| Basic Information | |
|---|---|
| Family ID | F086908 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MVTVCTVLPPPERPRLDAAGDGCFTTLHTSSFRDALRAAR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 81.82 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.091 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 11.76% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF04389 | Peptidase_M28 | 30.00 |
| PF00069 | Pkinase | 15.45 |
| PF01661 | Macro | 10.91 |
| PF05960 | DUF885 | 6.36 |
| PF00106 | adh_short | 0.91 |
| PF01902 | Diphthami_syn_2 | 0.91 |
| PF12802 | MarR_2 | 0.91 |
| PF12706 | Lactamase_B_2 | 0.91 |
| PF12833 | HTH_18 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 61.82 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 10.91 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 6.36 |
| COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.18 % |
| Unclassified | root | N/A | 1.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10047822 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300002886|JGI25612J43240_1084345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300002908|JGI25382J43887_10192430 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005166|Ga0066674_10074102 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300005181|Ga0066678_10446716 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005184|Ga0066671_10861974 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005186|Ga0066676_10056285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2256 | Open in IMG/M |
| 3300005341|Ga0070691_10481027 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 714 | Open in IMG/M |
| 3300005447|Ga0066689_10935676 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 535 | Open in IMG/M |
| 3300005468|Ga0070707_101487022 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 644 | Open in IMG/M |
| 3300005536|Ga0070697_101858795 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005554|Ga0066661_10244279 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300005555|Ga0066692_10000272 | All Organisms → cellular organisms → Bacteria | 16175 | Open in IMG/M |
| 3300005556|Ga0066707_10025936 | All Organisms → cellular organisms → Bacteria | 3181 | Open in IMG/M |
| 3300005556|Ga0066707_10915855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300005560|Ga0066670_10614965 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005561|Ga0066699_10414998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 963 | Open in IMG/M |
| 3300005561|Ga0066699_10878857 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005566|Ga0066693_10411721 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005566|Ga0066693_10465713 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 519 | Open in IMG/M |
| 3300005569|Ga0066705_10581169 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005574|Ga0066694_10183000 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300005574|Ga0066694_10516502 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005883|Ga0075299_1022613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 633 | Open in IMG/M |
| 3300006032|Ga0066696_10041887 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2522 | Open in IMG/M |
| 3300006796|Ga0066665_10033322 | All Organisms → cellular organisms → Bacteria | 3405 | Open in IMG/M |
| 3300006797|Ga0066659_11345590 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006797|Ga0066659_11794609 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300006806|Ga0079220_12103834 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006853|Ga0075420_101920469 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006914|Ga0075436_100100004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2019 | Open in IMG/M |
