Basic Information | |
---|---|
Family ID | F086985 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 40 residues |
Representative Sequence | MLAGVAVTLPRWPIVGRRPELEVFERALGSGELAGLVI |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 43.12 % |
% of genes near scaffold ends (potentially truncated) | 99.09 % |
% of genes from short scaffolds (< 2000 bps) | 92.73 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.818 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (60.909 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (61.818 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.79% β-sheet: 0.00% Coil/Unstructured: 71.21% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF01152 | Bac_globin | 78.18 |
PF07167 | PhaC_N | 1.82 |
PF00296 | Bac_luciferase | 1.82 |
PF00753 | Lactamase_B | 1.82 |
PF07992 | Pyr_redox_2 | 0.91 |
PF13460 | NAD_binding_10 | 0.91 |
PF02627 | CMD | 0.91 |
PF00501 | AMP-binding | 0.91 |
PF02625 | XdhC_CoxI | 0.91 |
PF04226 | Transgly_assoc | 0.91 |
PF02781 | G6PD_C | 0.91 |
PF13193 | AMP-binding_C | 0.91 |
PF13714 | PEP_mutase | 0.91 |
PF01471 | PG_binding_1 | 0.91 |
PF00155 | Aminotran_1_2 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 78.18 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.82 |
COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 1.82 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.91 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.91 |
COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.91 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 51.82 % |
Unclassified | root | N/A | 48.18 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004479|Ga0062595_100103205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1523 | Open in IMG/M |
3300004633|Ga0066395_10647704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
3300005363|Ga0008090_15367021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300005764|Ga0066903_101808229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1167 | Open in IMG/M |
3300005764|Ga0066903_107461266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300006755|Ga0079222_11968108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
3300009523|Ga0116221_1157388 | Not Available | 988 | Open in IMG/M |
3300009698|Ga0116216_10033500 | All Organisms → cellular organisms → Bacteria | 3187 | Open in IMG/M |
3300010043|Ga0126380_10697928 | Not Available | 815 | Open in IMG/M |
3300010047|Ga0126382_10085307 | Not Available | 1990 | Open in IMG/M |
3300010048|Ga0126373_10121335 | All Organisms → cellular organisms → Bacteria | 2445 | Open in IMG/M |
3300010323|Ga0134086_10238895 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 689 | Open in IMG/M |
3300010358|Ga0126370_12550642 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300010360|Ga0126372_10298990 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300010361|Ga0126378_12335646 | Not Available | 610 | Open in IMG/M |
3300010376|Ga0126381_100535936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1657 | Open in IMG/M |
3300010376|Ga0126381_101140265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
3300010376|Ga0126381_101173591 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300010937|Ga0137776_1080276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2278 | Open in IMG/M |
3300011271|Ga0137393_10572325 | Not Available | 969 | Open in IMG/M |
3300012209|Ga0137379_10732434 | Not Available | 894 | Open in IMG/M |
