| Basic Information | |
|---|---|
| Family ID | F086882 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 90.91 % |
| % of genes from short scaffolds (< 2000 bps) | 77.27 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.727 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (39.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (68.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01797 | Y1_Tnp | 25.45 |
| PF00854 | PTR2 | 21.82 |
| PF07676 | PD40 | 14.55 |
| PF06800 | Sugar_transport | 0.91 |
| PF01370 | Epimerase | 0.91 |
| PF09723 | Zn-ribbon_8 | 0.91 |
| PF12706 | Lactamase_B_2 | 0.91 |
| PF00069 | Pkinase | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 25.45 |
| COG3104 | Dipeptide/tripeptide permease | Amino acid transport and metabolism [E] | 21.82 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.64 |
| COG4975 | Glucose uptake protein GlcU | Carbohydrate transport and metabolism [G] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.73 % |
| Unclassified | root | N/A | 7.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10024833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2132 | Open in IMG/M |
| 3300002560|JGI25383J37093_10007531 | All Organisms → cellular organisms → Bacteria | 3514 | Open in IMG/M |
| 3300002908|JGI25382J43887_10045311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2392 | Open in IMG/M |
| 3300002911|JGI25390J43892_10023164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1496 | Open in IMG/M |
| 3300002911|JGI25390J43892_10039159 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300005186|Ga0066676_10521196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 807 | Open in IMG/M |
| 3300005186|Ga0066676_11030899 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005187|Ga0066675_10078776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2119 | Open in IMG/M |
| 3300005187|Ga0066675_11356947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
| 3300005437|Ga0070710_11072933 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005444|Ga0070694_100373375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1110 | Open in IMG/M |
| 3300005445|Ga0070708_100113332 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300005446|Ga0066686_10807197 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005446|Ga0066686_11013195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 538 | Open in IMG/M |
| 3300005468|Ga0070707_100045738 | All Organisms → cellular organisms → Bacteria | 4188 | Open in IMG/M |
| 3300005518|Ga0070699_101245293 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005536|Ga0070697_101198147 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005540|Ga0066697_10474952 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005556|Ga0066707_10285242 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300005556|Ga0066707_10463299 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300005557|Ga0066704_10347123 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005559|Ga0066700_10425686 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 934 | Open in IMG/M |
| 3300005569|Ga0066705_10066289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2070 | Open in IMG/M |
| 3300005574|Ga0066694_10464349 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005575|Ga0066702_10151077 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1374 | Open in IMG/M |
| 3300006796|Ga0066665_10971624 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006797|Ga0066659_10292106 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300006797|Ga0066659_11136292 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 653 | Open in IMG/M |
