| Basic Information | |
|---|---|
| Family ID | F086956 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEELKRARKRL |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.06 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 92.73 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.909 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00990 | GGDEF | 75.45 |
| PF00300 | His_Phos_1 | 4.55 |
| PF00578 | AhpC-TSA | 1.82 |
| PF00326 | Peptidase_S9 | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.91 % |
| Unclassified | root | N/A | 9.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101600416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 549 | Open in IMG/M |
| 3300005363|Ga0008090_10112793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1773 | Open in IMG/M |
| 3300005406|Ga0070703_10113147 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300005435|Ga0070714_100931326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300005435|Ga0070714_101891843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300005560|Ga0066670_10282149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1009 | Open in IMG/M |
| 3300005586|Ga0066691_10238672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300005764|Ga0066903_108206419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300005921|Ga0070766_10808046 | Not Available | 639 | Open in IMG/M |
| 3300006034|Ga0066656_10207354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1249 | Open in IMG/M |
| 3300006102|Ga0075015_100873474 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006791|Ga0066653_10546526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300006797|Ga0066659_11846599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300009093|Ga0105240_10256928 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300009137|Ga0066709_100654004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1505 | Open in IMG/M |
| 3300009143|Ga0099792_11236700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300009174|Ga0105241_10422142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1174 | Open in IMG/M |
| 3300009174|Ga0105241_11006526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300009177|Ga0105248_10844327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1034 | Open in IMG/M |
| 3300010321|Ga0134067_10136878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300010322|Ga0134084_10086703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 981 | Open in IMG/M |
| 3300010360|Ga0126372_10751444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300010379|Ga0136449_104517016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300010396|Ga0134126_10909090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 990 | Open in IMG/M |
| 3300010398|Ga0126383_11816158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300010401|Ga0134121_10123707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2186 | Open in IMG/M |
| 3300010877|Ga0126356_11420204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300011269|Ga0137392_10943187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 710 | Open in IMG/M |
| 3300012202|Ga0137363_11449948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300012207|Ga0137381_11247344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300012361|Ga0137360_10357191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1224 | Open in IMG/M |
| 3300012361|Ga0137360_10916755 | Not Available | 755 | Open in IMG/M |
| 3300012377|Ga0134029_1263978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300012683|Ga0137398_10352040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 997 | Open in IMG/M |