3300012211|Ga0137377_10394700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1321 | Open in IMG/M |
3300012532|Ga0137373_10198522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1654 | Open in IMG/M |
3300016270|Ga0182036_11695450 | Not Available | 533 | Open in IMG/M |
3300016341|Ga0182035_10617299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
3300016357|Ga0182032_10693935 | Not Available | 854 | Open in IMG/M |
3300016371|Ga0182034_10926819 | Not Available | 750 | Open in IMG/M |
3300016387|Ga0182040_11489405 | Not Available | 574 | Open in IMG/M |
3300016422|Ga0182039_11776840 | Not Available | 565 | Open in IMG/M |
3300017924|Ga0187820_1306865 | Not Available | 524 | Open in IMG/M |
3300017926|Ga0187807_1202487 | Not Available | 643 | Open in IMG/M |
3300021405|Ga0210387_10636723 | Not Available | 947 | Open in IMG/M |
3300022533|Ga0242662_10295964 | Not Available | 538 | Open in IMG/M |
3300025915|Ga0207693_10248312 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300025922|Ga0207646_10536008 | Not Available | 1053 | Open in IMG/M |
3300026551|Ga0209648_10722505 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300027812|Ga0209656_10027364 | Not Available | 3421 | Open in IMG/M |
3300031544|Ga0318534_10754265 | Not Available | 548 | Open in IMG/M |
3300031545|Ga0318541_10141770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1315 | Open in IMG/M |
3300031545|Ga0318541_10455534 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300031549|Ga0318571_10195172 | Not Available | 722 | Open in IMG/M |
3300031564|Ga0318573_10609772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300031572|Ga0318515_10035229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2465 | Open in IMG/M |
3300031572|Ga0318515_10399970 | Not Available | 735 | Open in IMG/M |
3300031573|Ga0310915_10731435 | Not Available | 698 | Open in IMG/M |
3300031573|Ga0310915_11188000 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031640|Ga0318555_10700120 | Not Available | 547 | Open in IMG/M |
3300031668|Ga0318542_10353860 | Not Available | 755 | Open in IMG/M |
3300031668|Ga0318542_10385407 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300031679|Ga0318561_10183371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
3300031680|Ga0318574_10166019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1259 | Open in IMG/M |
3300031680|Ga0318574_10325239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
3300031681|Ga0318572_10092885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1692 | Open in IMG/M |
3300031682|Ga0318560_10751994 | Not Available | 526 | Open in IMG/M |
3300031713|Ga0318496_10565855 | Not Available | 628 | Open in IMG/M |
3300031719|Ga0306917_10189635 | Not Available | 1551 | Open in IMG/M |
3300031736|Ga0318501_10027475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2479 | Open in IMG/M |
3300031747|Ga0318502_10998861 | Not Available | 510 | Open in IMG/M |
3300031748|Ga0318492_10415797 | Not Available | 708 | Open in IMG/M |
3300031751|Ga0318494_10007425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5024 | Open in IMG/M |
3300031771|Ga0318546_10718195 | Not Available | 703 | Open in IMG/M |
3300031771|Ga0318546_10993653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300031780|Ga0318508_1060284 | Not Available | 1016 | Open in IMG/M |
3300031781|Ga0318547_10186460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