| 3300006800|Ga0066660_10975741 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006804|Ga0079221_10698808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 706 | Open in IMG/M |
| 3300006804|Ga0079221_11404561 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006806|Ga0079220_10772445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 721 | Open in IMG/M |
| 3300006871|Ga0075434_101761606 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006903|Ga0075426_10418153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 990 | Open in IMG/M |
| 3300009090|Ga0099827_10139575 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1973 | Open in IMG/M |
| 3300009090|Ga0099827_10252761 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300009137|Ga0066709_104683997 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010301|Ga0134070_10149188 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 838 | Open in IMG/M |
| 3300010304|Ga0134088_10553450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
| 3300010326|Ga0134065_10171178 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300010335|Ga0134063_10030417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2289 | Open in IMG/M |
| 3300010335|Ga0134063_10445346 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 641 | Open in IMG/M |
| 3300010364|Ga0134066_10214518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
| 3300010400|Ga0134122_10281978 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300011269|Ga0137392_10293912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1342 | Open in IMG/M |
| 3300012189|Ga0137388_10633767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 993 | Open in IMG/M |
| 3300012199|Ga0137383_10125425 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1874 | Open in IMG/M |
| 3300012200|Ga0137382_10080271 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300012200|Ga0137382_10478305 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012207|Ga0137381_11361777 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 602 | Open in IMG/M |
| 3300012209|Ga0137379_11831013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300012211|Ga0137377_10254489 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300012211|Ga0137377_10300303 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300012211|Ga0137377_10642334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 997 | Open in IMG/M |
| 3300012351|Ga0137386_10500183 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300012351|Ga0137386_11106109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
| 3300012359|Ga0137385_10215874 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1671 | Open in IMG/M |
| 3300012927|Ga0137416_10160000 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300012927|Ga0137416_10343330 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300012927|Ga0137416_11076375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 720 | Open in IMG/M |
| 3300012929|Ga0137404_11648931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 595 | Open in IMG/M |
| 3300012929|Ga0137404_11829157 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012972|Ga0134077_10245654 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300012975|Ga0134110_10008819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3798 | Open in IMG/M |
| 3300012976|Ga0134076_10133273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1007 | Open in IMG/M |
| 3300012976|Ga0134076_10568054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300015264|Ga0137403_10834332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 775 | Open in IMG/M |
| 3300017656|Ga0134112_10426242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300017659|Ga0134083_10015052 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
