| Basic Information | |
|---|---|
| Family ID | F086954 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LASRIVLLEAGRIVASATPQEFLRLDHPEVRAFTSSLSVAPGAPA |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.45 % |
| % of genes from short scaffolds (< 2000 bps) | 87.27 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.546 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.81% β-sheet: 15.07% Coil/Unstructured: 67.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 78.18 |
| PF04069 | OpuAC | 13.64 |
| PF13620 | CarboxypepD_reg | 1.82 |
| PF00106 | adh_short | 0.91 |
| PF13360 | PQQ_2 | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.73 % |
| Unclassified | root | N/A | 7.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001180|JGI12695J13573_1011760 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300001593|JGI12635J15846_10848032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 523 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100379468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1293 | Open in IMG/M |
| 3300004091|Ga0062387_100176779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1262 | Open in IMG/M |
| 3300005167|Ga0066672_11004871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 509 | Open in IMG/M |
| 3300005172|Ga0066683_10072997 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300005174|Ga0066680_10398557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 874 | Open in IMG/M |
| 3300005330|Ga0070690_100605625 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005332|Ga0066388_101663477 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005334|Ga0068869_100610741 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005435|Ga0070714_101472696 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005436|Ga0070713_102093641 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005518|Ga0070699_101930067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 540 | Open in IMG/M |
| 3300005538|Ga0070731_11152862 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005575|Ga0066702_10903150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 527 | Open in IMG/M |
| 3300005576|Ga0066708_10065871 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300006791|Ga0066653_10585897 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006854|Ga0075425_102862988 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300007258|Ga0099793_10717091 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300007265|Ga0099794_10339500 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300007788|Ga0099795_10571192 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009088|Ga0099830_10010289 | All Organisms → cellular organisms → Bacteria | 5677 | Open in IMG/M |
| 3300009089|Ga0099828_10392787 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300009089|Ga0099828_10896566 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300009137|Ga0066709_101469373 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300010047|Ga0126382_11103557 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300010322|Ga0134084_10431542 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010360|Ga0126372_11628173 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300010361|Ga0126378_10778772 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300010366|Ga0126379_11216910 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300011269|Ga0137392_10677928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 854 | Open in IMG/M |
| 3300011271|Ga0137393_11389244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 591 | Open in IMG/M |
