| Basic Information | |
|---|---|
| Family ID | F086871 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDLNLTAEELAFRDELRAWLASNVPKDWNEWREKPLEE |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 87.27 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.818 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13193 | AMP-binding_C | 66.36 |
| PF13561 | adh_short_C2 | 5.45 |
| PF13673 | Acetyltransf_10 | 3.64 |
| PF13620 | CarboxypepD_reg | 1.82 |
| PF00593 | TonB_dep_Rec | 1.82 |
| PF00106 | adh_short | 0.91 |
| PF03454 | MoeA_C | 0.91 |
| PF13432 | TPR_16 | 0.91 |
| PF00230 | MIP | 0.91 |
| PF00583 | Acetyltransf_1 | 0.91 |
| PF13474 | SnoaL_3 | 0.91 |
| PF00378 | ECH_1 | 0.91 |
| PF00107 | ADH_zinc_N | 0.91 |
| PF00126 | HTH_1 | 0.91 |
| PF14329 | DUF4386 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.91 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.82 % |
| Unclassified | root | N/A | 28.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001166|JGI12694J13545_1009162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1117 | Open in IMG/M |
| 3300001170|JGI12704J13340_1004796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1333 | Open in IMG/M |
| 3300001593|JGI12635J15846_10878856 | Not Available | 512 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101510817 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300004080|Ga0062385_10350447 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300004092|Ga0062389_102719819 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005526|Ga0073909_10188856 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005537|Ga0070730_10852180 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005542|Ga0070732_10764275 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005563|Ga0068855_100315353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1729 | Open in IMG/M |
| 3300005575|Ga0066702_10061041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2059 | Open in IMG/M |
| 3300005764|Ga0066903_107339822 | Not Available | 570 | Open in IMG/M |
| 3300006797|Ga0066659_10257099 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300009088|Ga0099830_10270048 | Not Available | 1351 | Open in IMG/M |
| 3300009088|Ga0099830_11740235 | Not Available | 520 | Open in IMG/M |
| 3300010048|Ga0126373_12786303 | Not Available | 546 | Open in IMG/M |
| 3300010048|Ga0126373_13200191 | Not Available | 510 | Open in IMG/M |
| 3300010339|Ga0074046_10803579 | Not Available | 550 | Open in IMG/M |
| 3300010361|Ga0126378_13423039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia spinosispora | 503 | Open in IMG/M |
| 3300010375|Ga0105239_10287095 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300010876|Ga0126361_10600555 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300011269|Ga0137392_10392376 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300011271|Ga0137393_10124311 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
| 3300012189|Ga0137388_11291198 | Not Available | 669 | Open in IMG/M |
| 3300012361|Ga0137360_11283487 | Not Available | 633 | Open in IMG/M |
| 3300012363|Ga0137390_10485370 | Not Available | 1210 | Open in IMG/M |
| 3300015053|Ga0137405_1248081 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300016294|Ga0182041_11527151 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300016404|Ga0182037_10897203 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300017821|Ga0187812_1041493 | Not Available | 1562 | Open in IMG/M |
