| Basic Information | |
|---|---|
| Family ID | F086867 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AKSNTVAAIEAFQSRSNISIDGLIEPDSQTWQALLQAAGGT |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.36 % |
| % of genes from short scaffolds (< 2000 bps) | 91.82 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01551 | Peptidase_M23 | 28.18 |
| PF03734 | YkuD | 25.45 |
| PF00472 | RF-1 | 1.82 |
| PF05990 | DUF900 | 1.82 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 25.45 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 25.45 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 1.82 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 1.82 |
| COG4782 | Esterase/lipase superfamily enzyme | General function prediction only [R] | 1.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.09 % |
| Unclassified | root | N/A | 0.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8864296 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1024 | Open in IMG/M |
| 2170459003|FZ032L002G7V0F | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 520 | Open in IMG/M |
| 2170459007|GKWS7RC02H274W | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 511 | Open in IMG/M |
| 2170459013|GO6OHWN02F5Q7M | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 2228664022|INPgaii200_c0998488 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300000955|JGI1027J12803_100013508 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300000955|JGI1027J12803_101130516 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300000955|JGI1027J12803_101445163 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300001991|JGI24743J22301_10033929 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300004479|Ga0062595_102413134 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300004643|Ga0062591_101331455 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300005093|Ga0062594_100712933 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300005186|Ga0066676_10355961 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005289|Ga0065704_10028798 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1156 | Open in IMG/M |
| 3300005338|Ga0068868_101036372 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 752 | Open in IMG/M |
| 3300005340|Ga0070689_100802213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 828 | Open in IMG/M |
| 3300005347|Ga0070668_101705112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 578 | Open in IMG/M |
| 3300005450|Ga0066682_10108271 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300005450|Ga0066682_10555883 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005554|Ga0066661_10520785 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 716 | Open in IMG/M |
| 3300005598|Ga0066706_10779775 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005764|Ga0066903_105981746 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 638 | Open in IMG/M |
| 3300005840|Ga0068870_11370341 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006031|Ga0066651_10555704 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 609 | Open in IMG/M |
| 3300006032|Ga0066696_10801679 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006034|Ga0066656_11089125 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300006059|Ga0075017_100818002 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300006797|Ga0066659_10404190 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300009012|Ga0066710_100818250 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300009012|Ga0066710_102293113 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009137|Ga0066709_102082620 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009137|Ga0066709_104651412 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009176|Ga0105242_10469150 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300009553|Ga0105249_10221102 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300010040|Ga0126308_10977419 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 592 | Open in IMG/M |
