| Basic Information | |
|---|---|
| Family ID | F086922 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PGVDLAINGLVEATPDDHELLERGMAIFDGLYTVLKQKT |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.73 % |
| % of genes near scaffold ends (potentially truncated) | 96.36 % |
| % of genes from short scaffolds (< 2000 bps) | 94.55 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF06439 | 3keto-disac_hyd | 14.55 |
| PF07485 | DUF1529 | 11.82 |
| PF09828 | Chrome_Resist | 2.73 |
| PF02417 | Chromate_transp | 1.82 |
| PF09837 | DUF2064 | 1.82 |
| PF09678 | Caa3_CtaG | 0.91 |
| PF00005 | ABC_tran | 0.91 |
| PF13473 | Cupredoxin_1 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 1.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.27 % |
| Unclassified | root | N/A | 2.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig1060181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300002558|JGI25385J37094_10191918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300005166|Ga0066674_10481939 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005175|Ga0066673_10327005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 895 | Open in IMG/M |
| 3300005186|Ga0066676_10568103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 769 | Open in IMG/M |
| 3300005330|Ga0070690_101500546 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005332|Ga0066388_103008028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 861 | Open in IMG/M |
| 3300005526|Ga0073909_10249125 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005540|Ga0066697_10020608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3566 | Open in IMG/M |
| 3300005555|Ga0066692_10428462 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005556|Ga0066707_10324490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1008 | Open in IMG/M |
| 3300005556|Ga0066707_10680945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300005557|Ga0066704_10408855 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 900 | Open in IMG/M |
| 3300005558|Ga0066698_10147303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1588 | Open in IMG/M |
| 3300005560|Ga0066670_10841683 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005569|Ga0066705_10014617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3875 | Open in IMG/M |
| 3300005764|Ga0066903_101432863 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300006034|Ga0066656_10197979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1278 | Open in IMG/M |
| 3300006794|Ga0066658_10490687 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006806|Ga0079220_11243758 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300006852|Ga0075433_11015727 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300006880|Ga0075429_100169314 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300006880|Ga0075429_101344070 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006914|Ga0075436_101145828 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009012|Ga0066710_104404499 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300009038|Ga0099829_11692387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300009089|Ga0099828_10551706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1038 | Open in IMG/M |
| 3300009089|Ga0099828_10810791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 838 | Open in IMG/M |
| 3300009089|Ga0099828_11786653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300009090|Ga0099827_11160054 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300009148|Ga0105243_12522065 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300009162|Ga0075423_12874295 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009176|Ga0105242_12151510 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300009792|Ga0126374_10618061 | Not Available | 802 | Open in IMG/M |