| 3300012096|Ga0137389_10235515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1534 | Open in IMG/M |
| 3300012189|Ga0137388_10638048 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300012189|Ga0137388_11520101 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012189|Ga0137388_11597965 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012202|Ga0137363_11038445 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012202|Ga0137363_11672878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 529 | Open in IMG/M |
| 3300012203|Ga0137399_10125960 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300012203|Ga0137399_10610064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 918 | Open in IMG/M |
| 3300012205|Ga0137362_11161671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 655 | Open in IMG/M |
| 3300012206|Ga0137380_10479209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1098 | Open in IMG/M |
| 3300012349|Ga0137387_10173172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1544 | Open in IMG/M |
| 3300012361|Ga0137360_10519049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1015 | Open in IMG/M |
| 3300012361|Ga0137360_11808495 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012363|Ga0137390_11922991 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012683|Ga0137398_10960372 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012685|Ga0137397_10296087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1206 | Open in IMG/M |
| 3300012685|Ga0137397_10845771 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012925|Ga0137419_11822627 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012927|Ga0137416_10001340 | All Organisms → cellular organisms → Bacteria | 12520 | Open in IMG/M |
| 3300012927|Ga0137416_10516020 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300012930|Ga0137407_11061622 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300012944|Ga0137410_11493094 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012948|Ga0126375_11438219 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012975|Ga0134110_10401727 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012986|Ga0164304_11477123 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300014166|Ga0134079_10035432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1694 | Open in IMG/M |
| 3300015089|Ga0167643_1041796 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300016294|Ga0182041_10326103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1282 | Open in IMG/M |
| 3300018433|Ga0066667_10250101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1343 | Open in IMG/M |
| 3300018468|Ga0066662_10424804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1179 | Open in IMG/M |
| 3300020140|Ga0179590_1163772 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300020170|Ga0179594_10052483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 1379 | Open in IMG/M |
| 3300020579|Ga0210407_10907781 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300020583|Ga0210401_11177810 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021088|Ga0210404_10626152 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300021168|Ga0210406_10002429 | All Organisms → cellular organisms → Bacteria | 21292 | Open in IMG/M |
| 3300021404|Ga0210389_10907296 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300021406|Ga0210386_11072249 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300021420|Ga0210394_11637776 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021478|Ga0210402_10211389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1784 | Open in IMG/M |