| 3300010154|Ga0127503_11057981 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010304|Ga0134088_10050118 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300010333|Ga0134080_10074909 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1363 | Open in IMG/M |
| 3300010358|Ga0126370_10943592 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300010360|Ga0126372_12945356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 528 | Open in IMG/M |
| 3300010362|Ga0126377_13002030 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
| 3300010366|Ga0126379_11005344 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 939 | Open in IMG/M |
| 3300012201|Ga0137365_10559758 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300012204|Ga0137374_10031206 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5824 | Open in IMG/M |
| 3300012204|Ga0137374_10031838 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 5753 | Open in IMG/M |
| 3300012207|Ga0137381_10367513 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300012207|Ga0137381_10378439 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300012211|Ga0137377_11431674 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012285|Ga0137370_10749581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 606 | Open in IMG/M |
| 3300012349|Ga0137387_10071673 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
| 3300012353|Ga0137367_10107210 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2056 | Open in IMG/M |
| 3300012354|Ga0137366_10475738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 904 | Open in IMG/M |
| 3300012358|Ga0137368_10049860 | All Organisms → cellular organisms → Bacteria | 3562 | Open in IMG/M |
| 3300012469|Ga0150984_107175321 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300012582|Ga0137358_10751078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 651 | Open in IMG/M |
| 3300012907|Ga0157283_10369271 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012911|Ga0157301_10460603 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012922|Ga0137394_10777310 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012924|Ga0137413_10669059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 784 | Open in IMG/M |
| 3300012925|Ga0137419_10343091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1153 | Open in IMG/M |
| 3300012929|Ga0137404_10670779 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300012941|Ga0162652_100029948 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 811 | Open in IMG/M |
| 3300012972|Ga0134077_10220880 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012975|Ga0134110_10476362 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 564 | Open in IMG/M |
| 3300012985|Ga0164308_11162078 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300012987|Ga0164307_10676766 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300012987|Ga0164307_10758161 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300012988|Ga0164306_11644254 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300013296|Ga0157374_10117500 | All Organisms → cellular organisms → Bacteria | 2563 | Open in IMG/M |