| 3300009819|Ga0105087_1014469 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300010029|Ga0105074_1074462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 620 | Open in IMG/M |
| 3300010043|Ga0126380_10467690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 958 | Open in IMG/M |
| 3300010047|Ga0126382_11725741 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 586 | Open in IMG/M |
| 3300010048|Ga0126373_12091723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 628 | Open in IMG/M |
| 3300010321|Ga0134067_10207279 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300010322|Ga0134084_10231603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 659 | Open in IMG/M |
| 3300010359|Ga0126376_10371691 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300010359|Ga0126376_11420423 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 719 | Open in IMG/M |
| 3300010360|Ga0126372_10980985 | Not Available | 855 | Open in IMG/M |
| 3300010361|Ga0126378_11642802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 730 | Open in IMG/M |
| 3300010362|Ga0126377_10481007 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300010362|Ga0126377_10801189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1000 | Open in IMG/M |
| 3300010366|Ga0126379_12804947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300010398|Ga0126383_12573605 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 593 | Open in IMG/M |
| 3300011270|Ga0137391_10536395 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 987 | Open in IMG/M |
| 3300012096|Ga0137389_10609773 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 938 | Open in IMG/M |
| 3300012096|Ga0137389_10826230 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
| 3300012189|Ga0137388_10559264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1063 | Open in IMG/M |
| 3300012198|Ga0137364_10310902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1171 | Open in IMG/M |
| 3300012203|Ga0137399_11151210 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300012204|Ga0137374_10448794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1013 | Open in IMG/M |
| 3300012207|Ga0137381_11041125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
| 3300012285|Ga0137370_10111159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1553 | Open in IMG/M |
| 3300012350|Ga0137372_10213417 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1537 | Open in IMG/M |
| 3300012350|Ga0137372_10525243 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 877 | Open in IMG/M |
| 3300012361|Ga0137360_10631318 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 918 | Open in IMG/M |
| 3300012379|Ga0134058_1256947 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012685|Ga0137397_11030097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
| 3300012957|Ga0164303_10923573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
| 3300012972|Ga0134077_10011875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2854 | Open in IMG/M |
| 3300012976|Ga0134076_10052015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1547 | Open in IMG/M |
| 3300014308|Ga0075354_1116888 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300015358|Ga0134089_10579810 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300015374|Ga0132255_102354386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 813 | Open in IMG/M |
| 3300016341|Ga0182035_12159190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 505 | Open in IMG/M |
