NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086985

Metagenome / Metatranscriptome Family F086985

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086985
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 40 residues
Representative Sequence MLAGVAVTLPRWPIVGRRPELEVFERALGSGELAGLVI
Number of Associated Samples 86
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 43.12 %
% of genes near scaffold ends (potentially truncated) 99.09 %
% of genes from short scaffolds (< 2000 bps) 92.73 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.818 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(60.909 % of family members)
Environment Ontology (ENVO) Unclassified
(70.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(61.818 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.79%    β-sheet: 0.00%    Coil/Unstructured: 71.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF01152Bac_globin 78.18
PF07167PhaC_N 1.82
PF00296Bac_luciferase 1.82
PF00753Lactamase_B 1.82
PF07992Pyr_redox_2 0.91
PF13460NAD_binding_10 0.91
PF02627CMD 0.91
PF00501AMP-binding 0.91
PF02625XdhC_CoxI 0.91
PF04226Transgly_assoc 0.91
PF02781G6PD_C 0.91
PF13193AMP-binding_C 0.91
PF13714PEP_mutase 0.91
PF01471PG_binding_1 0.91
PF00155Aminotran_1_2 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 78.18
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.82
COG3243Poly-beta-hydroxybutyrate synthaseLipid transport and metabolism [I] 1.82
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.91
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.91
COG1975Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF familyPosttranslational modification, protein turnover, chaperones [O] 0.91
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.91
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.82 %
UnclassifiedrootN/A48.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004479|Ga0062595_100103205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1523Open in IMG/M
3300004633|Ga0066395_10647704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300005363|Ga0008090_15367021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300005764|Ga0066903_101808229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1167Open in IMG/M
3300005764|Ga0066903_107461266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300006755|Ga0079222_11968108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300009523|Ga0116221_1157388Not Available988Open in IMG/M
3300009698|Ga0116216_10033500All Organisms → cellular organisms → Bacteria3187Open in IMG/M
3300010043|Ga0126380_10697928Not Available815Open in IMG/M
3300010047|Ga0126382_10085307Not Available1990Open in IMG/M
3300010048|Ga0126373_10121335All Organisms → cellular organisms → Bacteria2445Open in IMG/M
3300010323|Ga0134086_10238895All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium689Open in IMG/M
3300010358|Ga0126370_12550642All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300010360|Ga0126372_10298990All Organisms → cellular organisms → Bacteria1413Open in IMG/M
3300010361|Ga0126378_12335646Not Available610Open in IMG/M
3300010376|Ga0126381_100535936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1657Open in IMG/M