| 3300006954|Ga0079219_11070599 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300007255|Ga0099791_10140416 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1126 | Open in IMG/M |
| 3300007265|Ga0099794_10028849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2582 | Open in IMG/M |
| 3300009012|Ga0066710_102966511 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 662 | Open in IMG/M |
| 3300009012|Ga0066710_103794111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300009089|Ga0099828_10171952 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1924 | Open in IMG/M |
| 3300009089|Ga0099828_11728235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
| 3300009090|Ga0099827_10618597 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 934 | Open in IMG/M |
| 3300009162|Ga0075423_10914181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 931 | Open in IMG/M |
| 3300010320|Ga0134109_10073793 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1160 | Open in IMG/M |
| 3300010321|Ga0134067_10136177 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 867 | Open in IMG/M |
| 3300010322|Ga0134084_10248628 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 641 | Open in IMG/M |
| 3300010322|Ga0134084_10337539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
| 3300010323|Ga0134086_10163855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 817 | Open in IMG/M |
| 3300010333|Ga0134080_10033391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1970 | Open in IMG/M |
| 3300010335|Ga0134063_10024615 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2519 | Open in IMG/M |
| 3300010399|Ga0134127_12906554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 558 | Open in IMG/M |
| 3300011271|Ga0137393_10047176 | All Organisms → cellular organisms → Bacteria | 3355 | Open in IMG/M |
| 3300012201|Ga0137365_11137661 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012202|Ga0137363_10773189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 814 | Open in IMG/M |
| 3300012208|Ga0137376_10131384 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2144 | Open in IMG/M |
| 3300012349|Ga0137387_11081486 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
| 3300012354|Ga0137366_10059242 | All Organisms → cellular organisms → Bacteria | 2925 | Open in IMG/M |
| 3300012357|Ga0137384_10133194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2081 | Open in IMG/M |
| 3300012357|Ga0137384_10214106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1612 | Open in IMG/M |
| 3300012360|Ga0137375_10105989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2849 | Open in IMG/M |
| 3300012532|Ga0137373_10022870 | All Organisms → cellular organisms → Bacteria | 6217 | Open in IMG/M |
| 3300012917|Ga0137395_11220534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 525 | Open in IMG/M |
| 3300012927|Ga0137416_10300310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1331 | Open in IMG/M |
| 3300012930|Ga0137407_11006694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 789 | Open in IMG/M |
| 3300012972|Ga0134077_10057676 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1444 | Open in IMG/M |
| 3300012972|Ga0134077_10078484 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1255 | Open in IMG/M |
| 3300014154|Ga0134075_10434214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
| 3300014157|Ga0134078_10384942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 625 | Open in IMG/M |
| 3300015358|Ga0134089_10466998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300017654|Ga0134069_1245917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 621 | Open in IMG/M |
| 3300017659|Ga0134083_10151740 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 938 | Open in IMG/M |
| 3300017961|Ga0187778_10458656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 842 | Open in IMG/M |