3300031781|Ga0318547_10216288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1148 | Open in IMG/M |
3300031781|Ga0318547_10378914 | Not Available | 866 | Open in IMG/M |
3300031781|Ga0318547_10396758 | Not Available | 846 | Open in IMG/M |
3300031782|Ga0318552_10050853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1963 | Open in IMG/M |
3300031782|Ga0318552_10251907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
3300031792|Ga0318529_10578275 | Not Available | 521 | Open in IMG/M |
3300031793|Ga0318548_10429256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300031795|Ga0318557_10151717 | Not Available | 1047 | Open in IMG/M |
3300031799|Ga0318565_10138032 | Not Available | 1180 | Open in IMG/M |
3300031799|Ga0318565_10240513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
3300031799|Ga0318565_10513088 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031805|Ga0318497_10087075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1662 | Open in IMG/M |
3300031805|Ga0318497_10162470 | Not Available | 1226 | Open in IMG/M |
3300031832|Ga0318499_10260243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
3300031835|Ga0318517_10082202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1395 | Open in IMG/M |
3300031845|Ga0318511_10078914 | Not Available | 1372 | Open in IMG/M |
3300031860|Ga0318495_10263386 | Not Available | 770 | Open in IMG/M |
3300031896|Ga0318551_10349116 | Not Available | 837 | Open in IMG/M |
3300031941|Ga0310912_10897830 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300031946|Ga0310910_11057317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
3300031954|Ga0306926_11032797 | Not Available | 976 | Open in IMG/M |
3300031959|Ga0318530_10473519 | Not Available | 520 | Open in IMG/M |
3300032008|Ga0318562_10426623 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300032009|Ga0318563_10625112 | Not Available | 580 | Open in IMG/M |
3300032010|Ga0318569_10458675 | Not Available | 594 | Open in IMG/M |
3300032042|Ga0318545_10342328 | Not Available | 538 | Open in IMG/M |
3300032044|Ga0318558_10223889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
3300032052|Ga0318506_10037154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1906 | Open in IMG/M |
3300032052|Ga0318506_10274592 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300032052|Ga0318506_10285071 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300032063|Ga0318504_10065062 | Not Available | 1570 | Open in IMG/M |
3300032064|Ga0318510_10066304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1314 | Open in IMG/M |
3300032064|Ga0318510_10430568 | Not Available | 565 | Open in IMG/M |
3300032067|Ga0318524_10266179 | Not Available | 883 | Open in IMG/M |
3300032067|Ga0318524_10563508 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300032067|Ga0318524_10656717 | Not Available | 553 | Open in IMG/M |
3300032076|Ga0306924_10559906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1297 | Open in IMG/M |
3300032089|Ga0318525_10343425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
3300032089|Ga0318525_10443006 | Not Available | 665 | Open in IMG/M |
3300032089|Ga0318525_10510411 | Not Available | 615 | Open in IMG/M |
3300032090|Ga0318518_10477951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300032174|Ga0307470_10357957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
3300032261|Ga0306920_101545404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