| 3300017993|Ga0187823_10197008 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300018007|Ga0187805_10177405 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300018047|Ga0187859_10020272 | All Organisms → cellular organisms → Bacteria | 3687 | Open in IMG/M |
| 3300018062|Ga0187784_11073332 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018085|Ga0187772_10490878 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300018468|Ga0066662_10939607 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300019789|Ga0137408_1137109 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300020199|Ga0179592_10287979 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300020579|Ga0210407_11441565 | Not Available | 510 | Open in IMG/M |
| 3300020580|Ga0210403_10307723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1298 | Open in IMG/M |
| 3300020580|Ga0210403_11008895 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300020581|Ga0210399_10545381 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300020581|Ga0210399_10651522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300021046|Ga0215015_10183544 | Not Available | 593 | Open in IMG/M |
| 3300021088|Ga0210404_10133224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1288 | Open in IMG/M |
| 3300021403|Ga0210397_10079608 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300021405|Ga0210387_10643498 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300021406|Ga0210386_11274238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300021420|Ga0210394_10603528 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300021420|Ga0210394_10947938 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300021420|Ga0210394_11054991 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300021420|Ga0210394_11477598 | Not Available | 575 | Open in IMG/M |
| 3300021433|Ga0210391_10151502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1826 | Open in IMG/M |
| 3300021478|Ga0210402_11160040 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300021478|Ga0210402_11927893 | Not Available | 517 | Open in IMG/M |
| 3300021559|Ga0210409_10103406 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
| 3300021559|Ga0210409_10323639 | Not Available | 1387 | Open in IMG/M |
| 3300022533|Ga0242662_10313141 | Not Available | 526 | Open in IMG/M |
| 3300025612|Ga0208691_1117187 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300025898|Ga0207692_10786788 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300025898|Ga0207692_10887252 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300025905|Ga0207685_10110560 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300025911|Ga0207654_10656356 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300025912|Ga0207707_10533559 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300025912|Ga0207707_11016010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300025939|Ga0207665_10916798 | Not Available | 695 | Open in IMG/M |
| 3300026356|Ga0257150_1061269 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026489|Ga0257160_1089092 | Not Available | 552 | Open in IMG/M |
| 3300026499|Ga0257181_1035924 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300026551|Ga0209648_10637777 | Not Available | 584 | Open in IMG/M |
| 3300027034|Ga0209730_1040388 | Not Available | 541 | Open in IMG/M |