| 3300014150|Ga0134081_10114681 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300014154|Ga0134075_10584401 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300014325|Ga0163163_11063348 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300015053|Ga0137405_1193215 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300015242|Ga0137412_10278442 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300015245|Ga0137409_10451293 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300015374|Ga0132255_103426064 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300017659|Ga0134083_10252367 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018051|Ga0184620_10020739 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300018054|Ga0184621_10291708 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 576 | Open in IMG/M |
| 3300018061|Ga0184619_10128747 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1149 | Open in IMG/M |
| 3300018072|Ga0184635_10158450 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300019874|Ga0193744_1100433 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
| 3300019881|Ga0193707_1141772 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300019885|Ga0193747_1003148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4094 | Open in IMG/M |
| 3300019999|Ga0193718_1017196 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300020004|Ga0193755_1126389 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300020199|Ga0179592_10062765 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300021413|Ga0193750_1042949 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300021560|Ga0126371_11463586 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300025908|Ga0207643_11059709 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300025930|Ga0207701_10753848 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300025930|Ga0207701_11264379 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300025933|Ga0207706_11633723 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300025944|Ga0207661_10914012 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300025945|Ga0207679_12016811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 525 | Open in IMG/M |
| 3300025961|Ga0207712_11325005 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300025986|Ga0207658_10481359 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1103 | Open in IMG/M |
| 3300026067|Ga0207678_10614850 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300026088|Ga0207641_11560776 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300026316|Ga0209155_1100292 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1047 | Open in IMG/M |
| 3300026335|Ga0209804_1196908 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 847 | Open in IMG/M |
| 3300026536|Ga0209058_1237397 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300027717|Ga0209998_10126554 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 647 | Open in IMG/M |
| 3300028784|Ga0307282_10350090 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300028881|Ga0307277_10249671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 783 | Open in IMG/M |
| 3300031057|Ga0170834_105055101 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031122|Ga0170822_12366372 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031446|Ga0170820_17840860 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1116 | Open in IMG/M |
| 3300032059|Ga0318533_11134156 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.91% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_02721810 | 2088090015 | Soil | AAIEAFQSRFNISIGGLIEPGSQTWQALLQAAGSN |
| E4A_03429740 | 2170459003 | Grass Soil | RPPQRSNTVAAIEAFQRRSNIPITGLIEPGSQAWQALLQGAGET |
| L02_00961030 | 2170459007 | Grass Soil | KDLDGKIARPPQRSNTVAAIEAFQRRSNIPITGLIEPGSQAWQALLQGAGET |