3300032261|Ga0306920_102913144 | Not Available | 648 | Open in IMG/M |
3300032892|Ga0335081_12176988 | Not Available | 585 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 60.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.18% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.73% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.82% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062595_1001032051 | 3300004479 | Soil | MACTGLAWHLSGVVMTLPRWPIVGRRPELEVFERALGSGERAGLAIYGR |
Ga0066395_106477042 | 3300004633 | Tropical Forest Soil | LSARVRADMLAGVGVTLQRWPIIGRRPELEVFERALSSGELAGVVIY |
Ga0008090_153670211 | 3300005363 | Tropical Rainforest Soil | MLTAVSPTLQRWPIVGRRSELEVFSEALCSGEHAGLVIHGRAGVG |
Ga0066903_1018082293 | 3300005764 | Tropical Forest Soil | MTLPRWPIVGRRPELEVFERALGSGEQAGLVIYGRAG |
Ga0066903_1074612662 | 3300005764 | Tropical Forest Soil | MTLPRWPIVGRRPELEVFERALGSGDRAGLAIYGRAGVGKTR |
Ga0079222_119681081 | 3300006755 | Agricultural Soil | MLADVVMTLPRWPIVGRRPELEVFEGALGSGEQAGLVIYGR |
Ga0116221_11573883 | 3300009523 | Peatlands Soil | MLAAVTTTLQRWPIIGRRSELEVFEKALCSGEQVGLVIHGRPGVGKTR |
Ga0116216_100335001 | 3300009698 | Peatlands Soil | MLAPVAITLQRWPIVGRRSELEVFEQALGSGERAGLVIYGRAGVG |
Ga0126380_106979282 | 3300010043 | Tropical Forest Soil | MLAAVTVTLPRWPIVGRRAELEVFGQALDSGEHTGLLI |
Ga0126382_100853071 | 3300010047 | Tropical Forest Soil | MTLPRWPIVGRRPELEVFERALGSGERAGLVVYGRAGVGK |
Ga0126373_101213355 | 3300010048 | Tropical Forest Soil | MLAAVTVTLPRWPIVGRRAELEVFGQALDSGEHTGLLIY |
Ga0134086_102388951 | 3300010323 | Grasslands Soil | MLAGVAVTLPRWPIIGRRLELEVFERAMRSGELAGLVIYGRADVGKTRLA |
Ga0126370_125506421 | 3300010358 | Tropical Forest Soil | MLAGVAMTLQRWPIVGRRSELEVFERALGVGDQAGLVIYGRAG |
Ga0126372_102989904 | 3300010360 | Tropical Forest Soil | MLASVAAVLRWPIVGRRSELEVFERALGPGERAGLVIHGRAG |
Ga0126378_123356461 | 3300010361 | Tropical Forest Soil | MLAGVGVVLPRWPIIGRHPELEVFEQTLGSGDKAGLVIHGRAGVGK |
Ga0126381_1005359361 | 3300010376 | Tropical Forest Soil | MLTDVGIARPRWPIIGRRSELEVFERALGSSEQAGLVIHGRAGVG |
Ga0126381_1011402651 | 3300010376 | Tropical Forest Soil | MLSNVVGVLPRWPMVGRRGELEVFERVLGSAEHKGLII |
Ga0126381_1011735911 | 3300010376 | Tropical Forest Soil | MLARVTITAQRWPIVGRRPELEAFERALGSGEHAGLV |
Ga0137776_10802761 | 3300010937 | Sediment | VGARTLPRWPIIGRRPEIEVFERALGSGEMAGLVIYGRAGV |
Ga0137393_105723251 | 3300011271 | Vadose Zone Soil | MLAGAAMALQRWPIVGRRSELEVFERALGSAELAGLVI |
Ga0137379_107324341 | 3300012209 | Vadose Zone Soil | MLAGVAITLQRWPIVGRRSELEVFERALDSGELAGLVIHGRA |
Ga0137377_103947001 | 3300012211 | Vadose Zone Soil | MTQPRWPIVGRRPELEVFERALGSGGPAGLVIYGRAG |
Ga0137373_101985221 | 3300012532 | Vadose Zone Soil | MLAGVAVTLPRWPIVGRRPELEAFERAMGSGELAGVVIY |
Ga0182036_116954502 | 3300016270 | Soil | MLTDVGIARPRWPIIGRRSELEVFERALGSGQQAGLVIHGRA |
Ga0182035_106172993 | 3300016341 | Soil | MLAGVAMVLLRWPIVGRRSELEVFERTLTSGEYAGLVIHGRA |
Ga0182032_106939351 | 3300016357 | Soil | MLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGLVIYGRVGVGKTRLA |
Ga0182034_109268191 | 3300016371 | Soil | MLADVGVTLQRWPIIGRRPELELFERALDSGELAGVVIYGR |
Ga0182040_114894051 | 3300016387 | Soil | MLTAVTATLQRWPIVGRHAELEVFEEALCSGEHAGLVIHGRAGVG |
Ga0182039_117768402 | 3300016422 | Soil | MLAGVAMVLLRWPIVGRRSELEVFERTLTSDGYAGLVIHGRPGVG |
Ga0187820_13068651 | 3300017924 | Freshwater Sediment | LVRSAMAGMLAGVAVALPQWPIVGRRPELEVFERALGLGDRAGL |
Ga0187807_12024871 | 3300017926 | Freshwater Sediment | VYPGRTVMLSAVAITLQRWPLVGRRSELEVFEKALCSGERTGMVIHGRAGV |