| 3300017997|Ga0184610_1019131 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300018054|Ga0184621_10037187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1582 | Open in IMG/M |
| 3300018082|Ga0184639_10484946 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 627 | Open in IMG/M |
| 3300018084|Ga0184629_10122531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1295 | Open in IMG/M |
| 3300018433|Ga0066667_10529026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 975 | Open in IMG/M |
| 3300018433|Ga0066667_12137374 | Not Available | 519 | Open in IMG/M |
| 3300018468|Ga0066662_10656993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 992 | Open in IMG/M |
| 3300018482|Ga0066669_10063504 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300018482|Ga0066669_10154707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1693 | Open in IMG/M |
| 3300020003|Ga0193739_1078354 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 841 | Open in IMG/M |
| 3300020170|Ga0179594_10265333 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 648 | Open in IMG/M |
| 3300020199|Ga0179592_10527228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 504 | Open in IMG/M |
| 3300024219|Ga0247665_1027275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 734 | Open in IMG/M |
| 3300024330|Ga0137417_1034248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2367 | Open in IMG/M |
| 3300024330|Ga0137417_1119990 | Not Available | 1064 | Open in IMG/M |
| 3300024330|Ga0137417_1136201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 774 | Open in IMG/M |
| 3300025327|Ga0209751_10500928 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_70_11 | 992 | Open in IMG/M |
| 3300025796|Ga0210113_1063217 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300025905|Ga0207685_10802706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
| 3300025917|Ga0207660_11711774 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026296|Ga0209235_1259624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 534 | Open in IMG/M |
| 3300026300|Ga0209027_1046279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1635 | Open in IMG/M |
| 3300026305|Ga0209688_1075001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
| 3300026325|Ga0209152_10007713 | All Organisms → cellular organisms → Bacteria | 3817 | Open in IMG/M |
| 3300026326|Ga0209801_1116558 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1147 | Open in IMG/M |
| 3300026329|Ga0209375_1097161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1331 | Open in IMG/M |
| 3300026342|Ga0209057_1052868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1898 | Open in IMG/M |
| 3300026527|Ga0209059_1048374 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1876 | Open in IMG/M |
| 3300026552|Ga0209577_10402413 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300027169|Ga0209897_1018031 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300027384|Ga0209854_1101229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300027655|Ga0209388_1092278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 870 | Open in IMG/M |
| 3300027775|Ga0209177_10254407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 650 | Open in IMG/M |
| 3300027787|Ga0209074_10003950 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300027846|Ga0209180_10048792 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2331 | Open in IMG/M |
| 3300027873|Ga0209814_10049663 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1751 | Open in IMG/M |
| 3300027875|Ga0209283_10974607 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
| 3300031720|Ga0307469_10934288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 806 | Open in IMG/M |