| N57_02163660 | 2170459013 | Grass Soil | SNTVNAIEAFQSRSNISIDGLIEPDSQTWQALLQAAGGS |
| INPgaii200_09984881 | 2228664022 | Soil | VAAIEAFQGRSNISIDGLIEPGSQTWQSLLQATGGP |
| JGI1027J12803_1000135082 | 3300000955 | Soil | IARQSAKSNTVAAIEAFQSRSNISIDGLIEPGSQTWRALLQAAGDT* |
| JGI1027J12803_1011305161 | 3300000955 | Soil | RQSAKSNTVAAIEAFQRRSNVPIDGLIEPGSQTWQSLLQAVGGP* |
| JGI1027J12803_1014451632 | 3300000955 | Soil | TSNTVAAIEAFQSRSNSSIDGLIDPASQTWQALMQAAGGT* |
| JGI24743J22301_100339291 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | DGKIARPPRNSNTVNAIEAFQSRLNISIDGLIEPDSQTWVALLQAASGS* |
| Ga0062595_1003826031 | 3300004479 | Soil | APQLDPKGIDGKIARLPAKSNTAAAIEALQSRCNISIGSLIEPGSETWRALLQAAGAT* |
| Ga0062595_1024131342 | 3300004479 | Soil | RPPAKSNTVAGVEAFQSLSNISINGLIEPGSQTWQALLQAAGES* |
| Ga0062591_1013314552 | 3300004643 | Soil | GVDGKIARPPRNSNTVNAIEAFQSRLNISIDGLIEPDSQTWVALLQAASGS* |
| Ga0062594_1007129332 | 3300005093 | Soil | SNTVNAIEAFQRRSNISVDGLIEPESQTWRALLQAAGGT* |
| Ga0066676_103559611 | 3300005186 | Soil | SNTVAAIEAFQSHSNISIDGLIEPGSQTWQALLQAAGET* |
| Ga0065704_100287982 | 3300005289 | Switchgrass Rhizosphere | LLRTAAQKLQAPQLDPKGVDGKIAQPPRNSNTVNAIVAFQSHSNISIDGLIKPESQTWRALLLAGGGS* |
| Ga0068868_1010363721 | 3300005338 | Miscanthus Rhizosphere | VDGKIARQSAKSNTVAAIEAFQGRSNIPITGLIEPGSQAWQALLQGAGET* |
| Ga0070689_1008022131 | 3300005340 | Switchgrass Rhizosphere | RQSAKSNTVAAIEAFQSRSNIPITGLIEPGSQAWQALLQVAGET* |
| Ga0070668_1017051122 | 3300005347 | Switchgrass Rhizosphere | SNTVAAIEAFQSRSSIPITGLIEPDSQAWQALLQAAGEP* |
| Ga0066682_101082711 | 3300005450 | Soil | KIARPPATSNTVAAIEAFQSRSNISIDGLIDPASQTWQALLQAAGGS* |
| Ga0066682_105558832 | 3300005450 | Soil | KIARPPATSNTVAAIEAFQSRSNISIDGLIDPASQTWQALVQAAGGT* |
| Ga0066661_105207851 | 3300005554 | Soil | LQAPQLDPKGVDGKIARPPAKSNTVAAIEAFQSLSNISITGLIEPGSQAWRALLQGAGET |
| Ga0066706_107797751 | 3300005598 | Soil | NTVAAIEAFQSRSNISIDGLIERTSQTWQALLQAAGGT* |
| Ga0066903_1059817462 | 3300005764 | Tropical Forest Soil | NTVAAIKAFQSRSNISITGLIEPGSQAWQALLQAAGET* |
| Ga0068870_113703412 | 3300005840 | Miscanthus Rhizosphere | VDGKIARPPRNSNTVNAIEAFQSRLNISIDGLIEPDSQTWVALLQAASGS* |
| Ga0066651_105557042 | 3300006031 | Soil | QLDPKGVDGKIARPPAKSNTVAAIEAFQSLSNISITGLIEPDSQAWRALLQGAGKT* |
| Ga0066696_108016791 | 3300006032 | Soil | SNTVAAIEAFQRHSNVPIDGLIEPSSQTWQSLVQPAGGL* |
| Ga0066656_110891252 | 3300006034 | Soil | KIARPPATSNTVAAIEAFQSRSNISIDGLIDPASQTWQALLQAAGGT* |
| Ga0075017_1008180023 | 3300006059 | Watersheds | AAQKAHLPQLDPHGVDGKIARPPAKSNTVAAIEALESASMLTVDGLIAPGSPAWQALLKAAS* |
| Ga0066659_104041903 | 3300006797 | Soil | DGKMARAPATSDTVAAIEAFQSRSNISIDGLIDPASQTWQALLQAAGGA* |
| Ga0066710_1008182503 | 3300009012 | Grasslands Soil | DGKIARQSAKSNTVAAIEAFQSHSNISISGLIEPGSQTWQALLQAAGET |
| Ga0066710_1022931132 | 3300009012 | Grasslands Soil | ARPPATSDTVAAIEAFQSRSNISIDGLIDPASQTWQALLQGAGGT |
| Ga0066709_1020826202 | 3300009137 | Grasslands Soil | ARPPATSDTVAAIEAFQSRSNISIDGLIDPASQTWQALLQAAGGT* |
| Ga0066709_1046514122 | 3300009137 | Grasslands Soil | ARPPATSDTVAAIEAFQSRSNISIDGLIDPASQTWQALLQGAGGT* |
| Ga0105242_104691501 | 3300009176 | Miscanthus Rhizosphere | NTVNAIEAFQSRLSISVDGLIEPGSQTWLALLQAAGGS* |
| Ga0105249_102211023 | 3300009553 | Switchgrass Rhizosphere | SNTVAAIEAFQSRSNISIDGLIEPGSQAWQALLQAANGS* |
| Ga0126308_109774191 | 3300010040 | Serpentine Soil | DGRIARQPAKSNTVAAIEAFQSRSNISITGLIEPDSQAWQALLHGTGES* |
| Ga0127503_110579811 | 3300010154 | Soil | KIARPPRNSNTVNAIEAFQSRSNISVDGLIATDSQTWQALLQAAGGS* |
| Ga0134088_100501184 | 3300010304 | Grasslands Soil | IARPPAKSNTVAAIEALQSRSNISIDGLIERTSQTWQALLQAAGGT* |
| Ga0134080_100749091 | 3300010333 | Grasslands Soil | ARPPATSNTVAAIEAFQSRSNISIDGLIERTSQTWQALLQAAGGT* |