| 3300027567|Ga0209115_1005491 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300027635|Ga0209625_1009244 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
| 3300027643|Ga0209076_1174908 | Not Available | 595 | Open in IMG/M |
| 3300027651|Ga0209217_1042597 | Not Available | 1389 | Open in IMG/M |
| 3300027655|Ga0209388_1032995 | Not Available | 1485 | Open in IMG/M |
| 3300027674|Ga0209118_1035364 | Not Available | 1518 | Open in IMG/M |
| 3300027676|Ga0209333_1186162 | Not Available | 551 | Open in IMG/M |
| 3300027842|Ga0209580_10014509 | All Organisms → cellular organisms → Bacteria | 3437 | Open in IMG/M |
| 3300027857|Ga0209166_10257321 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300027862|Ga0209701_10480844 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300027898|Ga0209067_10194401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
| 3300028775|Ga0302231_10108476 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300028806|Ga0302221_10444167 | Not Available | 565 | Open in IMG/M |
| 3300029944|Ga0311352_10030497 | All Organisms → cellular organisms → Bacteria | 5110 | Open in IMG/M |
| 3300029951|Ga0311371_10827260 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300029993|Ga0302304_10126613 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300030503|Ga0311370_10870718 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300030580|Ga0311355_10729554 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300030580|Ga0311355_11013506 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300031057|Ga0170834_107096014 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300031708|Ga0310686_101280647 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300031708|Ga0310686_108587986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300031715|Ga0307476_10172974 | Not Available | 1559 | Open in IMG/M |
| 3300031753|Ga0307477_10013619 | All Organisms → cellular organisms → Bacteria | 5555 | Open in IMG/M |
| 3300031753|Ga0307477_10230290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1285 | Open in IMG/M |
| 3300031771|Ga0318546_10763971 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300031793|Ga0318548_10165818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1079 | Open in IMG/M |
| 3300031805|Ga0318497_10055004 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300031945|Ga0310913_10808125 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031954|Ga0306926_10025046 | All Organisms → cellular organisms → Bacteria | 6934 | Open in IMG/M |
| 3300032060|Ga0318505_10423270 | Not Available | 630 | Open in IMG/M |
| 3300032261|Ga0306920_100136129 | All Organisms → cellular organisms → Bacteria | 3658 | Open in IMG/M |
| 3300032770|Ga0335085_11025836 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300032783|Ga0335079_10571898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1196 | Open in IMG/M |
| 3300032783|Ga0335079_10819702 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300032783|Ga0335079_11232971 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300032805|Ga0335078_12642202 | Not Available | 513 | Open in IMG/M |
| 3300032828|Ga0335080_12098856 | Not Available | 545 | Open in IMG/M |
| 3300033289|Ga0310914_10887966 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.09% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12694J13545_10091621 | 3300001166 | Forest Soil | MDLNLTSEEMQFRDELRSWLAAHVPSDWAERREESLESRFE |