| 3300018431|Ga0066655_10822599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 632 | Open in IMG/M |
| 3300018433|Ga0066667_11124611 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300018468|Ga0066662_10470413 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300018482|Ga0066669_10705398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 889 | Open in IMG/M |
| 3300025906|Ga0207699_10565324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 826 | Open in IMG/M |
| 3300026277|Ga0209350_1002014 | All Organisms → cellular organisms → Bacteria | 8218 | Open in IMG/M |
| 3300026295|Ga0209234_1125835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 938 | Open in IMG/M |
| 3300026297|Ga0209237_1115353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1144 | Open in IMG/M |
| 3300026298|Ga0209236_1077435 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300026306|Ga0209468_1058755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1296 | Open in IMG/M |
| 3300026308|Ga0209265_1006071 | All Organisms → cellular organisms → Bacteria | 3747 | Open in IMG/M |
| 3300026322|Ga0209687_1213205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 595 | Open in IMG/M |
| 3300026323|Ga0209472_1058891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1620 | Open in IMG/M |
| 3300026325|Ga0209152_10076565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300026326|Ga0209801_1231796 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 716 | Open in IMG/M |
| 3300026328|Ga0209802_1060886 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300026329|Ga0209375_1289157 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300026330|Ga0209473_1063236 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300026331|Ga0209267_1011533 | All Organisms → cellular organisms → Bacteria | 4769 | Open in IMG/M |
| 3300026332|Ga0209803_1118455 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300026334|Ga0209377_1122595 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300026335|Ga0209804_1014500 | All Organisms → cellular organisms → Bacteria | 4196 | Open in IMG/M |
| 3300026342|Ga0209057_1154665 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300026507|Ga0257165_1072582 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300026524|Ga0209690_1245291 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026528|Ga0209378_1037919 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300026528|Ga0209378_1171111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 810 | Open in IMG/M |
| 3300026540|Ga0209376_1011823 | All Organisms → cellular organisms → Bacteria | 6367 | Open in IMG/M |
| 3300026540|Ga0209376_1133093 | Not Available | 1216 | Open in IMG/M |
| 3300026548|Ga0209161_10063753 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2344 | Open in IMG/M |
| 3300027882|Ga0209590_10074187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1967 | Open in IMG/M |
| 3300028536|Ga0137415_10853982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 720 | Open in IMG/M |
| 3300031720|Ga0307469_10398559 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300032180|Ga0307471_102355264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 672 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 39.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.82% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100248333 | 3300002558 | Grasslands Soil | VGGATATIVGFGMVARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWRTTRFN* |
| JGI25383J37093_100075317 | 3300002560 | Grasslands Soil | ATFIGFGIVARVPQLTLHWGWVAGLAAAMLALLLGTGWLLWRTTRFN* |
| JGI25382J43887_100453111 | 3300002908 | Grasslands Soil | ATIVGFGIVARVPQLTLGWGWVAGLTAAMLALLSGTGWLLWRTTRFN* |