| 3300012683|Ga0137398_10589376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300012971|Ga0126369_12086317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300013296|Ga0157374_10663361 | Not Available | 1055 | Open in IMG/M |
| 3300015357|Ga0134072_10007572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2432 | Open in IMG/M |
| 3300015372|Ga0132256_100422101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1438 | Open in IMG/M |
| 3300015374|Ga0132255_104139912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300016294|Ga0182041_10285841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1360 | Open in IMG/M |
| 3300016294|Ga0182041_10302023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1327 | Open in IMG/M |
| 3300016341|Ga0182035_11362362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300016371|Ga0182034_11515978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300016404|Ga0182037_10538733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 984 | Open in IMG/M |
| 3300016422|Ga0182039_10962848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300017994|Ga0187822_10058225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1102 | Open in IMG/M |
| 3300018034|Ga0187863_10684870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300018064|Ga0187773_10121674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1313 | Open in IMG/M |
| 3300020579|Ga0210407_10089149 | All Organisms → cellular organisms → Bacteria | 2333 | Open in IMG/M |
| 3300021372|Ga0213877_10291461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300021402|Ga0210385_10590346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300021441|Ga0213871_10050959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1134 | Open in IMG/M |
| 3300021477|Ga0210398_10671539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300021559|Ga0210409_10056586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3675 | Open in IMG/M |
| 3300021560|Ga0126371_12020929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 693 | Open in IMG/M |
| 3300021560|Ga0126371_12318734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300025898|Ga0207692_10988263 | Not Available | 555 | Open in IMG/M |
| 3300025906|Ga0207699_10401033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 977 | Open in IMG/M |
| 3300025921|Ga0207652_10976753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300025924|Ga0207694_11893426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300025929|Ga0207664_10887252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300025986|Ga0207658_12081141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300026318|Ga0209471_1245194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 622 | Open in IMG/M |
| 3300026323|Ga0209472_1104480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1127 | Open in IMG/M |
| 3300026979|Ga0207817_1036841 | Not Available | 517 | Open in IMG/M |
| 3300027505|Ga0209218_1137421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300027591|Ga0209733_1071150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300027671|Ga0209588_1208731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300027676|Ga0209333_1216268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300027727|Ga0209328_10082234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 985 | Open in IMG/M |
| 3300027895|Ga0209624_10513362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300028906|Ga0308309_11470935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300030490|Ga0302184_10439272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300030646|Ga0302316_10415703 | Not Available | 540 | Open in IMG/M |