Ga0210387_106367231 | 3300021405 | Soil | MLAAVAVALPQWPVVGRRPELEVFERALVSAECAGL |
Ga0242662_102959641 | 3300022533 | Soil | MLSDVLRALPRWPIVGRRAELEVFERVLGSAESMGLIIYG |
Ga0207693_102483121 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLADVVMTLPRWPIVGRRPELEVFERALGSGERAGLVI |
Ga0207646_105360083 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLARVTITAQRWPIVGRRPELEAFERALGSAEHAGLVI |
Ga0209648_107225052 | 3300026551 | Grasslands Soil | MLTGVAITLQRWPIVGRRSELEVFEKALCSGEYAG |
Ga0209656_100273646 | 3300027812 | Bog Forest Soil | MLAGVAVTLPRWPIVGRRPELEVFERALGSGELAGLVI |
Ga0318534_107542651 | 3300031544 | Soil | MLTAVAATLQRWPIVGRRSELEVFSEALRSGEHAGLVIHGRAGVG |
Ga0318541_101417703 | 3300031545 | Soil | MLADVGRALPRWPLIGRRSELDVFARALGSGEKAGLVIHGR |
Ga0318541_104555342 | 3300031545 | Soil | MLAAVATTLQRWPIVGRRSELEVFEEALCSGEHAGLV |
Ga0318571_101951721 | 3300031549 | Soil | MLTAVAPTLQRWPIVGRRSELEVFSEALRSGEHAGLVIH |
Ga0318573_106097722 | 3300031564 | Soil | MLSAVAATLQRWPIVGRRSELEVFSEALCSGEHAGLVIHG |
Ga0318515_100352294 | 3300031572 | Soil | MLTDVAIALPRWPIVGRRSELEVFERALASGECSGLVIHGQA |
Ga0318515_103999701 | 3300031572 | Soil | MLTAVAPTLQRWPIVGRRSELEVFEEALCSGEHAGLVI |
Ga0310915_107314351 | 3300031573 | Soil | MLTDVAIALPRWPIVGRRSELEVFERALASDECAGLVIHGQ |
Ga0310915_111880002 | 3300031573 | Soil | MLADVVMTLPRWPIVGRRPELEVFARALGSGERAGL |
Ga0318555_107001201 | 3300031640 | Soil | MTLPRWPIVGRRPELEVFERAMGSGERAGLVIYGRAAR |
Ga0318542_103538601 | 3300031668 | Soil | MLTDVAIALPRWPIVGRRSELEVFERALASGECSG |
Ga0318542_103854072 | 3300031668 | Soil | MLADVVMTLPRWPIVGRRPELEVFARALGSGERAGLVIY |
Ga0318561_101833711 | 3300031679 | Soil | MLADVGRALPRWPLIGRRSELDVFARALGSGEQAGLV |
Ga0318574_101660193 | 3300031680 | Soil | MLSAVAVTLQRWPIVGRRSELEVFSEALSSGDCAGLV |
Ga0318574_103252391 | 3300031680 | Soil | MLTAVAPTLQRWPIVGRRSELEVFSEALRSGEHAGLVIHG |
Ga0318572_100928853 | 3300031681 | Soil | MLADVVMTLPRWPIVGRRPELEVFARALGSGERAGLVIYG |
Ga0318560_107519942 | 3300031682 | Soil | MLAAVATTLPRWPIIGRRPELEVFERALGSGELAGLVIYGRAGVR |
Ga0318496_105658551 | 3300031713 | Soil | MLAGVAMVLLRWPIVGRRSELEVFERTLTSDEHAGLVIHGRPG |
Ga0306917_101896351 | 3300031719 | Soil | MLADVAVTLQQWPIIGRRPEIEVFERALGSGELAGLVIHGRAGT |
Ga0318501_100274751 | 3300031736 | Soil | MLAAVATTLPRWPIIGRRPELEVFERALGSGELAGLVIYGRAGVG |
Ga0318502_109988612 | 3300031747 | Soil | MLSAVAATLQRWPIVGRRSELEVFSEALCSGEHAGLV |
Ga0318492_104157972 | 3300031748 | Soil | MTLPRWPIVGRRPELEVFERALGSGEQAGLVIYGRAGVG |
Ga0318494_100074257 | 3300031751 | Soil | MLADVVMTLPRWPIVGRRPELEVFARALGSGEHLK |
Ga0318546_107181951 | 3300031771 | Soil | MLAAVAPTLQRWPIVGRRSELEVFEEALCSGEHAGLVI |
Ga0318546_109936531 | 3300031771 | Soil | MLSAVAVTLQRWPIVGRRSELEVFSEALSSGDCAGLVIHGRAG |
Ga0318508_10602842 | 3300031780 | Soil | MLADVAVTLQQWPIIGRRPEIEVFERALGSGELAGLVIHGRAGTG |
Ga0318547_101864601 | 3300031781 | Soil | MLTDVAIALPRWPIVGRRSELEVFERALASGECSGLVI |
Ga0318547_102162881 | 3300031781 | Soil | MLADVVMTLPRWPIVGRRPELEVFARALGSGERAGLVIYGRAG |
Ga0318547_103789142 | 3300031781 | Soil | MLTDVAIALQRWPIVGRRSELEVFERALASGECAGLV |
Ga0318547_103967582 | 3300031781 | Soil | MTLPRWPIVGRRPELEVFERAMGSGERAGLVIYGQA |
Ga0318552_100508534 | 3300031782 | Soil | MLADVAVTLQQWPIIGRRPEIEVFERALGSGELAGLVIHGRAGTGKTR |
Ga0318552_102519073 | 3300031782 | Soil | MLSAVAVTLQRWPIVGRRSELEVFSEALCSGEHAGLVI |
Ga0318529_105782752 | 3300031792 | Soil | MLAGVGVTLQRWPIIGRRPELEVFERALGSGELAG |
Ga0318548_104292562 | 3300031793 | Soil | MLSAVAVTLQRWPIVGRRSELEVFSEALSSGEYAGLV |