3300010376|Ga0126381_101140265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1126Open in IMG/M
3300010376|Ga0126381_101173591All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300010937|Ga0137776_1080276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2278Open in IMG/M
3300011271|Ga0137393_10572325Not Available969Open in IMG/M
3300012209|Ga0137379_10732434Not Available894Open in IMG/M
3300012211|Ga0137377_10394700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1321Open in IMG/M
3300012532|Ga0137373_10198522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1654Open in IMG/M
3300016270|Ga0182036_11695450Not Available533Open in IMG/M
3300016341|Ga0182035_10617299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300016357|Ga0182032_10693935Not Available854Open in IMG/M
3300016371|Ga0182034_10926819Not Available750Open in IMG/M
3300016387|Ga0182040_11489405Not Available574Open in IMG/M
3300016422|Ga0182039_11776840Not Available565Open in IMG/M
3300017924|Ga0187820_1306865Not Available524Open in IMG/M
3300017926|Ga0187807_1202487Not Available643Open in IMG/M
3300021405|Ga0210387_10636723Not Available947Open in IMG/M
3300022533|Ga0242662_10295964Not Available538Open in IMG/M
3300025915|Ga0207693_10248312All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300025922|Ga0207646_10536008Not Available1053Open in IMG/M
3300026551|Ga0209648_10722505All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300027812|Ga0209656_10027364Not Available3421Open in IMG/M
3300031544|Ga0318534_10754265Not Available548Open in IMG/M
3300031545|Ga0318541_10141770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1315Open in IMG/M
3300031545|Ga0318541_10455534All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300031549|Ga0318571_10195172Not Available722Open in IMG/M
3300031564|Ga0318573_10609772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300031572|Ga0318515_10035229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2465Open in IMG/M
3300031572|Ga0318515_10399970Not Available735Open in IMG/M
3300031573|Ga0310915_10731435Not Available698Open in IMG/M
3300031573|Ga0310915_11188000All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300031640|Ga0318555_10700120Not Available547Open in IMG/M
3300031668|Ga0318542_10353860Not Available755Open in IMG/M
3300031668|Ga0318542_10385407All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300031679|Ga0318561_10183371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1132Open in IMG/M
3300031680|Ga0318574_10166019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1259Open in IMG/M
3300031680|Ga0318574_10325239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300031681|Ga0318572_10092885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1692Open in IMG/M
3300031682|Ga0318560_10751994Not Available526Open in IMG/M
3300031713|Ga0318496_10565855Not Available628Open in IMG/M
3300031719|Ga0306917_10189635Not Available1551Open in IMG/M
3300031736|Ga0318501_10027475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2479Open in IMG/M
3300031747|Ga0318502_10998861Not Available510Open in IMG/M
3300031748|Ga0318492_10415797Not Available708Open in IMG/M
3300031751|Ga0318494_10007425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5024Open in IMG/M