| 3300017654|Ga0134069_1147568 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 785 | Open in IMG/M |
| 3300018075|Ga0184632_10002609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7510 | Open in IMG/M |
| 3300018433|Ga0066667_10088312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2022 | Open in IMG/M |
| 3300018433|Ga0066667_10315894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1224 | Open in IMG/M |
| 3300018433|Ga0066667_11303195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300018468|Ga0066662_10416650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1188 | Open in IMG/M |
| 3300018468|Ga0066662_11901051 | Not Available | 623 | Open in IMG/M |
| 3300018468|Ga0066662_12690145 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300018482|Ga0066669_11569108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
| 3300018482|Ga0066669_12188202 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300019789|Ga0137408_1110621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1910 | Open in IMG/M |
| 3300022694|Ga0222623_10259543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 670 | Open in IMG/M |
| 3300024330|Ga0137417_1474791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1007 | Open in IMG/M |
| 3300025917|Ga0207660_10446394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1046 | Open in IMG/M |
| 3300026297|Ga0209237_1045081 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2266 | Open in IMG/M |
| 3300026316|Ga0209155_1133088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 850 | Open in IMG/M |
| 3300026325|Ga0209152_10470162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300026333|Ga0209158_1121927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 975 | Open in IMG/M |
| 3300026333|Ga0209158_1246545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
| 3300026342|Ga0209057_1049624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1990 | Open in IMG/M |
| 3300026469|Ga0257169_1091709 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026532|Ga0209160_1349983 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
| 3300026537|Ga0209157_1378125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300026538|Ga0209056_10483877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
| 3300026548|Ga0209161_10414471 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300027527|Ga0209684_1067696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300027748|Ga0209689_1417040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300027882|Ga0209590_10747738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 624 | Open in IMG/M |
| 3300027909|Ga0209382_12149092 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300028792|Ga0307504_10306758 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 599 | Open in IMG/M |
| 3300031546|Ga0318538_10603632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 595 | Open in IMG/M |
| 3300031564|Ga0318573_10272580 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 904 | Open in IMG/M |
| 3300031716|Ga0310813_11813673 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031740|Ga0307468_101556124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
| 3300031782|Ga0318552_10065152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1752 | Open in IMG/M |
| 3300032174|Ga0307470_11605772 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300032180|Ga0307471_100723716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1160 | Open in IMG/M |
| 3300032180|Ga0307471_102451701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