Ga0318557_101517172 | 3300031795 | Soil | MLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGLV |
Ga0318565_101380321 | 3300031799 | Soil | MLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGL |
Ga0318565_102405131 | 3300031799 | Soil | MLSAVAVTLQRWPIVGRRSELEVFSEALSSGDCAGLVI |
Ga0318565_105130881 | 3300031799 | Soil | MLADVVMTLPRWPIVGRRPELEVFERALGSGERAGLVIY |
Ga0318497_100870751 | 3300031805 | Soil | MTLPRWPIVGRRPELEVFERALGSGEQAGLVIYGRAGVGKT |
Ga0318497_101624701 | 3300031805 | Soil | MLTAVAPTLQRWPIVGRRSELEVFEEALCSGEHAGLVIH |
Ga0318499_102602432 | 3300031832 | Soil | MLSAVAATLQRWPIVGRRSELEVFSEALCSGEHAGLVIHGRAGVGKT |
Ga0318517_100822021 | 3300031835 | Soil | MLSAVAVTLQRWPIVGRRSELEVFSEALSSGEYAGLVIHG |
Ga0318511_100789143 | 3300031845 | Soil | MTLPRWPIVGRRPELEVFERAMGSGERAGLVIYGRAGVGKT |
Ga0318495_102633862 | 3300031860 | Soil | MLTAVAPTLQRWPIVGRRSELEVFEEALCSGEHAGLVIHGRAG |
Ga0318551_103491162 | 3300031896 | Soil | MLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGLVI |
Ga0306923_113457112 | 3300031910 | Soil | LSAQAGAAILADVAVTLQRWPIIGRRAEIEVFERALGSGELAGLVIHGRAGVG |
Ga0310912_108978301 | 3300031941 | Soil | MLTDVGIARPRWPIIGRRSELEVFERALGSGQQAGLVIHG |
Ga0310910_110573171 | 3300031946 | Soil | MLSAVAVTLQRWPIVGRRSELEVFSEALCSGEHAGLVIHG |
Ga0306926_110327972 | 3300031954 | Soil | MLAGVGVTLQRWPIIGRRPELDVFERVLGSGELAGLVIYG |
Ga0318530_104735192 | 3300031959 | Soil | MLADVGRALPRWPLIGRRSELDVFARALGSGEKAGLVIHGRAGV |
Ga0318562_104266232 | 3300032008 | Soil | MLAGVGVALLRWPIVGRRSELEVFERTLTSDQYAGLVI |
Ga0318563_106251122 | 3300032009 | Soil | MLADVGRALPRWPLIGRRSELDVFARALGSGEKAGL |
Ga0318569_104586752 | 3300032010 | Soil | MLTAVAPTLQRWPIVGRRLELEVFEEALCSGEHAGLVIH |
Ga0318545_103423281 | 3300032042 | Soil | MLADVGRALPRWPLIGRRSELDVFARALGSGEKAGLVIHGRAG |
Ga0318558_102238891 | 3300032044 | Soil | MLAGVAMALLRWPIVGRRSELEVFERTLTSDGYAGLVIHGRPG |
Ga0318506_100371541 | 3300032052 | Soil | MLADVGRALPRWPLIGRRSELDVFARALGSGEKAGLV |
Ga0318506_102745922 | 3300032052 | Soil | MLAAVATTLQRWPIVGRRSELEVFEEALCSGEHAGLVIHGRAG |
Ga0318506_102850711 | 3300032052 | Soil | MLTAVAPTLQRWPIVGRRAELEVFEEALCSGEHAG |
Ga0318504_100650621 | 3300032063 | Soil | MLADVAVTLQQWPIIGRRPEIEVFERALGSGELAG |
Ga0318510_100663041 | 3300032064 | Soil | MLADVVMTLPRWPIVGRRPELEVFARALGSGERAGLVI |
Ga0318510_104305681 | 3300032064 | Soil | MLTAVAPTLQRWPIVGRRSELEVLSEALRSGEHAGLVIHGRAGVGK |
Ga0318524_102661792 | 3300032067 | Soil | MLTDVAIALPRWPIVGRRSELEVFERALASGECAGLVIHG |
Ga0318524_105635082 | 3300032067 | Soil | MLAGVTITAQRWPIVGRRPELEAFERALGSAEHAGLVIHGQAG |
Ga0318524_106567172 | 3300032067 | Soil | MLARVTITAQRWPIVGRRPELEAFERALGSGEHAGLVIH |
Ga0306924_105599061 | 3300032076 | Soil | MLTAVAATLQRWPIVGRRSELEVFSEALRSGEHAGLVIHGRAGVGKT |
Ga0318525_103434251 | 3300032089 | Soil | MLSAVTGALQRWPIVGRRAELELFERVLSSGEQMGLIIYGRAGVG |
Ga0318525_104430061 | 3300032089 | Soil | MLADVAVTLQQWPIIGRRPEIEVFERALGSGGLAGLVIHGRAG |
Ga0318525_105104112 | 3300032089 | Soil | MLAGVAMVLLRWPIVGRRSELEVFERTLTSDEHAGLVIH |
Ga0318518_104779512 | 3300032090 | Soil | MLSAVAVTLQRWPIVGRRSELEVFSEALSSGEYAGLVIHGRAGVG |
Ga0307470_103579573 | 3300032174 | Hardwood Forest Soil | MLADVVMTLPRWPIVGRRPELEVFERALGSRERAGLVIYGRAGV |
Ga0306920_1015454043 | 3300032261 | Soil | MLTAVAPTLQRWPIVGRRSELEVFSEALRSGEHAGLVIHGRAGV |
Ga0306920_1029131441 | 3300032261 | Soil | MLTDVAIALQRWPIVGRRSELEVFERALASGECAGLVIHGQA |
Ga0335081_121769882 | 3300032892 | Soil | MLAGVAVTLPRWPIVGRRPELEVFERALGSGELAGLVIHGRAGV |
⦗Top⦘ |