3300031771|Ga0318546_10718195Not Available703Open in IMG/M
3300031771|Ga0318546_10993653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300031780|Ga0318508_1060284Not Available1016Open in IMG/M
3300031781|Ga0318547_10186460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300031781|Ga0318547_10216288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1148Open in IMG/M
3300031781|Ga0318547_10378914Not Available866Open in IMG/M
3300031781|Ga0318547_10396758Not Available846Open in IMG/M
3300031782|Ga0318552_10050853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1963Open in IMG/M
3300031782|Ga0318552_10251907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria896Open in IMG/M
3300031792|Ga0318529_10578275Not Available521Open in IMG/M
3300031793|Ga0318548_10429256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300031795|Ga0318557_10151717Not Available1047Open in IMG/M
3300031799|Ga0318565_10138032Not Available1180Open in IMG/M
3300031799|Ga0318565_10240513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria880Open in IMG/M
3300031799|Ga0318565_10513088All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300031805|Ga0318497_10087075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1662Open in IMG/M
3300031805|Ga0318497_10162470Not Available1226Open in IMG/M
3300031832|Ga0318499_10260243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300031835|Ga0318517_10082202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1395Open in IMG/M
3300031845|Ga0318511_10078914Not Available1372Open in IMG/M
3300031860|Ga0318495_10263386Not Available770Open in IMG/M
3300031896|Ga0318551_10349116Not Available837Open in IMG/M
3300031941|Ga0310912_10897830All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031946|Ga0310910_11057317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300031954|Ga0306926_11032797Not Available976Open in IMG/M
3300031959|Ga0318530_10473519Not Available520Open in IMG/M
3300032008|Ga0318562_10426623All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300032009|Ga0318563_10625112Not Available580Open in IMG/M
3300032010|Ga0318569_10458675Not Available594Open in IMG/M
3300032042|Ga0318545_10342328Not Available538Open in IMG/M
3300032044|Ga0318558_10223889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria922Open in IMG/M
3300032052|Ga0318506_10037154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1906Open in IMG/M
3300032052|Ga0318506_10274592All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300032052|Ga0318506_10285071All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300032063|Ga0318504_10065062Not Available1570Open in IMG/M
3300032064|Ga0318510_10066304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1314Open in IMG/M
3300032064|Ga0318510_10430568Not Available565Open in IMG/M
3300032067|Ga0318524_10266179Not Available883Open in IMG/M
3300032067|Ga0318524_10563508All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300032067|Ga0318524_10656717Not Available553Open in IMG/M
3300032076|Ga0306924_10559906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1297Open in IMG/M
3300032089|Ga0318525_10343425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria766Open in IMG/M
3300032089|Ga0318525_10443006Not Available665Open in IMG/M