| 3300021559|Ga0210409_10710517 | Not Available | 876 | Open in IMG/M |
| 3300025905|Ga0207685_10185228 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300025939|Ga0207665_11575001 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300025949|Ga0207667_10415536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1369 | Open in IMG/M |
| 3300026310|Ga0209239_1327618 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026325|Ga0209152_10124072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 983 | Open in IMG/M |
| 3300026330|Ga0209473_1194788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 773 | Open in IMG/M |
| 3300026354|Ga0257180_1044697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 622 | Open in IMG/M |
| 3300026557|Ga0179587_10355438 | Not Available | 950 | Open in IMG/M |
| 3300027537|Ga0209419_1067975 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300027587|Ga0209220_1054593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1065 | Open in IMG/M |
| 3300027587|Ga0209220_1170765 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300027610|Ga0209528_1103746 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300027671|Ga0209588_1114261 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300027674|Ga0209118_1195958 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027737|Ga0209038_10141098 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300027846|Ga0209180_10432843 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300028047|Ga0209526_10324106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1038 | Open in IMG/M |
| 3300028536|Ga0137415_10443684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1103 | Open in IMG/M |
| 3300029636|Ga0222749_10732900 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300029636|Ga0222749_10782166 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031715|Ga0307476_10721106 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300031720|Ga0307469_10294232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1334 | Open in IMG/M |
| 3300031720|Ga0307469_11273068 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300031740|Ga0307468_102532485 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031753|Ga0307477_10079902 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
| 3300031754|Ga0307475_10017604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4937 | Open in IMG/M |
| 3300031820|Ga0307473_10722831 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031820|Ga0307473_11137258 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031823|Ga0307478_10064098 | All Organisms → cellular organisms → Bacteria | 2761 | Open in IMG/M |
| 3300031823|Ga0307478_10361357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1197 | Open in IMG/M |
| 3300031962|Ga0307479_11084662 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300033412|Ga0310810_10933984 | Not Available | 755 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12695J13573_10117601 | 3300001180 | Forest Soil | ALLLASRIVLLQSGRIVANARPQEFLRIDHPEVKAFTASLQAVPGAPE* |
| JGI12635J15846_108480322 | 3300001593 | Forest Soil | RIILLQNGRMVADGTPEEFLQIDHPEVRAFTASLAPPTGAPA* |
| JGIcombinedJ26739_1003794683 | 3300002245 | Forest Soil | LLESGRIIADATPQEFPRIDHPEVRAFTASLFPLAGAQA* |
| Ga0062387_1001767791 | 3300004091 | Bog Forest Soil | EAMLLASRIVLLEKGRIVASAAPQEFLRVDHQEVRAFTASLAAVSGVRS* |
| Ga0066672_110048712 | 3300005167 | Soil | DLREALLLATRIVLLEAGRIVAVAPPQEFLKADHPEVRAFAASLEANSGAPA* |