| JGI25390J43892_100231641 | 3300002911 | Grasslands Soil | SATAVFVALGLVARVPDLRLGWAWVAGLTLAMLALLGGTGILLWRTTRFN* |
| JGI25390J43892_100391591 | 3300002911 | Grasslands Soil | VFVGLGLVARVPALPLGWGWVAGLSAAMLASLGGTGALLWRTTRFN* |
| Ga0066676_105211961 | 3300005186 | Soil | LVGGATAIFIGFGMVARLPQLTLGWGWVAGLTLAMMALLSGTGWLLWRTTRFN* |
| Ga0066676_110308991 | 3300005186 | Soil | TATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLSGTGWLLWRTTRFN* |
| Ga0066675_100787762 | 3300005187 | Soil | VFVGLGLVARVPDLRLGWGWVAGLAVAMLALLGGTGVLLWRTTRFN* |
| Ga0066675_113569471 | 3300005187 | Soil | GGATATFVGFGMVARVPQLTIGWGWVVGLTATMLALLSGTGWWLWRTTRFN* |
| Ga0070710_110729332 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IVARVPQLTLHWGWVAGLTAAMLALLFGTGWLLWRTTRFN* |
| Ga0070694_1003733751 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AVFVGFGMVARVPQLTLHWGWVAGLTAAMLALLLGTGWLLWRTTRFN* |
| Ga0070708_1001133321 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GFGMVARVPQLTLHWGWVAGLTAAMLALLLGTGWLLWRTTRFN* |
| Ga0066686_108071971 | 3300005446 | Soil | FVGFGIVARVPQLTLGWGWVAGLGAAMLALLSGTGWLLWRTTRFN* |
| Ga0066686_110131951 | 3300005446 | Soil | VGFGIVARVPQLALGWGWVAGLTAAMLALLSGTGWLLWRTTRFN* |
| Ga0070707_1000457381 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LVTGATAVFVGLGLVARVPDLRLGWSWVAGLTVAMLALLGGTGVLLWRTTRFN* |
| Ga0070699_1012452932 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVGLGLVARVPDLRLGWGWVAGLTIAMLALLGGTGVLLWRTTRFN* |
| Ga0070697_1011981471 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVGFGVIARVPSLSIQWGWAVGLTALMAALLLGAGLLLWRTTRLN* |
| Ga0066697_104749522 | 3300005540 | Soil | AVFVALARGARVPDLALDWPAITALAVVMLALLGGTGLLLWRTTRFN* |
| Ga0066695_103572902 | 3300005553 | Soil | WLDWILVGGATATIVGFGIVARVPQLALGWGWVAGLTAAMLALLSGTGWLLWRTTRFN* |
| Ga0066707_102852423 | 3300005556 | Soil | GFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0066707_104632991 | 3300005556 | Soil | GGATATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0066704_103471231 | 3300005557 | Soil | TIVGFGMVARVPQLTLGWGWVVGLTAAMLALLFGTGWLLWRTTRFN* |
| Ga0066700_104256863 | 3300005559 | Soil | GGATATIVGFGMVARVPQLTLGWGWVVGLTAAMLALLFGTGWLLWRTTRFN* |
| Ga0066705_100662891 | 3300005569 | Soil | VPDLRLGWAWVAGLTLAMLALLGGTGILLWRTTRFN* |
| Ga0066694_104643491 | 3300005574 | Soil | VPQLTLGWGWVAGLTAAMLALLVGTGWLLWRTTRFN* |
| Ga0066702_101510771 | 3300005575 | Soil | ARVPDLRLGWGWVAGLTVAMLALLGGTGVLLWRTTRFN* |
| Ga0066665_108064212 | 3300006796 | Soil | VDWALVGGATATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0066665_109716241 | 3300006796 | Soil | DWALVGGATATIVGFGMVARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0066659_102921063 | 3300006797 | Soil | GGATATIVGFGMVARVPQLTLGWGWVVGLTAAMLALLFGTGWLLWQTTRFN* |
| Ga0066659_111362921 | 3300006797 | Soil | HIAARWDWIVGLALVMLGALAGCGILLWRTTRFN* |
| Ga0066660_109757412 | 3300006800 | Soil | VTAATAVFVAPGLVAWVLDLRLGWASVAVLTLAMLALLGGTGILLWRTTRFN* |
| Ga0079221_106988081 | 3300006804 | Agricultural Soil | DLRLGWGWVAGLTVAMLALLGGTGVLLWRTTRFN* |
| Ga0079221_114045612 | 3300006804 | Agricultural Soil | MVARVPQLTLHWGWVAGLTAAMLALLLGTGLLLWRTTRFN* |
| Ga0079220_107724452 | 3300006806 | Agricultural Soil | VGFGVIARVPSLSIQWGWVVGLAATMMALLVGTGLLLWRTTRLN* |
| Ga0075434_1017616062 | 3300006871 | Populus Rhizosphere | GFGMLARVPQLTLHWGWVAGLTAAMLALLGGTGWLLWRTTRFN* |
| Ga0075426_104181533 | 3300006903 | Populus Rhizosphere | FGVIARVPSLSIQWGWVVGLTAMMAALLLGAGLLLWRTTKLN* |
| Ga0099827_101395753 | 3300009090 | Vadose Zone Soil | ATIVGFGMVARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWSTTRFN* |
| Ga0099827_102527612 | 3300009090 | Vadose Zone Soil | ATIVGFGMVARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0066709_1046839972 | 3300009137 | Grasslands Soil | ATATIAGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0134070_101491881 | 3300010301 | Grasslands Soil | VGGATATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0134088_105534502 | 3300010304 | Grasslands Soil | GGATATFVGFAIVARVPQLTLGWGWVVGLTAAMLALLFGTGWLLWRTTRFN* |