3300032089|Ga0318525_10510411Not Available615Open in IMG/M
3300032090|Ga0318518_10477951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300032174|Ga0307470_10357957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1015Open in IMG/M
3300032261|Ga0306920_101545404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300032261|Ga0306920_102913144Not Available648Open in IMG/M
3300032892|Ga0335081_12176988Not Available585Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil60.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.18%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.73%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.82%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.91%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.91%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062595_10010320513300004479SoilMACTGLAWHLSGVVMTLPRWPIVGRRPELEVFERALGSGERAGLAIYGR
Ga0066395_1064770423300004633Tropical Forest SoilLSARVRADMLAGVGVTLQRWPIIGRRPELEVFERALSSGELAGVVIY
Ga0008090_1536702113300005363Tropical Rainforest SoilMLTAVSPTLQRWPIVGRRSELEVFSEALCSGEHAGLVIHGRAGVG
Ga0066903_10180822933300005764Tropical Forest SoilMTLPRWPIVGRRPELEVFERALGSGEQAGLVIYGRAG
Ga0066903_10746126623300005764Tropical Forest SoilMTLPRWPIVGRRPELEVFERALGSGDRAGLAIYGRAGVGKTR
Ga0079222_1196810813300006755Agricultural SoilMLADVVMTLPRWPIVGRRPELEVFEGALGSGEQAGLVIYGR
Ga0116221_115738833300009523Peatlands SoilMLAAVTTTLQRWPIIGRRSELEVFEKALCSGEQVGLVIHGRPGVGKTR
Ga0116216_1003350013300009698Peatlands SoilMLAPVAITLQRWPIVGRRSELEVFEQALGSGERAGLVIYGRAGVG
Ga0126380_1069792823300010043Tropical Forest SoilMLAAVTVTLPRWPIVGRRAELEVFGQALDSGEHTGLLI
Ga0126382_1008530713300010047Tropical Forest SoilMTLPRWPIVGRRPELEVFERALGSGERAGLVVYGRAGVGK
Ga0126373_1012133553300010048Tropical Forest SoilMLAAVTVTLPRWPIVGRRAELEVFGQALDSGEHTGLLIY
Ga0134086_1023889513300010323Grasslands SoilMLAGVAVTLPRWPIIGRRLELEVFERAMRSGELAGLVIYGRADVGKTRLA
Ga0126370_1255064213300010358Tropical Forest SoilMLAGVAMTLQRWPIVGRRSELEVFERALGVGDQAGLVIYGRAG
Ga0126372_1029899043300010360Tropical Forest SoilMLASVAAVLRWPIVGRRSELEVFERALGPGERAGLVIHGRAG
Ga0126378_1233564613300010361Tropical Forest SoilMLAGVGVVLPRWPIIGRHPELEVFEQTLGSGDKAGLVIHGRAGVGK
Ga0126381_10053593613300010376Tropical Forest SoilMLTDVGIARPRWPIIGRRSELEVFERALGSSEQAGLVIHGRAGVG
Ga0126381_10114026513300010376Tropical Forest SoilMLSNVVGVLPRWPMVGRRGELEVFERVLGSAEHKGLII
Ga0126381_10117359113300010376Tropical Forest SoilMLARVTITAQRWPIVGRRPELEAFERALGSGEHAGLV
Ga0137776_108027613300010937SedimentVGARTLPRWPIIGRRPEIEVFERALGSGEMAGLVIYGRAGV
Ga0137393_1057232513300011271Vadose Zone SoilMLAGAAMALQRWPIVGRRSELEVFERALGSAELAGLVI
Ga0137379_1073243413300012209Vadose Zone SoilMLAGVAITLQRWPIVGRRSELEVFERALDSGELAGLVIHGRA
Ga0137377_1039470013300012211Vadose Zone SoilMTQPRWPIVGRRPELEVFERALGSGGPAGLVIYGRAG
Ga0137373_1019852213300012532Vadose Zone SoilMLAGVAVTLPRWPIVGRRPELEAFERAMGSGELAGVVIY
Ga0182036_1169545023300016270SoilMLTDVGIARPRWPIIGRRSELEVFERALGSGQQAGLVIHGRA
Ga0182035_1061729933300016341SoilMLAGVAMVLLRWPIVGRRSELEVFERTLTSGEYAGLVIHGRA
Ga0182032_1069393513300016357SoilMLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGLVIYGRVGVGKTRLA
Ga0182034_1092681913300016371SoilMLADVGVTLQRWPIIGRRPELELFERALDSGELAGVVIYGR