| 3300031753|Ga0307477_10717015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 668 | Open in IMG/M |
| 3300032954|Ga0335083_10161852 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300034176|Ga0364931_0257862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.82% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.91% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100478221 | 3300002558 | Grasslands Soil | MVTVCTVLPPTERPRVDAVGDGCFATLHADSFRDVLRAARTRRVDALVISVH |
| JGI25612J43240_10843451 | 3300002886 | Grasslands Soil | MVTVCTVLPAPERPRFDAAGHGCFDTLHADSLREALYVVRRRRVDAVV |
| JGI25382J43887_101924301 | 3300002908 | Grasslands Soil | MVTVCTVLPPTERPRVDAVGDGCFATLHADSFRDVLRAARTRRVDALVISV |
| Ga0066674_100741024 | 3300005166 | Soil | MVTVCTVLAPPERPRVDAAGDGYFTALHVDSFRDVLHTARKRR |
| Ga0066678_104467162 | 3300005181 | Soil | MVTVCTVLPAPERPRLDAAGDGCFTTVHTGSFRDALRAARRKRVDALV |
| Ga0066671_108619741 | 3300005184 | Soil | MVTVCTVLPAAERPRIDAAGDGCFHTLHTESLREALHVAR |
| Ga0066676_100562853 | 3300005186 | Soil | MVTVCTVLPPTERPRVDAAGDGCFTTLHTNSLRDALHAAR |
| Ga0070691_104810271 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTVCTVLPAPERPRIDAAGDGCFHTLHAESLREALHVARR |
| Ga0066689_109356762 | 3300005447 | Soil | MGRMVTVCTILPPPERPRIDAVGDGCFDTLHADSLREVLYVARRRRVDAVI |
| Ga0070707_1014870221 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTVCTVLPREERPRIDAAGDGCFTTLHAESLGEARLAARCGRVDAM |
| Ga0070697_1018587952 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTVCTVLPPPERPRIDAVGDGCFDTLHADSLREALYVARR |
| Ga0066661_102442791 | 3300005554 | Soil | MVTVCTVLPPPERPRLDAAADGCFTTLHAASLREALRAARRKRVDALVLSVHAC |
| Ga0066692_1000027215 | 3300005555 | Soil | MVTVCTVLPPPERPRLDAAGDGCFTTLHTSSFRDALR |
| Ga0066707_100259361 | 3300005556 | Soil | MVTVCTFLPPPERPRVDAAGDGCFTTLHANSLRDALHAARR |
| Ga0066707_109158551 | 3300005556 | Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSVH |
| Ga0066670_106149652 | 3300005560 | Soil | MVTVCTVLPPPERPRLDAAGDGCFTTLHTGSFRDALRAAR |
| Ga0066699_104149982 | 3300005561 | Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHTSSFRDAL |
| Ga0066699_108788571 | 3300005561 | Soil | MVTVCTVLPPPERPRVDAAADGCFATLHAASLRDALRAARRKRVDALVLSVHACRGEEL |
| Ga0066693_104117211 | 3300005566 | Soil | MVTVCTVLPLPERPRVDAAADGCFTTLHAASLRDALRAARRKRVDAL |
| Ga0066693_104657131 | 3300005566 | Soil | MVTVCTVLPPTERPRVDAAGDGCFTTLHANSLRDA |
| Ga0066705_105811691 | 3300005569 | Soil | MVTVCTVLPPTERPRVDAAGDGCFTTLHTNSLRDALHAARRKR |
| Ga0066694_101830003 | 3300005574 | Soil | VQRYRLRYMVTVCTVLPPTERPRVDAAGDGCFTTLHANSLRD |
| Ga0066694_105165021 | 3300005574 | Soil | MVTVCTVLPAPERPRLDAAGDGCFTTLHTTSFRDALRAARRKRVDALVL |
| Ga0075299_10226132 | 3300005883 | Rice Paddy Soil | MVTVCTVIPAPERPRLDAVGDGCFDTLHAESLREALYV |
| Ga0066696_100418871 | 3300006032 | Soil | MVTVCTVLPPPERPRLDAAADGCFATFHAASLRDALRAAR |
| Ga0066665_100333221 | 3300006796 | Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHTSSFRDALRAARRRRVDALVLSVHAC |
| Ga0066659_113455901 | 3300006797 | Soil | MMRMVTVCTVLPPPERPRIDAAGDGCFDTLHADSLR |
| Ga0066659_117946092 | 3300006797 | Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSV |
| Ga0079220_121038341 | 3300006806 | Agricultural Soil | MVTVCTVLPAPERPRLDAAGDGCFTTVHISSFRAALRAARRKRVDALVL |
| Ga0075420_1019204692 | 3300006853 | Populus Rhizosphere | MVTVCTVLPPPERPRVDAAGDGCFTTYHVDSLRDVLNA |
| Ga0075436_1001000044 | 3300006914 | Populus Rhizosphere | MVTVCTVLPAPERPRLDAAGDGCFTTVHTSSFRDALRA |
| Ga0079219_110705992 | 3300006954 | Agricultural Soil | MVTVCTVLPVPERPRLDAAADGCFATLHAASLRDALRAARRKRVDALVLSV |
| Ga0099791_101404162 | 3300007255 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSVHVCRSDELPAV |
| Ga0099794_100288491 | 3300007265 | Vadose Zone Soil | MVTVCTVLPPPEPPRLDAVGDGCFTTLHATSFRDALRAARRKRVDALVLSV |
| Ga0066710_1029665111 | 3300009012 | Grasslands Soil | MVTVCTVLPPPERPRIDAAGDGCFTTLHTNSFRDALRA |