| Ga0134065_101711782 | 3300010326 | Grasslands Soil | VGGATTTFVGFGILARVPQLTVGWGWVAGLTTAMLALLSGTGWLLWRTTRFN* |
| Ga0134065_102120682 | 3300010326 | Grasslands Soil | VDWALVGGATATIAGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0134063_100304173 | 3300010335 | Grasslands Soil | VPQLTLAWGWVAGVTAAMLALLFGTGWLLWRTTRFN* |
| Ga0134063_104453461 | 3300010335 | Grasslands Soil | TATIAGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0134066_102145181 | 3300010364 | Grasslands Soil | VFVALGLVARVPDLRLGWAWVAGLTLAMLALLGGTGILLWRTTRFN* |
| Ga0134122_102819781 | 3300010400 | Terrestrial Soil | IGLGLMARVPNLAIHWSWVVGLTATMLALLWGTGILLWRTTRFN* |
| Ga0137392_102939122 | 3300011269 | Vadose Zone Soil | FVGLGAMARVPSLALAWGWVAGLTAAMLALLGGAGVLLWRTTRFN* |
| Ga0137388_106337671 | 3300012189 | Vadose Zone Soil | DWLLVGIATATFIGFGIVARVPQLTLHWGWVAGLTAAMLALLLGTGWLLWRTTRFN* |
| Ga0137383_101254252 | 3300012199 | Vadose Zone Soil | ARVPQLTLGWGWVVGLTAAMLALLSGTGWLLWRTTRFN* |
| Ga0137382_100802711 | 3300012200 | Vadose Zone Soil | QLTLGWGWVVGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0137382_104783051 | 3300012200 | Vadose Zone Soil | QLTVGWGWVAGLTTAMLALLSGTGWLLWRTTRFN* |
| Ga0137381_113617772 | 3300012207 | Vadose Zone Soil | ARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0137379_118310132 | 3300012209 | Vadose Zone Soil | GIVARVPQLTLGWGWVVGLTAAMLALLSGTGWLLWRTTRFN* |
| Ga0137377_102544893 | 3300012211 | Vadose Zone Soil | LDWLLVATATAVFVGLARVARVPDLPLAWGAIAALVLAMLALLGGTGLLLWRTTRFN* |
| Ga0137377_103003033 | 3300012211 | Vadose Zone Soil | VPELRLGWGWVAGLTLAMLALLGGTGVLLWRTTRFN* |
| Ga0137377_106423341 | 3300012211 | Vadose Zone Soil | RVPQLTLGWGWVVGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0137386_105001831 | 3300012351 | Vadose Zone Soil | VARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0137386_111061092 | 3300012351 | Vadose Zone Soil | VPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0137385_102158742 | 3300012359 | Vadose Zone Soil | GFGMVARVPQLTLRWGWVVGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0137390_105471982 | 3300012363 | Vadose Zone Soil | WLDWLLVGIATATFIGFGIVARVPQLTLHWGWVAGLAAAMLALLLGTGWLLWRTTRFN* |
| Ga0137416_101600002 | 3300012927 | Vadose Zone Soil | GMVARLPQLTIGWGWVAGLAATMLALLLGTGLLLWRTTRFN* |
| Ga0137416_103433302 | 3300012927 | Vadose Zone Soil | TATFVAFGVAARVPQLTLHWGWVAGLTAAMLALLFGTGWLLWRTTRFN* |
| Ga0137416_110763752 | 3300012927 | Vadose Zone Soil | VPQLTLHWGWVAGLTAAMLALLFGTGWLLWRTTRFN* |
| Ga0137404_116489311 | 3300012929 | Vadose Zone Soil | VGGATATFVGFGMVARVPQLTLGWGWVAGLTVAMLALLCGTGWLLWRTTRFN* |
| Ga0137404_118291572 | 3300012929 | Vadose Zone Soil | DWILVGGATATFVGFGIVARVPQLTLGWGWVVGLTTAMLALLSGTGWLLWRTTRFN* |
| Ga0134077_102456542 | 3300012972 | Grasslands Soil | DWILVGGATATFVGFGVVARVPQLTLGWGWVAGLTVAMLALLFGTGWLLWRTTRFN* |
| Ga0134110_100088193 | 3300012975 | Grasslands Soil | VGGATATFVGFGMVARVPQLTIGWGWVVGLTATMLALLSGTGWWLWRTTRFN* |
| Ga0134076_101332731 | 3300012976 | Grasslands Soil | IVGFGMVARVPQLTLSWGWVAGLTAAMLALLTGTGWLLWRTTRFN* |
| Ga0134076_105680542 | 3300012976 | Grasslands Soil | VGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN* |
| Ga0137403_108343322 | 3300015264 | Vadose Zone Soil | IVGFGMVARVPHLTLGWGWVAGLTAAMLALFAGTGWLLWRTTRFN* |
| Ga0134112_104262422 | 3300017656 | Grasslands Soil | ATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLSGTGWLLWRTTRFN |
| Ga0134083_100150521 | 3300017659 | Grasslands Soil | VDWVLVGGATATIVGFGMVARVPQLTLGWGWVAGLTVAMLALLFGTGWLLWRTTRFN |