| 3300030693|Ga0302313_10181847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300031090|Ga0265760_10316994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031128|Ga0170823_12916142 | Not Available | 969 | Open in IMG/M |
| 3300031561|Ga0318528_10214844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1030 | Open in IMG/M |
| 3300031561|Ga0318528_10659614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300031616|Ga0307508_10625108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300031713|Ga0318496_10587946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300031719|Ga0306917_11602471 | Not Available | 500 | Open in IMG/M |
| 3300031720|Ga0307469_10445593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1119 | Open in IMG/M |
| 3300031744|Ga0306918_10737734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300031748|Ga0318492_10055344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1863 | Open in IMG/M |
| 3300031753|Ga0307477_10315341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1078 | Open in IMG/M |
| 3300031754|Ga0307475_10263873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1381 | Open in IMG/M |
| 3300031765|Ga0318554_10279883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 949 | Open in IMG/M |
| 3300031779|Ga0318566_10322487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300031782|Ga0318552_10129067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1263 | Open in IMG/M |
| 3300031796|Ga0318576_10637030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300031819|Ga0318568_10153390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1409 | Open in IMG/M |
| 3300031832|Ga0318499_10198127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300031845|Ga0318511_10076793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1389 | Open in IMG/M |
| 3300031894|Ga0318522_10148170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300031910|Ga0306923_10948180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300031962|Ga0307479_10957438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300032009|Ga0318563_10343145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300032039|Ga0318559_10153924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1045 | Open in IMG/M |
| 3300032041|Ga0318549_10032212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2072 | Open in IMG/M |
| 3300032076|Ga0306924_10158165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2596 | Open in IMG/M |
| 3300032090|Ga0318518_10331689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300032160|Ga0311301_12851488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300032180|Ga0307471_100300461 | Not Available | 1692 | Open in IMG/M |
| 3300032261|Ga0306920_101872673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300032261|Ga0306920_103190891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300033412|Ga0310810_11150076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300033480|Ga0316620_11066325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 788 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.91% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1016004161 | 3300002245 | Forest Soil | MKKTGSEPGTSPGEPLERARLQADVAKQRVRLAKDELKRARKRLKEAKREAK |
| Ga0008090_101127931 | 3300005363 | Tropical Rainforest Soil | MKKTASENSHPAESPERVRLQAEVAKQRVRIAKDELKRARK |
| Ga0070703_101131472 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTGGEQVSPAPSPDRARLQADVAKQRVRIAKEELKRARKRLKEAKREAK |