| Ga0066683_100729974 | 3300005172 | Soil | LASRIVLLEAGRIVAVAPPREFLQIDHPEVRAFAASLGTNSGAPA* |
| Ga0066680_103985572 | 3300005174 | Soil | ASRIVLLQAGRIVALATPQEFLRLDHPEVRAFTASLAAAPGASA* |
| Ga0070690_1006056252 | 3300005330 | Switchgrass Rhizosphere | LLQGGQIVATAAPEQFLHIDQPEVRAFAASLVPVPGATP* |
| Ga0066388_1016634771 | 3300005332 | Tropical Forest Soil | LLASRIVLLETGRIVATAPPREFLHLDHAEVRAFAASLEAVPGAAP* |
| Ga0068869_1006107412 | 3300005334 | Miscanthus Rhizosphere | ALLLGTRIVLLQGGQIVATAAPEQFLHIDQPEVRAFAASLVPVPGATP* |
| Ga0070714_1014726962 | 3300005435 | Agricultural Soil | LLEKGRIVADAAPQEFPGIDHPEVRAFTASLMPLPGANA* |
| Ga0070713_1020936412 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LASRIILLEKGHIVADATPQEFPGIDHAEVRAFTASLTPFPGGRA* |
| Ga0070699_1019300672 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LREALLLASRIVLLQNGRIAASAKPQEFLRIDHPEVKAFSATLHTVPGAPA* |
| Ga0070731_111528622 | 3300005538 | Surface Soil | TRIVLLQSGRIVASSTPEEFLSIDHPEVRAFAATLDSTPAVPGARA* |
| Ga0066707_103307222 | 3300005556 | Soil | HIVASATPQDFLRLEHPEVRAFTASLAVNPGAPA* |
| Ga0066702_109031501 | 3300005575 | Soil | LLEAGHIVASAAPQEFLRLEHPEVRAFTSSLTVMPGASA* |
| Ga0066708_100658714 | 3300005576 | Soil | RIVLLQAGRIVAVAPPQEFLRLEHPEVRAFAASLETGPGVPA* |
| Ga0066708_103321433 | 3300005576 | Soil | HIVASATPQDFLRLEHPEVRAFTASLAVSPGAPA* |
| Ga0066653_105858972 | 3300006791 | Soil | RIVLLEAGHIVASAAPQEFLRLEHPEVRAFTSSLTVMPGASA* |
| Ga0075425_1028629882 | 3300006854 | Populus Rhizosphere | LLEAGRIVATARPQEFLHVDHPEVRAFAASLETGPGVPA* |
| Ga0099793_107170912 | 3300007258 | Vadose Zone Soil | ALLLASRIVLLESGRIVASAAPQEFLRLDHPEVNAFAASLDMTPGASA* |
| Ga0099794_103395002 | 3300007265 | Vadose Zone Soil | ILLEAGRIVASATPQEFLRLDHPEVRAFTSSLVVTPGVVA* |
| Ga0099795_105711922 | 3300007788 | Vadose Zone Soil | LEKGRIVADATPQEFPRIDHPEVRAFTASLAPLPGVQA* |
| Ga0099830_100102896 | 3300009088 | Vadose Zone Soil | LLASRIVLLQAGRIVASATPQEFLRLDHAEVRAFTSSLSVSPGALA* |
| Ga0099828_103927871 | 3300009089 | Vadose Zone Soil | ALLLASRIVLLEAGRIVASAPPQDFLRLDHPEVRAFTSSLAITPGTCA* |
| Ga0099828_108965662 | 3300009089 | Vadose Zone Soil | LEKGRIVATAPPQEFLRIQHPEVQAFTSSLVPVSGAPA* |
| Ga0066709_1014693731 | 3300009137 | Grasslands Soil | KGRIVSSSTPQEFLKIEHPEVQAFVSSLAPIPGAPA* |
| Ga0126382_111035572 | 3300010047 | Tropical Forest Soil | EALFLASRIVLLEAGQVVATAAPQEFVRLNHPEVQAFTASLELAPGAPA* |
| Ga0134084_104315421 | 3300010322 | Grasslands Soil | AAARIVLLEAGRIIASATPQEFLRLDHPEVRAFASSIAIAPGAPV* |
| Ga0126372_116281732 | 3300010360 | Tropical Forest Soil | IVLLEAGRVVATATPQEFVRLNHPEVQAFTASLELAPGAPA* |
| Ga0126378_107787723 | 3300010361 | Tropical Forest Soil | ALMLASRIILLEAGRIVAATAPREFLRVDHPEVKAFAASLETPGAPG* |
| Ga0126379_112169101 | 3300010366 | Tropical Forest Soil | VLLEAGRIVAVAPPQEFLRLEHPEVRAFAASLETGPGVPA* |
| Ga0137392_106779281 | 3300011269 | Vadose Zone Soil | LLLASRIVLLQAGRIVASATPQEFLRLDHPEVRAFTSSLVMTPGAPA* |
| Ga0137393_113892441 | 3300011271 | Vadose Zone Soil | ALLLATRIVLLQTGRIVASATPQEFLRLDHPEVRAFTASLAVTPGASA* |
| Ga0137389_102355153 | 3300012096 | Vadose Zone Soil | LREALLLASRIILLEKGRIVADTTPQEFSRIDHPEVRAFTASLSPLAGAHI* |
| Ga0137388_106380482 | 3300012189 | Vadose Zone Soil | SRIVLLEKGRIVAAAPPQEFLRIQHPEVQAFTSSLVPLPGASA* |
| Ga0137388_115201011 | 3300012189 | Vadose Zone Soil | LLASRIILLEKGRIVASATPQEFPRIDHPEVRAFTASLTPLAGAPA* |
| Ga0137388_115979651 | 3300012189 | Vadose Zone Soil | LASRIVLLEAGRIVASATPQEFLRLDHPEVRAFTSSLAIIPGVSA* |
| Ga0137363_110384451 | 3300012202 | Vadose Zone Soil | GRIVADATPEEFPRIEHPEVRAFTACLAPLNGAQA* |