| JGI12704J13340_10047961 | 3300001170 | Forest Soil | MDLNLTAEELTFRDELRAWLASNVPKDWSDWREKPMEESFP |
| JGI12635J15846_108788561 | 3300001593 | Forest Soil | MDLNLTADELQFRDELRSWLTANLPKDWDEWREKPIEVSFPYL |
| JGIcombinedJ26739_1015108171 | 3300002245 | Forest Soil | MDLKLTPEESSFRDELRAWLATNAPKDWAEWREKPLEE |
| Ga0062385_103504471 | 3300004080 | Bog Forest Soil | MDLRLTAEESAFRDELRAWLAINVPRDWSEWREKPIEESYPYLRA |
| Ga0062389_1027198192 | 3300004092 | Bog Forest Soil | MDLNLSTDEQTFQDELRSWLETNVPREWEHAREQSLDVRFEFHR |
| Ga0073909_101888561 | 3300005526 | Surface Soil | MDLNLSPEEIKFRDELRTWLAANAPKDWDERREESMESRFEYLKRWQR |
| Ga0070730_108521801 | 3300005537 | Surface Soil | MDLNLSPEEIKFRDELRNWLSANAPKDWDERREESM |
| Ga0070732_107642751 | 3300005542 | Surface Soil | MDLKLSLEELQFRDELRAWLRANVPRDWGEWREKPIE |
| Ga0068855_1003153533 | 3300005563 | Corn Rhizosphere | MDLNLSPDEIKFRDELRTWLAANAPTDWDERREES |
| Ga0066702_100610411 | 3300005575 | Soil | MDLSLSPDEIKFRDVLRTWLAGNAPTDWDERREESMESRFEYLKRWQ |
| Ga0066903_1073398223 | 3300005764 | Tropical Forest Soil | MDLNLSADELKFRDELRAWLAANVPKDWDEYRDESLEARF |
| Ga0066659_102570991 | 3300006797 | Soil | MDLKLTAEELKFRDELRAWLKSNVPKDWDEWREETLEARF |
| Ga0099830_102700481 | 3300009088 | Vadose Zone Soil | MDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKP |
| Ga0099830_117402351 | 3300009088 | Vadose Zone Soil | MDLNLTLEEKQFRDELRIWLEANVPKDWSEWREKPIEESFTYL |
| Ga0126373_127863031 | 3300010048 | Tropical Forest Soil | MDLNLTREEVAFRDAFRSWLASNVPNDWSRWREKPLEESFSYL |
| Ga0126373_132001912 | 3300010048 | Tropical Forest Soil | MDLNLTREEVAFRDEFRSWLASNVPNDWSRWREKPLE |
| Ga0074046_108035792 | 3300010339 | Bog Forest Soil | MDLNLSSEERQFRDEFRGWLEANVPKDWPEWREKPL |
| Ga0126378_134230391 | 3300010361 | Tropical Forest Soil | MDLNLSADELKFRDELRAWLAANVPKDWNEHREESLEAR |
| Ga0105239_102870953 | 3300010375 | Corn Rhizosphere | MDLNLSPDEIKFRDELRTWLSANAPTDWDERREESMESRFEYL |
| Ga0126361_106005551 | 3300010876 | Boreal Forest Soil | MDLKLTPEESSFRDELRSWLAANAPKDWAEWREKPLEES |
| Ga0137392_103923762 | 3300011269 | Vadose Zone Soil | MNLNLSPEELQFRDELREWLRANVPRDWSEWREKPIEESFPYLRAW |
| Ga0137393_101243111 | 3300011271 | Vadose Zone Soil | MDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKPIEE |
| Ga0137388_112911982 | 3300012189 | Vadose Zone Soil | MDLNLSTEELKFRDELRAWLTANVPRDWDERREESLEVRFDYLK |
| Ga0137360_112834872 | 3300012361 | Vadose Zone Soil | MNLNLSPEELQFRDELRKWLRANVPRDWSEWREKPIEESF |
| Ga0137390_104853702 | 3300012363 | Vadose Zone Soil | MDLNLTKEEIAFRDELRAWLKASVPKDWDERRESPM |
| Ga0137405_12480811 | 3300015053 | Vadose Zone Soil | MDLNLTTEELSFRDELRAWLVSNVPKDWNEWRGVA* |
| Ga0182041_115271512 | 3300016294 | Soil | MDLNLTPDEAAFRDELRLWLAANVPTDGNTWREKSLEESFP |
| Ga0182037_108972031 | 3300016404 | Soil | MDLNLNNEEKQFRDELRSWLEANAPKDWAEWRERPL |
| Ga0187812_10414932 | 3300017821 | Freshwater Sediment | VDLNLTPGERQFRDDLRAWLAVHVPKDWNEWREKPIEVSF |
| Ga0187823_101970081 | 3300017993 | Freshwater Sediment | MDLNLNAEERQFRDELRAWLEANTPKDWSDWREKPLEESF |
| Ga0187805_101774052 | 3300018007 | Freshwater Sediment | VDLNLNAEEKQFRDELRAWLSANVPKDWAEWREKPLE |
| Ga0187859_100202721 | 3300018047 | Peatland | MDLNLTPEELTFRDELRAWLASNVPKDWKEWREKPMEESF |
| Ga0187784_110733322 | 3300018062 | Tropical Peatland | MDLNLSAEERSFRDEFRTWLEANVPRDWPEWREKPLE |
| Ga0187772_104908782 | 3300018085 | Tropical Peatland | MDLNLNAEERQFRDELRAWLEMHVPKDWSEWREKPLEESFPYLR |