| Ga0070714_1009313261 | 3300005435 | Agricultural Soil | MKKTGSETPANDSEKSKAAPAEPVERTRLQADVAKQRVRIAKEELKRARKRLKEAK |
| Ga0070714_1018918431 | 3300005435 | Agricultural Soil | MKKTGSDNSSRGTEPAEGSQAEPIERARLQAEVARQRVRIAKEELKRARKRLKEAKRE |
| Ga0066670_102821492 | 3300005560 | Soil | MKKTGSEQSSPAEPLERARLQADVAKQRVRIAKEELKRARK |
| Ga0066691_102386721 | 3300005586 | Soil | MKKTGSEARLEPAAHSEDAPAEPIERARLQADVAKQGVRLAKEELKRARKR |
| Ga0066903_1082064191 | 3300005764 | Tropical Forest Soil | MKKTGSEHGTPTEPLARARLQADVAKQRVRIAKDELKRARKRLKEAKREAKRA |
| Ga0070766_108080461 | 3300005921 | Soil | MKKTGSEIAPDEAVQSKAAPAEPVERARLQADVAKQRVRIAKEELKRA |
| Ga0066656_102073541 | 3300006034 | Soil | MKKTGSEQVTPAEPLERARLQAEVAKQRVRIAKEELKRAPRAK |
| Ga0075015_1008734741 | 3300006102 | Watersheds | MKKTGSEIAPDGSEQSKAPPAEPVERARLQADVAKQRVRIAKEELKRARKRLKEAKR |
| Ga0066653_105465262 | 3300006791 | Soil | MKKTGSEQSSPAEPLERARLQADVAKQRVRIAKEELKRARKGL |
| Ga0066659_118465992 | 3300006797 | Soil | MKKTGSEARTETAAYSEDAPAEPIERARLQADVAKQGVRLAKEELK |
| Ga0105240_102569281 | 3300009093 | Corn Rhizosphere | MKKTGSETPANDSKKSEAAPAEPVERTRLQADVAKQRVRIAKEELKRAR |
| Ga0066709_1006540043 | 3300009137 | Grasslands Soil | MKKTGSEQNSPAEPLERARLQADVAKQRVRIAKEELKR |
| Ga0099792_112367002 | 3300009143 | Vadose Zone Soil | MKKTGSEQNTPAEPLEPARLQAEVAKQRVRIAKEELKRARKRLKEAK |
| Ga0105241_104221423 | 3300009174 | Corn Rhizosphere | MKKTGSEPLSSATPFERARLLADVAKQRVRIAKEEL |
| Ga0105241_110065262 | 3300009174 | Corn Rhizosphere | MKKTGGEQVSSALPPERARLQADVAKQRVRIAKDELKRARKRIKEAKSEA |
| Ga0105248_108443272 | 3300009177 | Switchgrass Rhizosphere | MKKTGSETPSDPSEKNKAAATEPVERARLQADISKQRVRIAKEELKRARKR |
| Ga0105248_129255201 | 3300009177 | Switchgrass Rhizosphere | MKKTGTETASAEIIDRAQLQADVARQRVRLAKDELHRARKRLKEAK |
| Ga0134067_101368782 | 3300010321 | Grasslands Soil | MKKTGSEQDTPAEPLERARLQAEVAKQRVRIAKEELKRARKRLKEAK |
| Ga0134084_100867032 | 3300010322 | Grasslands Soil | MKKTGSEQDAPAEPLERARLQAEVAKQRVRIAKEELKRA |
| Ga0126372_107514441 | 3300010360 | Tropical Forest Soil | MKKTGSAQGSAAEPLERVRLQADVAKQRVRIAKDELKRA |
| Ga0136449_1045170162 | 3300010379 | Peatlands Soil | MKKSGSEPSDLPAEPLERARLQAEVARQRVRIAKE |
| Ga0134126_109090902 | 3300010396 | Terrestrial Soil | MKKTGSEQVTPAPPLERARLQADVAKQRVRIAKDELKRARKRLKEAKREAKR |
| Ga0126383_118161581 | 3300010398 | Tropical Forest Soil | MKKTGSEHGTPTEPLARARLQADVAKQRVRIAKDELKRARKRLKEAKRE |
| Ga0134121_101237071 | 3300010401 | Terrestrial Soil | MKKTGSEQSSTAEPLERVRLQADVAKQRVRIAKDELKRARKRLKEAKR |
| Ga0126356_114202042 | 3300010877 | Boreal Forest Soil | MKKTGSEIAPDESEQSKAPPAEPVERARLQADVAKQRVRIAKEELKR |
| Ga0137392_109431871 | 3300011269 | Vadose Zone Soil | MKKTGSEARLETAAHGEDAPAEPIERARLHADVAKQRVRLAKEELKRA |
| Ga0137363_114499482 | 3300012202 | Vadose Zone Soil | MKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEELKRARKRLKEAK |
| Ga0137381_112473442 | 3300012207 | Vadose Zone Soil | MKKTGSEQDTPAEPLERARLQAEVAKQRVRIAKEELKRARKRLKEAKREAR |
| Ga0137360_103571911 | 3300012361 | Vadose Zone Soil | MKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEELKRARKR |
| Ga0137360_109167552 | 3300012361 | Vadose Zone Soil | MKKTGSEARIETAAHSGDTAAEPIERARLQADVAKQRVRLAKE |
| Ga0134029_12639781 | 3300012377 | Grasslands Soil | MKKTGSEQSSPAEPLERARLQADVAKQRVRIAKEELKRARKGLKEAKR |
| Ga0137398_103520402 | 3300012683 | Vadose Zone Soil | MKKTGSEQNTPAEPLEPARLQAEVAKQRVRIAKEELKRARKRLKEAKRE |
| Ga0137398_105893761 | 3300012683 | Vadose Zone Soil | MKKTGSEQDSPAEPLERARLQADVAKQRVRIAKEE |
| Ga0126369_120863172 | 3300012971 | Tropical Forest Soil | MKKTGSEKETPAEPFGRARLLADVAKQRVRIAKEELKRARK |