| Ga0137363_116728782 | 3300012202 | Vadose Zone Soil | EALLLASRIVLLQAGRIVASATPQEFLRLDHAEVRAFTSSLSVSPGAFV* |
| Ga0137399_101259601 | 3300012203 | Vadose Zone Soil | LLQAGRIVASATPQEFLRLDHPEVRAFTSSLVMPPGTPA* |
| Ga0137399_106100641 | 3300012203 | Vadose Zone Soil | RIVLLQAGRIVASATPQEFLRLDHAEVRAFTSSLSVSPGAFV* |
| Ga0137362_111616711 | 3300012205 | Vadose Zone Soil | EALLLASHIVLLQDGRIVASAAPKEFLRLDHPEVRAFTASLDIAPGASA* |
| Ga0137380_104792093 | 3300012206 | Vadose Zone Soil | AGLIVASATPEEFLHLNHPEVRAFTSSLAMTPGASA* |
| Ga0137381_111933891 | 3300012207 | Vadose Zone Soil | GLIVASAAPEEFLHLNHPEVRAFTSSLAMTPGAST* |
| Ga0137387_101731723 | 3300012349 | Vadose Zone Soil | EAGRIVAVARPQEFLKLDHPEVRAFTASLETNFGVPT* |
| Ga0137360_105190493 | 3300012361 | Vadose Zone Soil | LEAGRIVANAAPQEFLRLDHPEVRAFTSSLDVSPGASA* |
| Ga0137360_118084952 | 3300012361 | Vadose Zone Soil | EKGRVVASAKPQDFPRIDHPEVRAFTASMIPLPGAQA* |
| Ga0137390_119229912 | 3300012363 | Vadose Zone Soil | REAVLLASRIVLLEAGRIVASALPQEFLRLDHPEVRAFTASLAVAPGDPA* |
| Ga0137398_109603721 | 3300012683 | Vadose Zone Soil | DLRVALLPASRIVLLEKGRIVADGTPHEFHRTNDPELGAFTASLAPLSGVQA* |
| Ga0137397_102960871 | 3300012685 | Vadose Zone Soil | ALLLASRIVLLQTGRIVASATPQEFLRLDHAEVRAFTSSLSVSPGALA* |
| Ga0137397_108457712 | 3300012685 | Vadose Zone Soil | LLLASRIVLLEKGRIVADATPQEFPRIDHPEVRAFTASLAPLSGVQA* |
| Ga0137419_118226272 | 3300012925 | Vadose Zone Soil | SRIVLLEKGRIVADATPQEFPRVDHPEVRAFTASLAPLSGAQA* |
| Ga0137416_1000134022 | 3300012927 | Vadose Zone Soil | LEAGRIVASATPQEFLRLDHPEVRAFTSSLAVPSGIPA* |
| Ga0137416_105160201 | 3300012927 | Vadose Zone Soil | MLLASRIVLLQAGRIVASATPGEFLRLDHPEVRAFTSSLSVSPGLPA* |
| Ga0137407_110616222 | 3300012930 | Vadose Zone Soil | ALLLGSRIVLLQSGQIVAAAAPREFLRIDHPEVRAFAASLLAVPGALV* |
| Ga0137410_114930941 | 3300012944 | Vadose Zone Soil | LLATRIVLLQTGRIVASATPQEFLRLDHPEVRAFTASLAVTPEAST* |
| Ga0126375_114382191 | 3300012948 | Tropical Forest Soil | FQAGKIVATASPQEFLRIDHPEVRAFVASLAGDTGDAA* |
| Ga0134110_104017271 | 3300012975 | Grasslands Soil | EALLLASRIVLLERGKVVAVAPPEEFLRLEHPEVRAFAASLETTPEAPV* |
| Ga0164304_114771232 | 3300012986 | Soil | ALLLGTRIVLLQGGQVVATAAPEQFLHIDQPEVRAFAASLVPVPGATP* |
| Ga0134079_100354323 | 3300014166 | Grasslands Soil | VLLDTGRIAAVAPPQEFLRMDHPEVRAFVASLGAVPGAPV* |
| Ga0167643_10417962 | 3300015089 | Glacier Forefield Soil | IVLLQAGRIVASALPSEFLRVDHPEVHAFASSLVPIPGAPA* |
| Ga0137403_101607611 | 3300015264 | Vadose Zone Soil | GRIVASATPQEFLRLDHAEVRAFTVSLNITPVASQ* |
| Ga0182036_100996061 | 3300016270 | Soil | ALLLASRIVLLKAGRIVASAPRDEFLQLEHEEVRAFGASLSNQAGEPA |
| Ga0182041_103261031 | 3300016294 | Soil | ASRIVLLDAGRIVAVAPPQEFLRIDHPEVRAFAASLEAVPGAHL |
| Ga0066667_102501013 | 3300018433 | Grasslands Soil | LASRIVLLEAGRIIASATPQEFLRLDHPEVRAFASSLAIAPGAPV |
| Ga0066662_104248043 | 3300018468 | Grasslands Soil | SRIVLLQAGRIVASATPQEFLRLDHPEVRAFTASLAAAPGASA |
| Ga0179590_11637721 | 3300020140 | Vadose Zone Soil | VLLEKGRIVADATPQEFPRIDHPEVRAFTASLAPLSGVQA |
| Ga0179594_100524833 | 3300020170 | Vadose Zone Soil | LLASRIVLLQAGRIVASATPQEFLRLDHAEVRAFTSSLSVSPGAFV |
| Ga0210407_109077812 | 3300020579 | Soil | IREALLLGQRIALLHAGRLVALASPQEFLRLDHPEVHAFTASLTVSDGVTP |
| Ga0210401_111778102 | 3300020583 | Soil | IVLLQNGEIVASGRPQEFLRIDHPEVKAFAASLQSVPGVPA |
| Ga0210404_106261521 | 3300021088 | Soil | REALLLASRIALLESGRLVAVGPPDVFLHLPHPEVQAFAASLIVSSGAPS |
| Ga0210406_1000242921 | 3300021168 | Soil | REALFLASRIVLLEAGRLVASATPQEFLRLDHPEVRAFTSSLAMTPGASA |
| Ga0210389_109072961 | 3300021404 | Soil | EALLLASRIILLEGGRVVADATPEEFPRIDHPEVRAFTASLHPLDGAQA |
| Ga0210386_110722492 | 3300021406 | Soil | LLLATRIVLLQAGRIIASAAPQEFLRIDHPEVQAFASSLGTLPGAPA |