| Ga0126370_109435921 | 3300010358 | Tropical Forest Soil | AAAQKLQASELDPKGIDGKITRPPGHSNTTAAIEALQARFNISIDGLIEPDSQTWRALVQAAAGT* |
| Ga0126372_129453561 | 3300010360 | Tropical Forest Soil | RTSNTVAAIKAFQSRSTISVDGLIEPGDKTWQALLHAAGET* |
| Ga0126377_130020302 | 3300010362 | Tropical Forest Soil | IARQSAKSNTVAAIKAFQKRSNISVDGMIEPGSQAWLALLQAAGQT* |
| Ga0126379_110053442 | 3300010366 | Tropical Forest Soil | AAIEAFQSRSNIAIDGVIEPGSETLQALLLGAGKT* |
| Ga0137365_105597581 | 3300012201 | Vadose Zone Soil | TVAAIEAFQSRSNISIDGLIEPGSQTWQALMQAAGAT* |
| Ga0137374_100312061 | 3300012204 | Vadose Zone Soil | QLDPKGVDGKIARPPAKSNTVAAIEALQSRSNISIDGLIEPGSQTWQALTQAAGGT* |
| Ga0137374_100318381 | 3300012204 | Vadose Zone Soil | QLDPKGVDGKIARPPAKSNTVAAIEALQSRSNISIDGLIERTSQTWQALLQAAGGT* |
| Ga0137381_103675132 | 3300012207 | Vadose Zone Soil | GKIARPPATSNTVAAIEAFQSRSNISIDGLIERTSQTWQALLQAAGGT* |
| Ga0137381_103784391 | 3300012207 | Vadose Zone Soil | TSNTVAAIEAFQSRSNISIDGLIDPASQTWQALLQAAGGT* |
| Ga0137377_114316742 | 3300012211 | Vadose Zone Soil | KGVDGKIARPPATSNTVAAIEAFQSRSNISIDGLIEPGSQTWQALMQAAGAT* |
| Ga0137370_107495811 | 3300012285 | Vadose Zone Soil | LETAAQKLQAPDLDPKGVDGKIAHDSARSNTVAAIEAFQSLSNISITGLIEPGSQAWRALLQGAGET* |
| Ga0137387_100716734 | 3300012349 | Vadose Zone Soil | GKIARPPATSNTVAAIEAFQSRSNISIDGLIDPASQTWQALVQAAGGT* |
| Ga0137367_101072101 | 3300012353 | Vadose Zone Soil | GKSNTVAAIEAFQSRFNISIDGLIEPGSQTWQVLLQAADGT* |
| Ga0137366_104757381 | 3300012354 | Vadose Zone Soil | QLDPKGVDGKIARPPAKSNTVAAIEAFQSLSNISITGLIEPDSQAWRALLQGAGET* |
| Ga0137368_100498605 | 3300012358 | Vadose Zone Soil | PGKSNTVAAIEAFQSRFNISIDGLIEPGSQTWQVLLQAADGT* |
| Ga0150984_1071753211 | 3300012469 | Avena Fatua Rhizosphere | NTVNAIEAFQGRSNISVDGLIERDSQTWQALLQAAIGS* |
| Ga0137358_107510781 | 3300012582 | Vadose Zone Soil | KIARPPAKSNTVAAIEAFQSLSNISITGLIEPGSQAWRALLQGAGKT* |
| Ga0157283_103692711 | 3300012907 | Soil | KGVDGKIARPPRNSNTVNAIEAFQSRSSISIDGLIEPDSPTWLALLQAAGGS* |
| Ga0157301_104606031 | 3300012911 | Soil | PPRNSNTVNAIEAFQSRSNISVDGLIEPGSQTWLALLQAAGGS* |
| Ga0137394_107773102 | 3300012922 | Vadose Zone Soil | RPPRNSNTVNAIEAFQRRSNISIDGLIEPDSQTWRALVQAAGSS* |
| Ga0137413_106690591 | 3300012924 | Vadose Zone Soil | KLQAPQLDPKGVDGKIARPPAKSNTVAAIEAFQSLSNISITGLIEPDSQAWRALLQGAGET* |
| Ga0137419_103430912 | 3300012925 | Vadose Zone Soil | NTVAAIEAFQSRSNIPITGLIEPGSQTWQALLQGASET* |
| Ga0137404_106707791 | 3300012929 | Vadose Zone Soil | AKSNTVAAIEAFQSRSNISIDGLIEPDSQTWQALLQAAGGT* |
| Ga0162652_1000299482 | 3300012941 | Soil | PKGVDGKIARQSAKSSTVVAIEAFQSRSNISITGLIEPGSQALQALLQGAGET* |
| Ga0134077_102208802 | 3300012972 | Grasslands Soil | GKIAQVSAKSNTVAAIEAFQSRSNISIDGLIEPDSQTWQALIQAAGGT* |
| Ga0134110_104763621 | 3300012975 | Grasslands Soil | PELDPKGVDGKIARPPAKSNTVAAIEAFQSLSNISITGLIEPDSQAWRALLQGAGET* |
| Ga0164308_111620781 | 3300012985 | Soil | VAAIEAFQSRSNISIDGLIEPGSQAWQALLQAAGGV* |
| Ga0164307_106767661 | 3300012987 | Soil | DGKIARPPRNSNAVNAIDAFQSRSSISSDGLIEPDSPTWLALLQAAGGS* |
| Ga0164307_107581611 | 3300012987 | Soil | TVNAIEAFQSRSNISIDGLIEPDSQTWQALLQAAGGS* |
| Ga0164306_116442541 | 3300012988 | Soil | TVAAIEAFQSRSNISIDGLIEPGSQAWQALLQAAGGV* |
| Ga0157374_101175004 | 3300013296 | Miscanthus Rhizosphere | VDGKIARLPGKSNTVAAIEAFQSRSNISITGLIEPGSQAWQALLQGAGET* |
| Ga0134081_101146811 | 3300014150 | Grasslands Soil | TVAAIEAFQSRSNISIDGLIDPASQTWQALLQAAGGS* |
| Ga0134075_105844012 | 3300014154 | Grasslands Soil | VAAIEAFQSRSNISIDGLIEPTSQTWQALLQAAGGT* |
| Ga0163163_110633481 | 3300014325 | Switchgrass Rhizosphere | AAIEAFQSRSSIPITGLIEPDSQAWQALLQAAGGS* |
| Ga0137405_11932154 | 3300015053 | Vadose Zone Soil | IARPPATSNTVAAIEAFQSRSNTSIDGLIEPDSQTWQELMQAAGGT* |