| Ga0157374_106633612 | 3300013296 | Miscanthus Rhizosphere | MKKTGSETPAIETEQTQAAPAEPVERARLQADVAKQRVRIAKEELKRARKRLK |
| Ga0134072_100075721 | 3300015357 | Grasslands Soil | MKKTGSEQDAPAEPLERARLQAEVAKQRVRIAKEELKRAPRAKRRPVARRAAAAQR |
| Ga0132256_1004221012 | 3300015372 | Arabidopsis Rhizosphere | MKKTGSAQGSAAEPLERVRLQADVAKQRVRIAKDELKRARK |
| Ga0132255_1041399121 | 3300015374 | Arabidopsis Rhizosphere | MKKTGSEPLSSATPFERARLLADVAKQRVRIAKEELKRARKRLKEAKREARRA |
| Ga0182041_102858412 | 3300016294 | Soil | MKKIASENGPPAESPERVRLQADVAKQRVRIAKDELKRAR |
| Ga0182041_103020232 | 3300016294 | Soil | MKKTGSDHGAPAEPLERVRLQAEVAKQRVRIAKDELKRARKRLKEAK |
| Ga0182035_113623622 | 3300016341 | Soil | MKKTGSAQGSAAEPLERVRLQADVAKQRVRIAKDELKRARKRLKEA |
| Ga0182034_115159781 | 3300016371 | Soil | MKKNSSGQDPPAEPLDRVRLQAEVARQRVRIAKDELKRARKRLKE |
| Ga0182037_105387332 | 3300016404 | Soil | MKKTGSDHGAPAEPLERVRLQAEVARQRVRIAKDELKRARKRLK |
| Ga0182039_109628481 | 3300016422 | Soil | MKKTGSDHDSAAEPLGRVRLQADVAKQRVRIAKDELKRARKRLKEAKR |
| Ga0187822_100582252 | 3300017994 | Freshwater Sediment | MKKSGSEPSLPAEPLERARLQAEVAKQRVRIAKDELKRARKRLKEAKREAK |
| Ga0187863_106848701 | 3300018034 | Peatland | MKKTGSEQNAPAEPFERARLQAEVGKQRVRIAKEE |
| Ga0187773_101216742 | 3300018064 | Tropical Peatland | MKKTGSEPQDLPAEPIERARLQADVAKQRVRIAKDELKRARKRLKEAKREAKRA |
| Ga0210407_100891494 | 3300020579 | Soil | MKKTGSEPAPAEPFERIRLQADVAKQRVRIAKEEL |
| Ga0213877_102914612 | 3300021372 | Bulk Soil | MKKSGSETAKLPAEPLERARLQAEVAKQRVRIAKDELKRARKR |
| Ga0210385_105903462 | 3300021402 | Soil | MKKTGSEIAPDEAVQSKAAPAEPVERARLQADVAKQRVRIAKEELKRARKRLKEAKRE |
| Ga0213871_100509592 | 3300021441 | Rhizosphere | MKKTGNVQSVPAVPRGHARLFADVAKQRVRIAKDELKR |
| Ga0210398_106715392 | 3300021477 | Soil | MKKSGSEPSDLPAEPLERARLQAEVAKQRVRIAKEELKRARKRL |
| Ga0210409_100565861 | 3300021559 | Soil | MKKSGGEPATFPAEPLERARLQAEVAKQRVRIAKDELKRARKRLKEAKRE |
| Ga0126371_120209292 | 3300021560 | Tropical Forest Soil | MKKSDSEPADLPAEPLERARLQAEVAKQRVRIAKDELK |
| Ga0126371_123187342 | 3300021560 | Tropical Forest Soil | MKKTGSDHVSAAEPLERVRLQADVSKQRVRIAKDELKRARKRLKEAKREA |
| Ga0207692_109882631 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTGSETPANDSEKSKAAPAEPVERTRLQADVAKQRVRIAKEELKRARK |
| Ga0207699_104010331 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTGSETPANDSEKSKAAPAEPVERTRLQADVAKQR |
| Ga0207652_109767532 | 3300025921 | Corn Rhizosphere | MKKTGSDNSPRGTEPADGSQAEPIERARLQAEVAKQRVRIAKEELKRARKRL |
| Ga0207694_118934262 | 3300025924 | Corn Rhizosphere | MKKTGSAEASPGSSSSADAAAPAEPVERARLQAEVAKQRVRIAKEELKRARKRVKE |
| Ga0207664_108872522 | 3300025929 | Agricultural Soil | MKKTGSETPANDSEKSKAAPAEPVERTRLQADVAKQRVRIAKEELK |
| Ga0207658_120811412 | 3300025986 | Switchgrass Rhizosphere | MKKTGSEPPLEAANGQDTPAEPIERARLQAEVAKQRV |
| Ga0209471_12451942 | 3300026318 | Soil | MKKTGSEQNTPAEPLEPARLQAEVAKQRVRIAKEELKRARK |
| Ga0209472_11044801 | 3300026323 | Soil | MKKTGSEQDAPAEPLERARLQAEVAKQRVRIAKEELKRARKRLKEAK |
| Ga0207817_10368411 | 3300026979 | Tropical Forest Soil | MKKTGSEQHISAEPLERVRLQADVAKQRVRIAKEELKRARKRLKGTRDAAGEEDDEN |
| Ga0209218_11374212 | 3300027505 | Forest Soil | MKKPSSEQSNSSEPIARARLQADVAKQRVRIAKDELK |
| Ga0209733_10711501 | 3300027591 | Forest Soil | MKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEELKRARKRL |
| Ga0209588_12087311 | 3300027671 | Vadose Zone Soil | MKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEE |
| Ga0209333_12162681 | 3300027676 | Forest Soil | MKKTSSESAPTVPAERAKLEAEVAKQRVRLAKEELKRARKRLKEA |
| Ga0209328_100822341 | 3300027727 | Forest Soil | MKKTGSEQVTPAEPLERARLQADVAKQRVRIAKEELKRARKRL |