Ga0182040_1148940513300016387SoilMLTAVTATLQRWPIVGRHAELEVFEEALCSGEHAGLVIHGRAGVG
Ga0182039_1177684023300016422SoilMLAGVAMVLLRWPIVGRRSELEVFERTLTSDGYAGLVIHGRPGVG
Ga0187820_130686513300017924Freshwater SedimentLVRSAMAGMLAGVAVALPQWPIVGRRPELEVFERALGLGDRAGL
Ga0187807_120248713300017926Freshwater SedimentVYPGRTVMLSAVAITLQRWPLVGRRSELEVFEKALCSGERTGMVIHGRAGV
Ga0210387_1063672313300021405SoilMLAAVAVALPQWPVVGRRPELEVFERALVSAECAGL
Ga0242662_1029596413300022533SoilMLSDVLRALPRWPIVGRRAELEVFERVLGSAESMGLIIYG
Ga0207693_1024831213300025915Corn, Switchgrass And Miscanthus RhizosphereMLADVVMTLPRWPIVGRRPELEVFERALGSGERAGLVI
Ga0207646_1053600833300025922Corn, Switchgrass And Miscanthus RhizosphereMLARVTITAQRWPIVGRRPELEAFERALGSAEHAGLVI
Ga0209648_1072250523300026551Grasslands SoilMLTGVAITLQRWPIVGRRSELEVFEKALCSGEYAG
Ga0209656_1002736463300027812Bog Forest SoilMLAGVAVTLPRWPIVGRRPELEVFERALGSGELAGLVI
Ga0318534_1075426513300031544SoilMLTAVAATLQRWPIVGRRSELEVFSEALRSGEHAGLVIHGRAGVG
Ga0318541_1014177033300031545SoilMLADVGRALPRWPLIGRRSELDVFARALGSGEKAGLVIHGR
Ga0318541_1045553423300031545SoilMLAAVATTLQRWPIVGRRSELEVFEEALCSGEHAGLV
Ga0318571_1019517213300031549SoilMLTAVAPTLQRWPIVGRRSELEVFSEALRSGEHAGLVIH
Ga0318573_1060977223300031564SoilMLSAVAATLQRWPIVGRRSELEVFSEALCSGEHAGLVIHG
Ga0318515_1003522943300031572SoilMLTDVAIALPRWPIVGRRSELEVFERALASGECSGLVIHGQA
Ga0318515_1039997013300031572SoilMLTAVAPTLQRWPIVGRRSELEVFEEALCSGEHAGLVI
Ga0310915_1073143513300031573SoilMLTDVAIALPRWPIVGRRSELEVFERALASDECAGLVIHGQ
Ga0310915_1118800023300031573SoilMLADVVMTLPRWPIVGRRPELEVFARALGSGERAGL
Ga0318555_1070012013300031640SoilMTLPRWPIVGRRPELEVFERAMGSGERAGLVIYGRAAR
Ga0318542_1035386013300031668SoilMLTDVAIALPRWPIVGRRSELEVFERALASGECSG
Ga0318542_1038540723300031668SoilMLADVVMTLPRWPIVGRRPELEVFARALGSGERAGLVIY
Ga0318561_1018337113300031679SoilMLADVGRALPRWPLIGRRSELDVFARALGSGEQAGLV
Ga0318574_1016601933300031680SoilMLSAVAVTLQRWPIVGRRSELEVFSEALSSGDCAGLV
Ga0318574_1032523913300031680SoilMLTAVAPTLQRWPIVGRRSELEVFSEALRSGEHAGLVIHG
Ga0318572_1009288533300031681SoilMLADVVMTLPRWPIVGRRPELEVFARALGSGERAGLVIYG
Ga0318560_1075199423300031682SoilMLAAVATTLPRWPIIGRRPELEVFERALGSGELAGLVIYGRAGVR
Ga0318496_1056585513300031713SoilMLAGVAMVLLRWPIVGRRSELEVFERTLTSDEHAGLVIHGRPG
Ga0306917_1018963513300031719SoilMLADVAVTLQQWPIIGRRPEIEVFERALGSGELAGLVIHGRAGT
Ga0318501_1002747513300031736SoilMLAAVATTLPRWPIIGRRPELEVFERALGSGELAGLVIYGRAGVG
Ga0318502_1099886123300031747SoilMLSAVAATLQRWPIVGRRSELEVFSEALCSGEHAGLV
Ga0318492_1041579723300031748SoilMTLPRWPIVGRRPELEVFERALGSGEQAGLVIYGRAGVG
Ga0318494_1000742573300031751SoilMLADVVMTLPRWPIVGRRPELEVFARALGSGEHLK
Ga0318546_1071819513300031771SoilMLAAVAPTLQRWPIVGRRSELEVFEEALCSGEHAGLVI
Ga0318546_1099365313300031771SoilMLSAVAVTLQRWPIVGRRSELEVFSEALSSGDCAGLVIHGRAG
Ga0318508_106028423300031780SoilMLADVAVTLQQWPIIGRRPEIEVFERALGSGELAGLVIHGRAGTG
Ga0318547_1018646013300031781SoilMLTDVAIALPRWPIVGRRSELEVFERALASGECSGLVI
Ga0318547_1021628813300031781SoilMLADVVMTLPRWPIVGRRPELEVFARALGSGERAGLVIYGRAG
Ga0318547_1037891423300031781SoilMLTDVAIALQRWPIVGRRSELEVFERALASGECAGLV
Ga0318547_1039675823300031781SoilMTLPRWPIVGRRPELEVFERAMGSGERAGLVIYGQA
Ga0318552_1005085343300031782SoilMLADVAVTLQQWPIIGRRPEIEVFERALGSGELAGLVIHGRAGTGKTR
Ga0318552_1025190733300031782SoilMLSAVAVTLQRWPIVGRRSELEVFSEALCSGEHAGLVI