| 3300032180|Ga0307471_103826251 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300032180|Ga0307471_104138902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_01204170 | 2124908045 | Soil | LHDGKFTRNESMGVDLAIRALAEATPDDHELLERGMAIFDGLHVVLKQKKT |
| JGI25385J37094_101919181 | 3300002558 | Grasslands Soil | MRWLTSEADLHDGTFTRQESTGADLAIKGLAAAAQDDHELLERGMAIFEGLRSVLKQKT* |
| Ga0066674_104819391 | 3300005166 | Soil | TGVDLAINGLVEATPDDDDLLARGMAIFDGLYTVLKQKT* |
| Ga0066673_103270051 | 3300005175 | Soil | ADLHDGTFTRQESTGADLAIKGLAAAAQDDHELLERGMAIFEGLRSVLKQKT* |
| Ga0066676_105681032 | 3300005186 | Soil | TGVDLAIRALAEATPDDHDLLERGMAIFDGLHAVLKQKTT* |
| Ga0070690_1015005461 | 3300005330 | Switchgrass Rhizosphere | RNESSGVDLAIQALAETTEDDHVLLERGMALFNGLFAVLKHTT* |
| Ga0066388_1030080281 | 3300005332 | Tropical Forest Soil | DGKFTRDESTGVDLAIRALAESTGDDHDLLERGMAIFDGLYTVLKRKA* |
| Ga0073909_102491251 | 3300005526 | Surface Soil | RNESTGVDLAIRALAEATPDDHDLLERGMAIFDGLHAVLKQKKA* |
| Ga0066697_100206087 | 3300005540 | Soil | RGVDLAIKGLAESTGDDHELLERGMAIFDGLYTVLKRKT* |
| Ga0066692_104284622 | 3300005555 | Soil | EADLHDGKFTRNESTGVDLAIRALAEATPDDDDLLERGMAIFDGLHSVLKQKKT* |
| Ga0066707_103244903 | 3300005556 | Soil | IRALAEATPDDHDLLEHGMAIFDGLHAVLKQKTT* |
| Ga0066707_106809452 | 3300005556 | Soil | DLHDGKFTRNESTGVDLAIRALAEATPDDHDLLERGMAIFDGLHAVLKQKTT* |
| Ga0066704_104088552 | 3300005557 | Soil | ESTGVDLAIRALAEATPDDHDLLERGMAIFDGLHAVLKQKTT* |
| Ga0066698_101473031 | 3300005558 | Soil | LHDGKFTRNESTGVDLAIRALAEATPDDLELLERGIAIFDGLHAVLKQKTA* |
| Ga0066670_108416832 | 3300005560 | Soil | AIRGLAASTQEDQELLERGMAIFDGLYTVLKRKT* |
| Ga0066705_100146171 | 3300005569 | Soil | GVDLAIRALAEATPDDDELLTRGMAMFDGLYAVLKSKTR* |
| Ga0066903_1014328633 | 3300005764 | Tropical Forest Soil | HAAAGLDLAIKGLAEATPDDHELFERGGAMFDGIYAVLKRDG* |
| Ga0066656_101979793 | 3300006034 | Soil | GKFTRNESTGVDLAIRALAEATLDDQELLERGMAIFDGLHSVLKQKKT* |
| Ga0066658_104906872 | 3300006794 | Soil | RNESTGVDLAIRALAEATPDDHDLLERGMAIFDGLHVVLKQKRT* |
| Ga0079220_112437582 | 3300006806 | Agricultural Soil | GLDLAINGLVEATPDDHELLARGGALFEGLYAVLKQKT* |
| Ga0075433_110157271 | 3300006852 | Populus Rhizosphere | DLAINGLVEATPDDDELLERGMAIFDGLYTVLKQKT* |
| Ga0075429_1001693144 | 3300006880 | Populus Rhizosphere | SGVDLAINGLVAAVPDDHELLERGMALFDGLHRVLKQQA* |
| Ga0075429_1013440702 | 3300006880 | Populus Rhizosphere | ATGVDLAIRALAESTPDDHDLLERGMAIFDGLYTVLKQKG* |
| Ga0075436_1011458282 | 3300006914 | Populus Rhizosphere | GKFTRNESIGVDLTLRALAEATTDDQDLLTQGMAIFDGLYTVLKQKA* |
| Ga0066710_1044044991 | 3300009012 | Grasslands Soil | PGVDLAINGLVEATPDDHELLERGMAIFDGLYTVLKQKT |
| Ga0099829_116923871 | 3300009038 | Vadose Zone Soil | GLDLAINGLVEATPDDDELLARGMGIFEGLYAVLKQKT* |
| Ga0099828_105517063 | 3300009089 | Vadose Zone Soil | EAHGIDLAVNGLVAATPDDHELLERGMILFDGRYATLKQKT* |
| Ga0099828_108107912 | 3300009089 | Vadose Zone Soil | GVDLAINSLVEVTPDDHELLERGMAIFEGLYTVFKQKT* |
| Ga0099828_117866531 | 3300009089 | Vadose Zone Soil | LAIKGLAEATQDDHDLLERGMAICDGLYTVLKRKT* |
| Ga0099827_111600542 | 3300009090 | Vadose Zone Soil | AILGLAATIHDDHELLERGMALFDGLYTVLKQRT* |
| Ga0105243_125220652 | 3300009148 | Miscanthus Rhizosphere | IGVDLTLRALAEAMTDDHDLLTQGMAIFDGLYTVLKQKA* |
| Ga0075423_128742951 | 3300009162 | Populus Rhizosphere | DLTLRALAEATTDDQDLLTQGMAIFDGLYTVLKQKA* |
| Ga0105242_121515102 | 3300009176 | Miscanthus Rhizosphere | DSKFTRNESIGVDLTLHALAETMTDDHDLLTQGMAIFDGLYTVLKQKA* |
| Ga0126374_106180612 | 3300009792 | Tropical Forest Soil | DGKYTRNEAVGVDLAIRALAEATGDDHELLTQGMAIFDGLYTVLKQKA* |
| Ga0105087_10144693 | 3300009819 | Groundwater Sand | NESTGVDLAIRALAEATPDDDELLDRGMAIFDGLYTVLKRKT* |
| Ga0105074_10744621 | 3300010029 | Groundwater Sand | TRNEAIGIDLAVRALAQATPDDHELLERGMAIFDGLHSVLKQKT* |