| Ga0066710_1037941111 | 3300009012 | Grasslands Soil | MVTVCTVLPAPERPRLDAAGDGCFTTLHTGSFRDALRAARRKKVDA |
| Ga0099828_101719521 | 3300009089 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSVHACRSDELPAVA |
| Ga0099828_117282352 | 3300009089 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSVHACRSDELP |
| Ga0099827_106185972 | 3300009090 | Vadose Zone Soil | MGARYRFSRMVTVCTVLPPPERPRLDAVGDGCFTTLHASSFR |
| Ga0075423_109141813 | 3300009162 | Populus Rhizosphere | MVTVCTVLPAPERPRIDAVGDGCFDTFHAESLREALHVART |
| Ga0134109_100737933 | 3300010320 | Grasslands Soil | MVTVCTVLPPPERPRIDAVGDGCFDTLHAESLREALYVARRWRVDAVIISVHR |
| Ga0134067_101361773 | 3300010321 | Grasslands Soil | MVTVCTVLPLPERPRVDAAADGCFTTLHAASLRDALRAARRKRVDALVLSVHACRG |
| Ga0134084_102486282 | 3300010322 | Grasslands Soil | VQRYRLRCMVTVCTVLPPTERPRVDAAGDGCFTTL |
| Ga0134084_103375391 | 3300010322 | Grasslands Soil | MVTVCTVLPAPERPRIDAAGHGCFDTLHADSLREALYV |
| Ga0134086_101638551 | 3300010323 | Grasslands Soil | MVTVCTVLPPTERPRVDAAGDGCFTTLHANSLRDALH |
| Ga0134080_100333913 | 3300010333 | Grasslands Soil | MVTVCTVLPAPERPRIDAAGDGCFHTLHTDSLREALH |
| Ga0134063_100246155 | 3300010335 | Grasslands Soil | MVTVCTVLPLPERPRLDAAADGCFTTLHAASLRDALRAARRKRVDALVLSV |
| Ga0134127_129065541 | 3300010399 | Terrestrial Soil | MVTVCTVLPAPERPRIDAVGDGCFDTLHAESLREVLQVARTRRVDA |
| Ga0137393_100471761 | 3300011271 | Vadose Zone Soil | MVTVCTLLPQPERSRVDAAGDGCFATLHADSPRELLRTAR |
| Ga0137365_111376611 | 3300012201 | Vadose Zone Soil | MVTVCTVLPPPERPRIDAAGDGCFDTLHTESLREALHLART |
| Ga0137363_107731892 | 3300012202 | Vadose Zone Soil | MVTVCTVVPPPERPRLDAVGDGCFTTLHASSFRDA |
| Ga0137376_101313844 | 3300012208 | Vadose Zone Soil | MVTVCTVLPPPERPRFDAVGDGCFTTLHTSSFRDALRAARRKRVD |
| Ga0137387_110814862 | 3300012349 | Vadose Zone Soil | MVTVCTVLPAPERPRIDAAGQGCFDTLHADSLREALY |
| Ga0137366_100592425 | 3300012354 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAAGDGCFTTLHTSSFRDALRAARRMRV |
| Ga0137384_101331944 | 3300012357 | Vadose Zone Soil | MAQLPWWRMVTVCTVLPAPERPRIDAAGQGCFDTLHADSLRE |
| Ga0137384_102141061 | 3300012357 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAAGDGCFTTLHTSSFRDALRA |
| Ga0137375_101059891 | 3300012360 | Vadose Zone Soil | MVTVCTVLPPPERPRIDAAGDGCFDTLHADSLHEA |
| Ga0137373_100228707 | 3300012532 | Vadose Zone Soil | MVTVCAVLPPPERPRLDAAGDGCFTTLHATSFRDALRAARRKRVDAL |
| Ga0137395_112205341 | 3300012917 | Vadose Zone Soil | MVTVCTVLPPPERPRVDAAGDGSFTALHVDSFRDVLHAA |
| Ga0137416_103003101 | 3300012927 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDAL |
| Ga0137407_110066941 | 3300012930 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHTSSFRDALRAARRKRV |
| Ga0134077_100576761 | 3300012972 | Grasslands Soil | MVTVCTVLPPPERPRIDAAGDGYFDTLHADSLREALYVARRRRVDAMVIS |
| Ga0134077_100784841 | 3300012972 | Grasslands Soil | MVTVCTVLPPPERPRLDAAGDGCFTTLHTSSFRDALRAARRKRV |
| Ga0134075_104342142 | 3300014154 | Grasslands Soil | MVTVCTVLSPPERPRIDAAGDGCFTTLHASSFRDALRAARR |
| Ga0134078_103849421 | 3300014157 | Grasslands Soil | MVTVCTVLPPPERPRLDAAADGCFATFHAASLRDALRAARRKRVDALVL |
| Ga0134089_104669981 | 3300015358 | Grasslands Soil | MVTVCTVLPPPERPRIDEAGDGYFDTLHADSLREALYVAR |
| Ga0134069_12459172 | 3300017654 | Grasslands Soil | MVTVCTVLPPPERPRLDAAGDGCFTTLHTSSFRDAL |
| Ga0134083_101517401 | 3300017659 | Grasslands Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHTSSFRDALRAARRKRVDAL |
| Ga0187778_104586561 | 3300017961 | Tropical Peatland | MGGAYSRHRMVTVCTVLPVPERPRVDAAGDGCFSTLHADSFRDVLSAAR |
| Ga0184610_10191312 | 3300017997 | Groundwater Sediment | MVTVCTVLPPPERPRIDAAGDGCFDTLHADSLREALY |
| Ga0184621_100371871 | 3300018054 | Groundwater Sediment | MVTVCTVLPPPERPRIDAAGDGCFDTLHAESLREALYVA |
| Ga0184639_104849463 | 3300018082 | Groundwater Sediment | MVTICTVVPPPERLRVDAAGDGCFATVHAESFRDAL |