| Ga0137412_102784422 | 3300015242 | Vadose Zone Soil | TVNAIEAFQSRSNISIDGLMEPDSQTWRALVQAAGGS* |
| Ga0137409_104512931 | 3300015245 | Vadose Zone Soil | KIARPPRNSNTVNAIEAFQSRSNISIDGLIEPDSQTWRALVQAAGGS* |
| Ga0132255_1034260641 | 3300015374 | Arabidopsis Rhizosphere | IARPPGKSNTVAAIEAFQSRSNISIDGLIEPESETWRALLQAAGGS* |
| Ga0134083_102523671 | 3300017659 | Grasslands Soil | TVAAIEAFQSRSNISIDGLIDPASQTWQALLQAAGGT |
| Ga0184620_100207391 | 3300018051 | Groundwater Sediment | LIARPPRKSNTVAAIEAFQSRANISIDGVIEPGSQTWQALLQAAGGS |
| Ga0184621_102917081 | 3300018054 | Groundwater Sediment | APQLDPKSIDGKIARPPRNSNTVAAIEAFQSRSNISITGLIEPGSQAWQALLQGAGET |
| Ga0184619_101287472 | 3300018061 | Groundwater Sediment | LQAPELDPKGVDGKIGRQSAKSNTVAAIEAFQNRSNISITGLIEPDSQTLQALLEGAGET |
| Ga0184635_101584501 | 3300018072 | Groundwater Sediment | RPPRNSNTVNAIEAFQSRSNISIDGLIEPDSQTWQGLLQAAGGS |
| Ga0193744_11004331 | 3300019874 | Soil | GKIARPPRNSNTVAAIEAFQSRSNISITGLIEPDSQAWQALLQGAGEA |
| Ga0193707_11417722 | 3300019881 | Soil | QAPQLDPKGVDGKIAQPPRNSNTVAAIEAFQSRSNISIDGLIEPESQTLQALLQAAGGS |
| Ga0193747_10031487 | 3300019885 | Soil | NTVGAIEAFQSRSNISIDGLIEPASQTWQALLQAVGGT |
| Ga0193718_10171961 | 3300019999 | Soil | PKGVDGKIARPPVTSNTVAAIEAFQSRSNISIDGLTEPDSQTWQALIQAAGGT |
| Ga0193755_11263891 | 3300020004 | Soil | NTVAVIEAFQSRSNISIDGLIEPGSQTWQALLQAAGGT |
| Ga0179592_100627651 | 3300020199 | Vadose Zone Soil | AAIEAFQSRSNISITGLIEPDSQTWQALLQGAGET |
| Ga0193750_10429491 | 3300021413 | Soil | PPATSNTVAAIEAFQSRSNISIDGLIDPASQTWQALVQAAAGT |
| Ga0126371_114635862 | 3300021560 | Tropical Forest Soil | TVNAIEAFQSRSNISVDGLIEPDSQTWQTLLQAAGGS |
| Ga0207643_110597092 | 3300025908 | Miscanthus Rhizosphere | KGVDGKIARPPRNSNTVNAIEAFQSRLNISIDGLIEPDSQTWVALLQAASGS |
| Ga0207701_107538481 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAIEAFQSRSNISIDGLIEPGSQAWQALLQAANGS |
| Ga0207701_112643791 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAIEAFQSRSNISIDGLIEPGSQAWQALLQAADGS |
| Ga0207706_116337231 | 3300025933 | Corn Rhizosphere | STVKAIEAFQSSSSHPIDGLIEPGDQTWNALLQAAG |
| Ga0207661_109140121 | 3300025944 | Corn Rhizosphere | KGVDGKIARPPRNSNTVNAIEAFQSRSSISIDGLIEPDSPTWLALLQAAGGS |
| Ga0207679_120168111 | 3300025945 | Corn Rhizosphere | KGVDGKIARLPGKSNTVAAIEAFQSRSNISITGLIEPGSQAWQALLQGAGET |
| Ga0207712_113250051 | 3300025961 | Switchgrass Rhizosphere | SNTVAAIEAFQSRSNISIDGLIEPGSQAWQALLQAANGS |
| Ga0207658_104813592 | 3300025986 | Switchgrass Rhizosphere | PPRNSNTVAAIEAFQSRSNISIDGLIEPGSQAWQALLQAADGS |
| Ga0207678_106148501 | 3300026067 | Corn Rhizosphere | NSNTVNAIEAFQSRSNISIDGLIEPDSQTWQALLQAAGGS |
| Ga0207641_115607762 | 3300026088 | Switchgrass Rhizosphere | SNTVNAIEAFQSRSSISIDGLIEPDSPTWLALLQAAGGS |
| Ga0209155_11002921 | 3300026316 | Soil | QAPHLDPKGVDGKIARPPAKSNTVAAIEAFQSLSNISITGLIEPDSQAWRALLQGAGKT |
| Ga0209804_11969082 | 3300026335 | Soil | NTVAAIEAFQSLSNISITGLIEPDSQAWRALLQGAGET |
| Ga0209058_12373972 | 3300026536 | Soil | DGKIARPPATSNTVAAIEAFQSRSNISIDGLIDPASQTWQALLQAAGGS |
| Ga0209998_101265541 | 3300027717 | Arabidopsis Thaliana Rhizosphere | KSNTVAAIEAFQSRFNISIGGLIEPGSQTWQALLQAAGSN |
| Ga0307282_103500901 | 3300028784 | Soil | AAIEAFQGRSNISIDGLIEPGSQTWQALMQAAGGT |
| Ga0307277_102496711 | 3300028881 | Soil | IARLPGKSNTVAAIEAFQSRSNISITGLIEPGSQAWQALLQAAGET |
| Ga0170834_1050551011 | 3300031057 | Forest Soil | TSNTVAAIEAFQGRYTSSVDGLIKPDSQTWQALLQAAGGS |
| Ga0170822_123663722 | 3300031122 | Forest Soil | SNTVAAIEAFQSCSNISIDGLIDPASQTWQALLQAAGGT |
| Ga0170820_178408601 | 3300031446 | Forest Soil | IARQSAKSNTVAAIEAFQSRSNISITGLIEPDSQAWQTLLQGAGET |
| Ga0318533_111341561 | 3300032059 | Soil | SNTVAAIEAFQSRSNISISGLIEPESRTWQALLEAAGGS |
| ⦗Top⦘ |