Ga0318529_1057827523300031792SoilMLAGVGVTLQRWPIIGRRPELEVFERALGSGELAG
Ga0318548_1042925623300031793SoilMLSAVAVTLQRWPIVGRRSELEVFSEALSSGEYAGLV
Ga0318557_1015171723300031795SoilMLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGLV
Ga0318565_1013803213300031799SoilMLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGL
Ga0318565_1024051313300031799SoilMLSAVAVTLQRWPIVGRRSELEVFSEALSSGDCAGLVI
Ga0318565_1051308813300031799SoilMLADVVMTLPRWPIVGRRPELEVFERALGSGERAGLVIY
Ga0318497_1008707513300031805SoilMTLPRWPIVGRRPELEVFERALGSGEQAGLVIYGRAGVGKT
Ga0318497_1016247013300031805SoilMLTAVAPTLQRWPIVGRRSELEVFEEALCSGEHAGLVIH
Ga0318499_1026024323300031832SoilMLSAVAATLQRWPIVGRRSELEVFSEALCSGEHAGLVIHGRAGVGKT
Ga0318517_1008220213300031835SoilMLSAVAVTLQRWPIVGRRSELEVFSEALSSGEYAGLVIHG
Ga0318511_1007891433300031845SoilMTLPRWPIVGRRPELEVFERAMGSGERAGLVIYGRAGVGKT
Ga0318495_1026338623300031860SoilMLTAVAPTLQRWPIVGRRSELEVFEEALCSGEHAGLVIHGRAG
Ga0318551_1034911623300031896SoilMLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGLVI
Ga0306923_1134571123300031910SoilLSAQAGAAILADVAVTLQRWPIIGRRAEIEVFERALGSGELAGLVIHGRAGVG
Ga0310912_1089783013300031941SoilMLTDVGIARPRWPIIGRRSELEVFERALGSGQQAGLVIHG
Ga0310910_1105731713300031946SoilMLSAVAVTLQRWPIVGRRSELEVFSEALCSGEHAGLVIHG
Ga0306926_1103279723300031954SoilMLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGLVIYG
Ga0318530_1047351923300031959SoilMLADVGRALPRWPLIGRRSELDVFARALGSGEKAGLVIHGRAGV
Ga0318562_1042662323300032008SoilMLAGVGVALLRWPIVGRRSELEVFERTLTSDQYAGLVI
Ga0318563_1062511223300032009SoilMLADVGRALPRWPLIGRRSELDVFARALGSGEKAGL
Ga0318569_1045867523300032010SoilMLTAVAPTLQRWPIVGRRLELEVFEEALCSGEHAGLVIH
Ga0318545_1034232813300032042SoilMLADVGRALPRWPLIGRRSELDVFARALGSGEKAGLVIHGRAG
Ga0318558_1022388913300032044SoilMLAGVAMALLRWPIVGRRSELEVFERTLTSDGYAGLVIHGRPG
Ga0318506_1003715413300032052SoilMLADVGRALPRWPLIGRRSELDVFARALGSGEKAGLV
Ga0318506_1027459223300032052SoilMLAAVATTLQRWPIVGRRSELEVFEEALCSGEHAGLVIHGRAG
Ga0318506_1028507113300032052SoilMLTAVAPTLQRWPIVGRRAELEVFEEALCSGEHAG
Ga0318504_1006506213300032063SoilMLADVAVTLQQWPIIGRRPEIEVFERALGSGELAG
Ga0318510_1006630413300032064SoilMLADVVMTLPRWPIVGRRPELEVFARALGSGERAGLVI
Ga0318510_1043056813300032064SoilMLTAVAPTLQRWPIVGRRSELEVLSEALRSGEHAGLVIHGRAGVGK
Ga0318524_1026617923300032067SoilMLTDVAIALPRWPIVGRRSELEVFERALASGECAGLVIHG
Ga0318524_1056350823300032067SoilMLAGVTITAQRWPIVGRRPELEAFERALGSAEHAGLVIHGQAG
Ga0318524_1065671723300032067SoilMLARVTITAQRWPIVGRRPELEAFERALGSGEHAGLVIH
Ga0306924_1055990613300032076SoilMLTAVAATLQRWPIVGRRSELEVFSEALRSGEHAGLVIHGRAGVGKT
Ga0318525_1034342513300032089SoilMLSAVTGALQRWPIVGRRAELELFERVLSSGEQMGLIIYGRAGVG
Ga0318525_1044300613300032089SoilMLADVAVTLQQWPIIGRRPEIEVFERALGSGGLAGLVIHGRAG
Ga0318525_1051041123300032089SoilMLAGVAMVLLRWPIVGRRSELEVFERTLTSDEHAGLVIH
Ga0318518_1047795123300032090SoilMLSAVAVTLQRWPIVGRRSELEVFSEALSSGEYAGLVIHGRAGVG
Ga0307470_1035795733300032174Hardwood Forest SoilMLADVVMTLPRWPIVGRRPELEVFERALGSRERAGLVIYGRAGV
Ga0306920_10154540433300032261SoilMLTAVAPTLQRWPIVGRRSELEVFSEALRSGEHAGLVIHGRAGV
Ga0306920_10291314413300032261SoilMLTDVAIALQRWPIVGRRSELEVFERALASGECAGLVIHGQA
Ga0335081_1217698823300032892SoilMLAGVAVTLPRWPIVGRRPELEVFERALGSGELAGLVIHGRAGV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.