| Ga0210394_116377761 | 3300021420 | Soil | LEGGRIVADATPQEFPRIDHPEVRAFTASLDPLRGAQA |
| Ga0210402_102113893 | 3300021478 | Soil | LREALLLATRIVLLEAGRIVASAAPQEFLRLDHPEVRAFTASLTVAPGAPA |
| Ga0210409_107105171 | 3300021559 | Soil | ALLLASRIVLLQNGKIVASGRPQEFLRIDHPEVKAFAASLQSVPGVPA |
| Ga0207685_101852281 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LENGRIVADASPQEFSRIDHPEVRAFTASLDPLAGAQA |
| Ga0207665_115750011 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ASRIVLLEKGRIVADATPEEFPRIDHPEVHAFTASLAPLSGVQA |
| Ga0207667_104155363 | 3300025949 | Corn Rhizosphere | LGTRIVRLQGGKIVATAAPEQFLHIDQPEVRAFAASLVPVPGATP |
| Ga0209239_13276181 | 3300026310 | Grasslands Soil | DAFIPALLLASRIVLLDTGRIAAVAPPQEFLRMDHPEVRAFVASLGAVPGAPV |
| Ga0209152_101240721 | 3300026325 | Soil | SRIVLLEAGHVVASAAPQEFLRLDHPEVRAFTSSLSVTPGGSA |
| Ga0209473_11947882 | 3300026330 | Soil | LLEAGPVVASAAPQEFLRLDHPEVRAFTSSLSVTPGGSA |
| Ga0257180_10446971 | 3300026354 | Soil | EALLLASRIVLLQAGRIVASATPQEFLRLDHAEVRAFTSSLSVSPGALA |
| Ga0179587_103554383 | 3300026557 | Vadose Zone Soil | GRIVADATPQEFPRIDHPEVRAFTASLAPLPGVQA |
| Ga0209419_10679751 | 3300027537 | Forest Soil | GRIIADATPEEFPRIDHPEVRAFTASLAPLAGAQA |
| Ga0209220_10545933 | 3300027587 | Forest Soil | IVLLEVGRIVANTTPQEFLRLDHPEVRAFTASLGTSLTTTPGEPA |
| Ga0209220_11707651 | 3300027587 | Forest Soil | DLREALLLASRIILLQTGRIIADATPQEFPHIDHPEVRAFTASLTPLAGAQA |
| Ga0209528_11037461 | 3300027610 | Forest Soil | ATRIVLLQAGRIIASASPQEFLRIDHPEVRAFAASLTPLDGAPA |
| Ga0209588_11142612 | 3300027671 | Vadose Zone Soil | ALLLASRIVLLQAGRIVASATPQEFLRLDHAEVRAFTSSLSVSPGALA |
| Ga0209118_11959581 | 3300027674 | Forest Soil | LASRIVLLQNGKIVASARPQEFLRIDHPEVQAFAASLQSVPGVPA |
| Ga0209038_101410981 | 3300027737 | Bog Forest Soil | LASRIVLLQAGRIVSSAPPQEFLRIDHPEVQAFAASLGSLPGAPA |
| Ga0209180_104328431 | 3300027846 | Vadose Zone Soil | LASRIVLLEKGRIVATAPPQEFLRIQHPEVQAFTSSLVPVSGAPA |
| Ga0209526_103241061 | 3300028047 | Forest Soil | RIILLEAGRMVASATPREFLHLDHPEVRAFTSSLSVSTEASAVSPP |
| Ga0137415_104436841 | 3300028536 | Vadose Zone Soil | IVLLQAGRIVASATPQEFLRLDHAEVRAFTSSLSVSPGASA |
| Ga0222749_107329002 | 3300029636 | Soil | LASRIVLLEAGRIVASATPQEFLRLDHPEVRAFTSSLSVAPGAPA |
| Ga0222749_107821662 | 3300029636 | Soil | RIVLLEAGRIVASSTPPEFLSIDHPEVRAFAASLNPALGAGA |
| Ga0307476_107211061 | 3300031715 | Hardwood Forest Soil | LREAILLASRIILLQNGRMVADATPQEFPYIDHPEVRAFTASLAPPTGAQA |
| Ga0307469_102942321 | 3300031720 | Hardwood Forest Soil | EALLLASRFVLLESGRIVASAAPQEFLRLDHPEVHAFAASLDMTPGAST |
| Ga0307469_112730682 | 3300031720 | Hardwood Forest Soil | LLEKGRVIASATPQEFPRINHPEVRAFTASLTPLAGAPA |
| Ga0307468_1025324851 | 3300031740 | Hardwood Forest Soil | VLLEKGRIIASATPHDFPRIDHPEVRAFTSSLIPLPGAPA |
| Ga0307477_100799024 | 3300031753 | Hardwood Forest Soil | SRIILLENGRIITDCSPQEFPRIDHPEVQAFTDCLAPLPGASA |
| Ga0307475_100176041 | 3300031754 | Hardwood Forest Soil | EALLLASRIVLLENGRMVASARPQEFLRIDHPEVQAFSASLHTVPGAPA |
| Ga0307473_107228311 | 3300031820 | Hardwood Forest Soil | EAGRIVASATPQEFLRLDHPEVRAFTASLNAAPGASA |
| Ga0307473_111372581 | 3300031820 | Hardwood Forest Soil | GRIVASTTPQEFLHLDHPEVRAFTSSLAISPGAPA |
| Ga0307478_100640981 | 3300031823 | Hardwood Forest Soil | RIVLLQNGRIVASAKPQEFLRIDHPEVKAFSASLHTVPGEMA |
| Ga0307478_103613571 | 3300031823 | Hardwood Forest Soil | REALLLASHIILLEAGRIVASAPPQEFLRLDHPEVRAFTASLFVTPGVPV |
| Ga0307479_110846622 | 3300031962 | Hardwood Forest Soil | ASRIVLLESGRIVASATPQDFLHLDHPEVRAFTASLDITPGVSA |
| Ga0310810_109339842 | 3300033412 | Soil | LLLASRIVLLQGGRIVASALPQEFLRIDHPEVRAFASSLVPVPGAPA |
| ⦗Top⦘ |