| Ga0126380_104676903 | 3300010043 | Tropical Forest Soil | AVARALAEATADDHDLLARGMAIFDGLYTVLKQKS* |
| Ga0126382_117257412 | 3300010047 | Tropical Forest Soil | DGKFTRQESTGVDLAISALAASTADDHDLLERGISLFDGLHAVLKKRTAT* |
| Ga0126373_120917231 | 3300010048 | Tropical Forest Soil | KFTRQESTGVDLAISALAASNPDDHDLLERGIALFDGLHAVLKKKTTT* |
| Ga0134067_102072792 | 3300010321 | Grasslands Soil | DFAIRGLAASTQEDQELLERGMAIFDGLYTVLKRKT* |
| Ga0134084_102316031 | 3300010322 | Grasslands Soil | LDLAVKGLAESTQDDHELLEQGMAIFDGLYAVLKRKT* |
| Ga0126376_103716911 | 3300010359 | Tropical Forest Soil | RNEAAGLDLAINGLVEAVPDDHELLARGTALFEGLYAVLKQKT* |
| Ga0126376_114204231 | 3300010359 | Tropical Forest Soil | VDLAISALAASTRDDYDLLERGIALFDGLHAVLKKRTAT* |
| Ga0126372_109809851 | 3300010360 | Tropical Forest Soil | LAIKGLAATTQDDDELLKRGMALFDGLYSVLKQKS* |
| Ga0126378_116428021 | 3300010361 | Tropical Forest Soil | EAAGVDLAINALVEIVPDDDELLERGMAIFEGLYTVLKQKT* |
| Ga0126377_104810073 | 3300010362 | Tropical Forest Soil | DLAIKGLAAATLDDHDLLERGMALFDGLYSVLKQKT* |
| Ga0126377_108011891 | 3300010362 | Tropical Forest Soil | KFTRNEAAGLDLAINGLVEAIPEDHELLAHGGALFEGLYAVLKQKT* |
| Ga0126379_128049471 | 3300010366 | Tropical Forest Soil | DGKFTRNEATGVDLAINGLVEATLEDDELLERGMAIFEGMYAVLKRKA* |
| Ga0126383_125736051 | 3300010398 | Tropical Forest Soil | KFTRDESSGVDLAISALAASTPDDQELLERGMAIFDGLHAVLKKKT* |
| Ga0137391_105363953 | 3300011270 | Vadose Zone Soil | ATGVDLAINGLVEATPDDDDLLARGMAMFEGLYTILKQKT* |
| Ga0137389_106097733 | 3300012096 | Vadose Zone Soil | GVDLAIRGLAASTQEDQELLERGMAIFDGLYTVLKQKT* |
| Ga0137389_108262301 | 3300012096 | Vadose Zone Soil | VDLAINGLVEATPDDDDLLARGMAMFEGLYTILKQKT* |
| Ga0137388_105592641 | 3300012189 | Vadose Zone Soil | NEATGVDLAINSLVEVTPDDHELLERGMAIFNGLYTVLKQKT* |
| Ga0137364_103109023 | 3300012198 | Vadose Zone Soil | GVDFAIRGLAASTQEDQELLERGMAIFDGLYTVLKRKT* |
| Ga0137399_111512101 | 3300012203 | Vadose Zone Soil | LHDGKFTRNESTGVDLAIRALAEATPDDHDLLERGMAIFDGLHAVLKQKRT* |
| Ga0137374_104487942 | 3300012204 | Vadose Zone Soil | LHDGKFTRNESTGVDLAIKGLAGATQDDADLLERGMAIFDGFYTVWRQKT* |
| Ga0137381_110411251 | 3300012207 | Vadose Zone Soil | VDLAINGLVEATPDDDDLLARGMAIFDGLYTVLKQKT* |
| Ga0137370_101111591 | 3300012285 | Vadose Zone Soil | TGVDLAIKGLAAATQDDHDLLERGMAIFDGLYSVLKQKT* |
| Ga0137372_102134174 | 3300012350 | Vadose Zone Soil | AINGLAEATQDDRDLLERGMEIFDGLYTVLKRKT* |
| Ga0137372_105252431 | 3300012350 | Vadose Zone Soil | AIRGLAAGTEDDQELLERGMAMFDGLYTVLKQKT* |
| Ga0137360_106313181 | 3300012361 | Vadose Zone Soil | GLDLAISGLVASIEDDRELLERGMAMFEGLYTVLKRKT* |
| Ga0134058_12569472 | 3300012379 | Grasslands Soil | DLAIRGLAATLHDDDDLLERGMAVFDGLYEALKQKS* |
| Ga0137397_110300972 | 3300012685 | Vadose Zone Soil | EATGVDLAINGLVEATPEDHELLERGMAIFDGLYTVLKRKT* |
| Ga0164303_109235731 | 3300012957 | Soil | EATGIDLAIKGLAEATPDDQDLLERGMAMFDGLYTVLKRKT* |
| Ga0134077_100118751 | 3300012972 | Grasslands Soil | FTRNESTGVDLAIRALAEATPDDHDLLERGMAIFDGLHAVLKQKTT* |
| Ga0134076_100520151 | 3300012976 | Grasslands Soil | DLAINGLVEATPDDHELLERGMAIFNGLYTVLKQKT* |
| Ga0075354_11168882 | 3300014308 | Natural And Restored Wetlands | GIDLAIKGLAEATQDDQDLLDRGMAIFDGLYTVLKRKT* |
| Ga0134089_105798101 | 3300015358 | Grasslands Soil | RNEATGVDLAINSLVEATPDDHELLERGMAIFEGLYTVLKQKT* |
| Ga0132255_1023543862 | 3300015374 | Arabidopsis Rhizosphere | AINALVEATAEDHELLERGMALFEGLYAVLKRKT* |
| Ga0182035_121591901 | 3300016341 | Soil | ESTGVDLAVSALAASTPDDHDLLEKGIALFDGLHTVLKKRTAT |
| Ga0134069_11475682 | 3300017654 | Grasslands Soil | LAINGLVEATPDDHELLERGMAIFDGLYTVLEQKT |
| Ga0184632_1000260911 | 3300018075 | Groundwater Sediment | NEAIGIDLAVRALAQATPDDHELLERGMAIFDGLHSVLKQKT |