| Ga0066662_109396072 | 3300018468 | Grasslands Soil | MDLNLTAGELKFRDELRAWLATNVPKDWEEWREESLEAR |
| Ga0137408_11371093 | 3300019789 | Vadose Zone Soil | MDLNLSPDEIKFRDELRSWLSANAPTDWDERREESMESRFEYL |
| Ga0179592_102879791 | 3300020199 | Vadose Zone Soil | MDLNLTAGESAFREELRAWLAANAPKDWNEWREKPLE |
| Ga0210407_114415651 | 3300020579 | Soil | MDLKLTPEESSFRDELRAWLATNAPKDWAEWREKPLE |
| Ga0210403_103077232 | 3300020580 | Soil | MDLKLTPEESSFRDELRAWLATNAPKDWAEWREKPL |
| Ga0210403_110088951 | 3300020580 | Soil | MDLNLTADEKLFRDELRSWLALNAPKDWPAWQNKPLEE |
| Ga0210399_105453811 | 3300020581 | Soil | MDLKLTAEELAFRDELRAWLASNIPKDWEEWREKPIEES |
| Ga0210399_106515222 | 3300020581 | Soil | MDLNLTADESAFRDELRAWLASHVPKDWDAWREKPMEESF |
| Ga0215015_101835441 | 3300021046 | Soil | MDLNLSVEELRFRDELRAWLLANAPRDWSEWPVSY |
| Ga0210404_101332242 | 3300021088 | Soil | MDLNLTAEELAFRDELRGWLAANAPKDWNEWREKPLEES |
| Ga0210397_100796081 | 3300021403 | Soil | MDLNLTADELQFRDELRSWLASNVPKDWNEWREKP |
| Ga0210387_106434982 | 3300021405 | Soil | MDLNLTADEKVFRDELRSWLAANAPKDWPVWQNKP |
| Ga0210386_112742382 | 3300021406 | Soil | MDLNLTAEELAFRDELRSWLASHVPKDWDEWREKHM |
| Ga0210394_106035281 | 3300021420 | Soil | MDLNLTAEELAFRDELRSWLASNLPIDWEEWREKPIEESFP |
| Ga0210394_109479382 | 3300021420 | Soil | MDLNLTSEEMQFRDELRSWLTANVPTDWAERREESLE |
| Ga0210394_110549912 | 3300021420 | Soil | MDLNLTPDELQFRDELRSWLATNVPKDWNEWREKPI |
| Ga0210394_114775982 | 3300021420 | Soil | MDLNLNTEEKQFRDELRAWLDANVPKDWAQWREKPLEEVFPYH |
| Ga0210391_101515021 | 3300021433 | Soil | MDLKLTAEESAFRDEFCAWLTSNVPKDWTEWREKPIEES |
| Ga0210402_111600401 | 3300021478 | Soil | MDLKLSREELQFRDELRAWLAANLPRDWGEWREKPIEESFSYLR |
| Ga0210402_119278932 | 3300021478 | Soil | MDLNLTAEELAFRDELRAWLATNVPKDWNEWREKP |
| Ga0210409_101034061 | 3300021559 | Soil | MDLNLTAEEKAFRDELRAWLASNVPRDWSEWREKPIE |
| Ga0210409_103236391 | 3300021559 | Soil | MDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKPIEES |
| Ga0242662_103131411 | 3300022533 | Soil | MDLNLTAEELAFRDELRAWLASNVPKDWNEWREKPLEE |
| Ga0208691_11171872 | 3300025612 | Peatland | MDLNLTPEELTFRDELRAWLASNVPKDWKEWREKPMEES |
| Ga0207692_107867882 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLNLNPAETKFRDELRAWLTANVPKDWDERREESLE |
| Ga0207692_108872522 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLNLSPDEIKFRDELRSWLAANAPKDWDERREESMESRFEY |
| Ga0207685_101105603 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLNLSPEEIKFRDELRSWLATNAPKDWDERREES |
| Ga0207654_106563562 | 3300025911 | Corn Rhizosphere | MDLNLSPDEIKFRDELRTWLAANAPSDWDERREESMESRFEYLKRWQRPSTQPA |
| Ga0207707_105335591 | 3300025912 | Corn Rhizosphere | MDLNLSPDEIKFRDELRTWLAANAPTDWDERREESMESRFEYLK |
| Ga0207707_110160101 | 3300025912 | Corn Rhizosphere | MDLNLSPDEIKFRDELRTWLAANAPTDWDERREESMESRFEYL |
| Ga0207665_109167982 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLNLSPEEIKFRDELRAWLAANVPKDWDERREESLESRF |
| Ga0257150_10612691 | 3300026356 | Soil | MDLNLTPDELQFRDELRSWLATNVPKDWNEWREKPIEES |
| Ga0257160_10890922 | 3300026489 | Soil | MDLNLNAEESAFRDELGAWLASNVPKDWNQWREKP |
| Ga0257181_10359242 | 3300026499 | Soil | MDLNLAAEESAFRDEFRAWLAANAPKDWNEWCEKPLEESFPYL |
| Ga0209648_106377773 | 3300026551 | Grasslands Soil | MDLNLSADELKFRDELRAWLAANVPKDWDEHREESLEA |
| Ga0209730_10403882 | 3300027034 | Forest Soil | MDLNLTAEELAFRDELRAWLAVNVPRDWNEWREKPLEESFPYL |
| Ga0209115_10054913 | 3300027567 | Forest Soil | MDLNLTKEELSFRDELRAWLANNLPKDWNEWREKP |