| Ga0209624_105133622 | 3300027895 | Forest Soil | MKKTASEQDTPVEPLERARLQADVAKQRVRIAKEE |
| Ga0308309_114709351 | 3300028906 | Soil | MKKTGSEQNAPAEPFERARLQADVAKQRVRIAKEELKRARKRLKEA |
| Ga0302184_104392721 | 3300030490 | Palsa | MKKTGSEQNAPAEPSERARLQADVAKQRVRIAKEELKRARKRLKEA |
| Ga0302316_104157031 | 3300030646 | Palsa | MKKTGSEIAPDEAIQSKTAPAEPVERARLQADVAKQRVRIAKEELKRARKRLKEAKR |
| Ga0302313_101818472 | 3300030693 | Palsa | MKKTGSEQNAPAEPSERARLQADVAKQRVRIAKEELKRARKRLKEAKRE |
| Ga0265760_103169941 | 3300031090 | Soil | MKKTASEQDTPVEPLERARLQADVAKQRVRIAKEELKRARKRLKEAKR |
| Ga0170823_129161422 | 3300031128 | Forest Soil | MKKTGSEIAPDEAVQSKAAPAEPVERARLQADVAKQRVRIAKEELKRAASA |
| Ga0318528_102148441 | 3300031561 | Soil | MKKTGSEQPSQAEPLERARLQADVAKQRVRLAKDELK |
| Ga0318528_106596142 | 3300031561 | Soil | MKKTGSEQKSTGEPLARVRLQADVAKQRVRIAKDELKRARKRL |
| Ga0307508_106251081 | 3300031616 | Ectomycorrhiza | MKKTGSEIAPDESEQSKAPPAEPVERARLQADVAKQRVRIAKEELKRARKR |
| Ga0318496_105879462 | 3300031713 | Soil | MKKTGSEQKSTGEPLARVRLQADVAKQRVRIAKDELKRARKR |
| Ga0306917_116024711 | 3300031719 | Soil | MKKTGSEQTTPAEPLERARLQADVAKQRVRIAKEELKRARK |
| Ga0307469_104455932 | 3300031720 | Hardwood Forest Soil | MKKTGSEQNPPAEPLERARLQADVAKQRVRIAKEELKRARRRLKEAK |
| Ga0306918_107377341 | 3300031744 | Soil | MKKTASDPDSAAEPLDRVRLQADVSKQRVRIAKDELKRARKRLKEAKREAKR |
| Ga0318492_100553443 | 3300031748 | Soil | MKKTGSDHDSAAEPLGRVRLQADVAKQRVRIAKDELK |
| Ga0307477_103153413 | 3300031753 | Hardwood Forest Soil | MKKTGSEQDTPAEPLERARLQAEVARQRVRIAKEE |
| Ga0307475_102638732 | 3300031754 | Hardwood Forest Soil | MKKTGSEIPSDEPEKSKAAPAEPERARLQADVAKQRVRIAKEE |
| Ga0318554_102798832 | 3300031765 | Soil | MKKTASENGPSAESPERVRLQADVAKQRVRIAKDELKRARKRLKEAKRE |
| Ga0318566_103224871 | 3300031779 | Soil | MKKNSSGQDPPAEPLDRVRLQAEVARQRVRIAKDEL |
| Ga0318552_101290672 | 3300031782 | Soil | MKKTGSDHGAPAEPLERVRLQAEVAKQRVRIAKDELKRARKRLKEAKREAKR |
| Ga0318576_106370301 | 3300031796 | Soil | MKKTGSEQKSTGEPLARVRLQADVAKQRVRIAKDELKRA |
| Ga0318568_101533901 | 3300031819 | Soil | MKKTASDPDSAAEPLDRVRLQADVSKQRVRIAKDEL |
| Ga0318499_101981271 | 3300031832 | Soil | MKKTGSDHDSAAEPLGRVRLQADVAKQRVRIAKDELKRARKRLK |
| Ga0318511_100767931 | 3300031845 | Soil | MKKTASENGPSAESPERVRLQADVAKQRVRIAKDELKRARKRLK |
| Ga0318522_101481701 | 3300031894 | Soil | MKKTASENGPPAESPERVRLQADVAKQRVRIAKDELKRARKRLK |
| Ga0306923_109481802 | 3300031910 | Soil | MKKTGSEQPSPAEPLERARLQADVAKQRVRLAKDELKR |
| Ga0307479_109574382 | 3300031962 | Hardwood Forest Soil | MKKTGSAQHSTAEPLQRVRLQADVAKQRVRIAKDELKR |
| Ga0318563_103431451 | 3300032009 | Soil | MKKTASDPDSAAEPLDRVRLQADVSKQRVRIAKDELKRARKRLK |
| Ga0318559_101539241 | 3300032039 | Soil | MKKIASENGPPAESPERVRLQADVAKQRVRIAKDELK |
| Ga0318549_100322121 | 3300032041 | Soil | MKKTGSDHDSAAEPLGRVRLQADVAKQRVRIAKDELKRARKRLKEAK |
| Ga0306924_101581651 | 3300032076 | Soil | MKKTGSEQKSTGEPLARVRLQADVAKQRVRIAKDEL |
| Ga0318518_103316891 | 3300032090 | Soil | MKKTGSEQPSQAEPLERARLQADVAKQRVRLAKDELKRARKGLK |
| Ga0311301_128514882 | 3300032160 | Peatlands Soil | MKKSGSEPSDLPAEPLERARLQAEVARQRVRIAKEELKRARKRLKEAK |
| Ga0307471_1003004611 | 3300032180 | Hardwood Forest Soil | MKKTASEQVTPAEPLERARLQADVAKQRVRIAKEELKRARKRLKEAKR |
| Ga0306920_1018726731 | 3300032261 | Soil | MKKTGSEHDAAAEPPERVRLQAEVARQRVRIAKDELKRARKRLKEAKREAKR |
| Ga0306920_1031908912 | 3300032261 | Soil | MKKTGSEPGPADARAVLQADVAKQRVRIAKEELKRARKRLKEAKREARRA |
| Ga0310810_111500762 | 3300033412 | Soil | MKKTGSAQGSAAEPLERVRLQADVAKQRVRIAKDELKRARKRLKEAKREAR |
| Ga0316620_110663251 | 3300033480 | Soil | MKKTGSEQNAPTEPFERARLQADVAKQRVRIAKEELKRARKRLKEA |
| ⦗Top⦘ |