARVTKEIFSKPAALSLIDEIASGGGLVVEALAD
Ga0310914_1163518923300033289SoilGAVTARATKEIFSKPAALDLIDEIAGRADAVVEALAD
Ga0318519_1000209713300033290SoilAATARVTKEIFSKPAALSLIDEIASGGGLVVEALAD
Ga0318519_1034853833300033290SoilETLLQEAGAVTARTAKEIFSKPAALGLIDQIAGQADLVVEALAD
Ga0310811_1058081113300033475SoilGATTARTTKEIFSKPAALALIGDITGQADLVVEALAD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.