| Ga0184629_101225313 | 3300018084 | Groundwater Sediment | VTVCTLLPPAERHRIDAVGDGCFVSLHTDSGRELLTAARRRRVDAVVL |
| Ga0066667_105290261 | 3300018433 | Grasslands Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHTSSFRDALRAARRKRVDALV |
| Ga0066667_121373742 | 3300018433 | Grasslands Soil | VSPAPPPPAGARRDAAADGCFTTLHAASLRDALRAARRKRVDALVLSV |
| Ga0066662_106569933 | 3300018468 | Grasslands Soil | MVTVCTVLPPTERPRVDAVGDGCFATLHADSFRDVLRAARTRRVDA |
| Ga0066669_100635045 | 3300018482 | Grasslands Soil | MVTVCTFLPPPERPRVDAAGDGCFTTPHANSLRDALHAARRNRVD |
| Ga0066669_101547074 | 3300018482 | Grasslands Soil | MVTMCTVLPPPECPRVDAAGDGSFTALHVDSFRDVLHAARRR |
| Ga0193739_10783541 | 3300020003 | Soil | MVTICTVVPPPERLRVDAAGDGCFATVHAESFRDALDAARR |
| Ga0179594_102653331 | 3300020170 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALV |
| Ga0179592_105272282 | 3300020199 | Vadose Zone Soil | MVTVCTVLPPPERPRIDAAGDGCFDTLHAESLREVL |
| Ga0247665_10272751 | 3300024219 | Soil | MVTVCTVLPPIERPRLDAVGDGCFLTLHATSFRDAMRAARRRRVDALVLSVHACRGEE |
| Ga0137417_10342484 | 3300024330 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSVHACRSDELPAVARF |
| Ga0137417_11199901 | 3300024330 | Vadose Zone Soil | MVTVCTVLPPTERPRLDAAGDGCFTAGDGCFTTLHAN |
| Ga0137417_11362012 | 3300024330 | Vadose Zone Soil | MVTVCTVLPPPERPRIDAVGDGCFETLHADSLREALHVARRRRVDVVSISDH |
| Ga0209751_105009282 | 3300025327 | Soil | MVTVCTVLPAPERPRIDAVGDGCFDTLHAESLREALHVARTRRVD |
| Ga0210113_10632172 | 3300025796 | Natural And Restored Wetlands | MVTVCTVLPREERPRVDAAGDGCFIAVHADSLGEARLAARRG |
| Ga0207685_108027062 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSVHACRGDELPAVA |
| Ga0207660_117117741 | 3300025917 | Corn Rhizosphere | MVTVCTVLPRDERPRVDAAGDGCFTTLHAESLGEARLAAR |
| Ga0209235_12596241 | 3300026296 | Grasslands Soil | MVTVCTVLPPPERPRIDAAGDGCFDTLHVGHIRYLEGA |
| Ga0209027_10462794 | 3300026300 | Grasslands Soil | MVTVCTVLPLPERPRLDAAADGCFTTLHAASLRDAL |
| Ga0209688_10750011 | 3300026305 | Soil | MVTVCTVIPAPERPRLDAVGDGCFNTLHADSLREALYVAR |
| Ga0209152_100077131 | 3300026325 | Soil | MVTVCTVLPPPERPRLDAAGDGCFTTLHTSSFRDALRAAR |
| Ga0209801_11165582 | 3300026326 | Soil | MVTICTVLPAPDRPRVDAAGDGCFTTLHAGSFRDAVHAA |
| Ga0209375_10971611 | 3300026329 | Soil | MVTVCTVLPAPERPRIDAAGHGCFDTLHADSLREA |
| Ga0209057_10528684 | 3300026342 | Soil | MVTVCTVLPPPERPRLDAAGDGCFTTVHTSSFRDALRAARRKR |
| Ga0209059_10483744 | 3300026527 | Soil | MVTVCTVLPPTERPRLDAAGDGCFTTLHANSLRDALHAARR |
| Ga0209577_104024132 | 3300026552 | Soil | MVTVCTVLPATERPRIDAAGDGCFHTLHTESLREALHVAR |
| Ga0209897_10180311 | 3300027169 | Groundwater Sand | MVTVCTVLARDERPRIDAAGDGCFTTLHADSLSEARLAARCGRVDAM |
| Ga0209854_11012291 | 3300027384 | Groundwater Sand | MVTICTVLPAPERPRVDAAGDGCFTTLHASSFRDALYTARRKKVDAL |
| Ga0209388_10922781 | 3300027655 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSVHVCRSDELPAVARF |
| Ga0209177_102544072 | 3300027775 | Agricultural Soil | MVTVCTVLPPIERPRLDAVGDGCFLTLHATSFRDAMRAARRRRVDALVLSVHACRGEELP |
| Ga0209074_100039506 | 3300027787 | Agricultural Soil | MVTVCTVLPPPERPRLDAAGDGCFITLHTGSLRDALRTA |
| Ga0209180_100487921 | 3300027846 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHANSFRDALRAARRKRVDALVLSVHACRGDEL |
| Ga0209814_100496634 | 3300027873 | Populus Rhizosphere | MVTVCTVLPAPERPRLDAAGDGCFTTVHTSSFRDALRAARRK |
| Ga0209283_109746072 | 3300027875 | Vadose Zone Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVD |
| Ga0307469_109342881 | 3300031720 | Hardwood Forest Soil | MVTVCTVLPPPERPRLDAVGDGCFTTLHASSFRDALRAARRKRVDALVLSVHACRGDELP |
| Ga0307477_107170153 | 3300031753 | Hardwood Forest Soil | MVTVCTFVPSPERPRLDAAGEGCFTALHVDSLRDALATARRRH |
| Ga0335083_101618522 | 3300032954 | Soil | VVTVCTVLPVPERSRVDAVGDGCFQTVHAESFREVL |
| Ga0364931_0257862_433_573 | 3300034176 | Sediment | MITVCTVLPAPERPRIDAVGDGCFDTLHAESLRETLQVARAGRMDAV |
| ⦗Top⦘ |