| Ga0066655_108225992 | 3300018431 | Grasslands Soil | DWALVGGATATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLSGTGWLLWRTTRFN |
| Ga0066667_111246111 | 3300018433 | Grasslands Soil | IVAAATAVFVGLARGARVPDLALDWPAITALAVVMLALLGGTGLLLWRTTRFN |
| Ga0066662_104704132 | 3300018468 | Grasslands Soil | VGFGIVARVPQLTLGWGWVVGLTTAMLALLSGTGWLLWRTTRFN |
| Ga0066669_107053982 | 3300018482 | Grasslands Soil | LVARVPDLRLGWAWVAGLTLAMLALLGSTGVLLWRTTRFN |
| Ga0207699_105653242 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LVARVPELRVAWGWVAGLAVAMLALLGGTGVLLWRTTRFN |
| Ga0209350_10020149 | 3300026277 | Grasslands Soil | FVALGLVARVPDLRLGWAWVAGLTLAMLALLGGTGILLWRTTRFN |
| Ga0209234_11258353 | 3300026295 | Grasslands Soil | AAVRPTTHPQLTLGWGWVVGLTAAMLALLAGTGWLLWSTTRFN |
| Ga0209237_11153532 | 3300026297 | Grasslands Soil | IVARVPQLTLHWGWVAGLTAAMLALLLGTGWLLWRTTRFN |
| Ga0209236_10774351 | 3300026298 | Grasslands Soil | VGFGMVARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWRTTRFN |
| Ga0209468_10587551 | 3300026306 | Soil | IAGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN |
| Ga0209265_10060714 | 3300026308 | Soil | FVALGLVARVPDLRLGWAWVAGLTLAMLALLGSTGVLLWRTTRFN |
| Ga0209687_12132052 | 3300026322 | Soil | RVPDLRLGWAWVAGLTLAMLALLGGTGILLWRTTRFN |
| Ga0209472_10588912 | 3300026323 | Soil | IVGFGMVARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWRTTRFN |
| Ga0209470_13163132 | 3300026324 | Soil | VDWALVGGATATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLSGTGWLLWRTTRFN |
| Ga0209152_100765653 | 3300026325 | Soil | MVARVPQLTLGWGWVVGLTAAMLALLFGTGWLLWRTTRFN |
| Ga0209801_12317962 | 3300026326 | Soil | VGGATATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN |
| Ga0209802_10608861 | 3300026328 | Soil | VGFGMVARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWSTTRFN |
| Ga0209375_12891571 | 3300026329 | Soil | DWMLVGGATAIFVGFGMVARLPQLTLGWGWVAGLTLAMMALLSGTGWLLWRTTRFN |
| Ga0209473_10632362 | 3300026330 | Soil | PQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN |
| Ga0209267_10115331 | 3300026331 | Soil | IVARVPQLTLGWGWVVGLTTAMLALLSGTGWLLWRTTRFN |
| Ga0209803_11184552 | 3300026332 | Soil | ARGARVPDLALDWPAITALAVVMLALLGGTGLLLWRTTRFN |
| Ga0209377_11225951 | 3300026334 | Soil | FGIVARVPQLTLGWGWVVGLTTAMLALLSGTGWLLWRTTRFN |
| Ga0209804_10145002 | 3300026335 | Soil | VTGATAVFVALGLVARVPDLRLGWAWVAGLTLAMLALLGGTGILLWRTTRFN |
| Ga0209057_11546652 | 3300026342 | Soil | AVFVALARGARVPDLALDWPAITALAVVMLALLGGTGLLLWRTTRFN |
| Ga0257165_10725822 | 3300026507 | Soil | TLVGGTSAIFVGLGAMARVPSLALAWGWVAGLTAAMLALLGGAGVLLWRTTRFN |
| Ga0209690_11857841 | 3300026524 | Soil | IWLDWILVGGATATIVGFGIVARVPQLALGWGWVAGLTAAMLALLSGTGWLLWRTTRFN |
| Ga0209690_12452911 | 3300026524 | Soil | FVALARAARVPDLALDWGAVSALAVAMLALLGGTGVLLWRTTRFN |
| Ga0209378_10379191 | 3300026528 | Soil | FVGFGIVARVPQLTLGWGWVVGLTTAMLALLSGTGWLLWRTTRFN |
| Ga0209378_11711111 | 3300026528 | Soil | LVGGATATIVGFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN |
| Ga0209376_10118231 | 3300026540 | Soil | CATATFVGFAIVARVPQLTLGWGWVVGLTAAMLALLSGTGWLLWRTTRFN |
| Ga0209376_11330931 | 3300026540 | Soil | GFGMVARVPQLTLGWGWVAGLTAAMLALLAGTGWLLWRTTRFN |
| Ga0209161_100637531 | 3300026548 | Soil | ARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWRTTRFN |
| Ga0209689_11282083 | 3300027748 | Soil | WVDWALVGGATATIVGFGMVARVPQLTLGWGWVVGLTAAMLALLFGTGWLLWRTTRFN |
| Ga0209590_100741873 | 3300027882 | Vadose Zone Soil | IVGFGMVARVPQLTLGWGWVVGLTAAMLALLAGTGWLLWSTTRFN |
| Ga0137415_108539822 | 3300028536 | Vadose Zone Soil | VPQLTLHWGWVAGLTAAMLALLFGTGWLLWRTTRFN |
| Ga0307469_103985593 | 3300031720 | Hardwood Forest Soil | RVPQLMLHWGWVAGLTAAMLALLLGTGWVLWRTTRFN |
| Ga0307471_1023552641 | 3300032180 | Hardwood Forest Soil | RVPELQVAWGWVAGLAVAMLALLGGTGVLLWRTTRFN |
| ⦗Top⦘ |