| Ga0209625_10092441 | 3300027635 | Forest Soil | MDLKLTPEESSFRDELRAWLATNAPKDWAEWREKPLEESFPYL |
| Ga0209076_11749081 | 3300027643 | Vadose Zone Soil | MDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKPIEESFPY |
| Ga0209217_10425972 | 3300027651 | Forest Soil | MNLNLNAEESTFRDELRLWLASNVPKDWNMWSEKPIEESFAY |
| Ga0209388_10329951 | 3300027655 | Vadose Zone Soil | MDLNLTTEELSFRDELRAWLVSNVPKDWNEWREKPIEESFP |
| Ga0209118_10353642 | 3300027674 | Forest Soil | MDLNLTAEEMAFRDELRAWLASNAPKDWNEWREKPLEESF |
| Ga0209333_11861622 | 3300027676 | Forest Soil | VDLNLTSEEMQFRDELRSWLTANVPTDWAERREES |
| Ga0209580_100145091 | 3300027842 | Surface Soil | MDLNLSPEEIKFRDELRSWLSANAPTDWDERREESMESRFEYLK |
| Ga0209166_102573211 | 3300027857 | Surface Soil | MDLNLSPDEIKFRDELRTWLAANAPTDWDERREESMESRFEYLKRWQR |
| Ga0209701_104808442 | 3300027862 | Vadose Zone Soil | MDLNLTTEELSFRDELRAWLVSNVPKDWNERREKP |
| Ga0209067_101944011 | 3300027898 | Watersheds | MDLKLTAEELAFRDELRTWLASNVPADWSEGREKP |
| Ga0302231_101084761 | 3300028775 | Palsa | MDLNLTEQELSFRDELRAWLAANLPKDWSEWREKPI |
| Ga0302221_104441672 | 3300028806 | Palsa | MDLNLTDEELKFRDELRAWLASNVPKDWKEWREKPM |
| Ga0311352_100304971 | 3300029944 | Palsa | MDLSLTAEESAFRDQLRAWLASNVPKDWSEWRDKPMEES |
| Ga0311371_108272602 | 3300029951 | Palsa | MDLNLTPDEKQFRDELRTWLAANTPKDWPEWQNKPLEESYPYL |
| Ga0302304_101266131 | 3300029993 | Palsa | MDLNLTDEELKFRDELRAWLASNVPKDWKEWREKPMEES |
| Ga0311370_108707182 | 3300030503 | Palsa | MDLNLTADEKLFRDELRSWLAANAPKDWPAWQNKPLEESYPY |
| Ga0311355_107295542 | 3300030580 | Palsa | VDLNLTSDEMQFRDELRSWLTANVPADWAERREES |
| Ga0311355_110135062 | 3300030580 | Palsa | MDLNLTDEELKFRDELRAWLASNVPKDWKEWREKPMEESFP |
| Ga0170834_1070960141 | 3300031057 | Forest Soil | MDLNLTPDEAAFRDELRPWLAANVPKDWSTWREKPLEES |
| Ga0310686_1012806472 | 3300031708 | Soil | MDLNLTPDELQFRDELRSWLATNVPKDWNEWREKPIE |
| Ga0310686_1085879863 | 3300031708 | Soil | MDLNLTAEELTFRDELRAWLASNVPKDWAEWREKPIE |
| Ga0307476_101729742 | 3300031715 | Hardwood Forest Soil | MDLNLTPEETKFRDELRTWLEANVPKDWGEWREKPLEESFP |
| Ga0307477_100136191 | 3300031753 | Hardwood Forest Soil | MDLNLTGEEVAFRDEFRSWLGINAPKDWSSWREKPLEESFA |
| Ga0307477_102302902 | 3300031753 | Hardwood Forest Soil | MDLKLSLEELQFREELRAWLGANLPRDWGEWREKPIEESFP |
| Ga0318546_107639712 | 3300031771 | Soil | MDLNLTRDEVAFRDELRSWLAANVPEDWSSWREKPLEE |
| Ga0318548_101658182 | 3300031793 | Soil | MDLNLTREEVAFRDEFRSWLASNVPNDWRRWREKPLEES |
| Ga0318497_100550043 | 3300031805 | Soil | MDLNLTREEVAFRDEFRSWLASNVPNDWSRWREKPLEE |
| Ga0310913_108081251 | 3300031945 | Soil | MDLNLTREEAAFRDEFRSWLATNVPRDWSAWREKPLEESF |
| Ga0306926_100250461 | 3300031954 | Soil | MDLNLTREETAFRDELRAWLAGNVPKDWSSWREKPLAVSFPYLR |
| Ga0318505_104232702 | 3300032060 | Soil | MDLTLNDEEKEFRNELRAWLEANAPNDWAEWREKPLEESFPYLR |
| Ga0306920_1001361291 | 3300032261 | Soil | MDLNLSADELKFRDELRAWLAANVPKDWNEHREESLEV |
| Ga0335085_110258361 | 3300032770 | Soil | MDLNLTTEEKQFRDELRAWLEANVPKDWGEWREKP |
| Ga0335079_105718982 | 3300032783 | Soil | MDLNLSAEEREFRDEFRGWLEANVPKDWPVWREKPLEESF |
| Ga0335079_108197022 | 3300032783 | Soil | MDLNLSPDELKFRDELRAWLETNVPREWDEAREESLD |
| Ga0335079_112329711 | 3300032783 | Soil | MDLNLNAEERQFRDELRAWLEANTPKDWSDWREKPLE |
| Ga0335078_126422022 | 3300032805 | Soil | MDLNLNAEELAFRGELRAWLEANVPKDWREWREKPLEE |
| Ga0335080_120988562 | 3300032828 | Soil | MDLNLNAEERQFRDELRAWLEANTPKDWSDWREKPLEES |
| Ga0310914_108879662 | 3300033289 | Soil | MDLKLTTEELAFRNELRAWLEANIPTDWSEWREKPLDESF |
| ⦗Top⦘ |