| Ga0066667_100883124 | 3300018433 | Grasslands Soil | AIRALAEATPDDHDLLERGMAIFDGLHVVLKQKRT |
| Ga0066667_103158941 | 3300018433 | Grasslands Soil | LAVKGLAESTQDDHELLERGMAIFDGLYTVLKQKT |
| Ga0066667_113031952 | 3300018433 | Grasslands Soil | ATGVDLAINGLVEATPDDDDLLARGMAIFDGLYTVLKQKT |
| Ga0066662_104166501 | 3300018468 | Grasslands Soil | ADLHDGTFTRQESTGADLAIKRLAAAAQDDHELLERGVAIFEGLRSVLKQKT |
| Ga0066662_119010512 | 3300018468 | Grasslands Soil | DLAIRGLAASTQDDHELLERGMAIFDGLYTVLKRKT |
| Ga0066662_126901452 | 3300018468 | Grasslands Soil | VDFAIRGLAASTQEDQELLERGMAIFDGLYTVLKRKT |
| Ga0066669_115691081 | 3300018482 | Grasslands Soil | NEATGLDLAINGLVEATPDDDELIERGMAIFEGLYTVLKQKT |
| Ga0066669_121882021 | 3300018482 | Grasslands Soil | TGVDLAINGLVEATPDDDDLLARGMAIFDGLYTVLKQKT |
| Ga0137408_11106214 | 3300019789 | Vadose Zone Soil | VDLAINGLVEATPDDDELLERGMAIFNGLYTVLKQKT |
| Ga0222623_102595432 | 3300022694 | Groundwater Sediment | HDGKFTRNEAIGIDLAVRALAQATPDDHELLERGMAIFDGLHAVLKQRT |
| Ga0137417_14747911 | 3300024330 | Vadose Zone Soil | VHTERVDGVDLAIRALAEATPDDHELLERGMAIFDGLHSVLKRRKT |
| Ga0207660_104463943 | 3300025917 | Corn Rhizosphere | STGVDLAIRALAEATPDDHDLLERGMAIFDGLHAVLKQKKA |
| Ga0209237_10450813 | 3300026297 | Grasslands Soil | VDLAIKGPGHRHAQDDHELLERGMAIFDGLRSVLKQKT |
| Ga0209155_11330883 | 3300026316 | Soil | ADLAIKGLAAAAQDDHELLERGMAIFEGLRSVLKQKT |
| Ga0209152_104701621 | 3300026325 | Soil | RNESTGVDLAIRALAEATPDDHDLLERGMAIFDGLHVVLKQKRT |
| Ga0209158_11219271 | 3300026333 | Soil | HSPGESTGVDLAIKGPGHRHAQDDHELLERGMAIFDGLRSVLKQKT |
| Ga0209158_12465451 | 3300026333 | Soil | DLAVNGLVEATPEDHELLERGMAIFEGLYTVLKQKA |
| Ga0209057_10496244 | 3300026342 | Soil | STGVDLAIRALAEATPDDHDLLERGMAIFDGLHVVLKQKRT |
| Ga0257169_10917091 | 3300026469 | Soil | DLAIKGLAEATHDDQDLLERGMLMFDGLYTVLKRKT |
| Ga0209160_13499831 | 3300026532 | Soil | TRNEATGVDLAINSLVEATPDDHELLERGMAIFEGLYTVLKQKT |
| Ga0209157_13781252 | 3300026537 | Soil | NEATGVDLAINSLVEATPDDHELLERGMAIFEGLYTVLKQKT |
| Ga0209056_104838772 | 3300026538 | Soil | RNESTGVDLAIRALAEATLDDQELLERGMAIFDGLHSVLKQKKT |
| Ga0209161_104144712 | 3300026548 | Soil | GVDLAINSLVEATPDDHELLERGMAIFEGLYTVLKQKT |
| Ga0209684_10676962 | 3300027527 | Tropical Forest Soil | AAGIDMAINALVVSTPDDHDLLSRGTALFEGLYTVLKQKT |
| Ga0209689_14170402 | 3300027748 | Soil | KFTRNEATGVDLAINSLVEVTPDDHELLERGMAIFEGLYTVLKQKT |
| Ga0209590_107477382 | 3300027882 | Vadose Zone Soil | VDLAIKGLAEATQDDQDLLERGMAIFDGLYTVLKRKT |
| Ga0209382_121490921 | 3300027909 | Populus Rhizosphere | DFAINGLVEATPDDDDLLARGMAIFEGLYTVLKQNT |
| Ga0307504_103067581 | 3300028792 | Soil | DLAIKGLAETTHDDHDLLERGMALFDGLYTVLKRKT |
| Ga0318538_106036321 | 3300031546 | Soil | DEAAGLDLAIRALAEATGDDHELLTQGMAIFDGLYTVLKQKA |
| Ga0318573_102725801 | 3300031564 | Soil | AEAIGVDLSIRALAEATADDHDLLTHGMAIFDGLYSVLKQKA |
| Ga0310813_118136732 | 3300031716 | Soil | RQEASGVDLALQAIAETTEDDHDLLERGMALFNGLFAVLKDKT |
| Ga0307468_1015561242 | 3300031740 | Hardwood Forest Soil | FTRNEATGVDLAIRALAEATPDDHELLERGMAIFDGLHSVLKQRKT |
| Ga0318552_100651521 | 3300031782 | Soil | THQESTGVDLAVSALAASTPDDHDLLEKGIALFDGLHTVLKKRTAT |
| Ga0307470_116057722 | 3300032174 | Hardwood Forest Soil | LTLRALAEATTDDHDLLTHGMAIFDGLYTVLKQKA |
| Ga0307471_1007237163 | 3300032180 | Hardwood Forest Soil | TGVDLAIRALAEATPDDHDLLERGMAIFDGLHTVLKQKKAR |
| Ga0307471_1024517011 | 3300032180 | Hardwood Forest Soil | TGVDLAIRALAEATPDDHELLERGMAIFDGLHSVLKQRKT |
| Ga0307471_1038262511 | 3300032180 | Hardwood Forest Soil | AAGLDLAIKGLAEATPDDHELLERGGSMFDGIYEVLKRDA |
| Ga0307471_1041389021 | 3300032180 | Hardwood Forest Soil | TRNEAAGLDLAINGLVEATPDDDELLARGMGIFEGLYAVLKQKT |
| ⦗Top⦘ |