| Basic Information | |
|---|---|
| Family ID | F086857 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSIIIRVVFIAACAYAGSVFAGIQFPDLPDPYQMAQK |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.47 % |
| % of genes near scaffold ends (potentially truncated) | 18.18 % |
| % of genes from short scaffolds (< 2000 bps) | 60.91 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (33.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.08% β-sheet: 0.00% Coil/Unstructured: 56.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF07369 | DUF1488 | 9.09 |
| PF00583 | Acetyltransf_1 | 3.64 |
| PF03734 | YkuD | 0.91 |
| PF00216 | Bac_DNA_binding | 0.91 |
| PF16518 | GrlR | 0.91 |
| PF07311 | Dodecin | 0.91 |
| PF13683 | rve_3 | 0.91 |
| PF13751 | DDE_Tnp_1_6 | 0.91 |
| PF13560 | HTH_31 | 0.91 |
| PF13546 | DDE_5 | 0.91 |
| PF00580 | UvrD-helicase | 0.91 |
| PF13551 | HTH_29 | 0.91 |
| PF09361 | Phasin_2 | 0.91 |
| PF02673 | BacA | 0.91 |
| PF00115 | COX1 | 0.91 |
| PF00872 | Transposase_mut | 0.91 |
| PF11175 | DUF2961 | 0.91 |
| PF05899 | Cupin_3 | 0.91 |
| PF01243 | Putative_PNPOx | 0.91 |
| PF07506 | RepB | 0.91 |
| PF05717 | TnpB_IS66 | 0.91 |
| PF11752 | DUF3309 | 0.91 |
| PF04851 | ResIII | 0.91 |
| PF04392 | ABC_sub_bind | 0.91 |
| PF13481 | AAA_25 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.91 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.91 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.91 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1475 | Chromosome segregation protein Spo0J, contains ParB-like nuclease domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.91 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.91 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.91 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.91 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.91 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.91 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.18 % |
| Unclassified | root | N/A | 21.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig39990 | Not Available | 852 | Open in IMG/M |
| 3300001545|JGI12630J15595_10008712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2189 | Open in IMG/M |
| 3300001545|JGI12630J15595_10039953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 952 | Open in IMG/M |
| 3300001593|JGI12635J15846_10169981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1473 | Open in IMG/M |
| 3300001661|JGI12053J15887_10006565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6194 | Open in IMG/M |
| 3300001661|JGI12053J15887_10015110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4279 | Open in IMG/M |
| 3300001661|JGI12053J15887_10071497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1920 | Open in IMG/M |
| 3300001661|JGI12053J15887_10081127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1785 | Open in IMG/M |
| 3300001661|JGI12053J15887_10107258 | Not Available | 1507 | Open in IMG/M |
| 3300001661|JGI12053J15887_10233333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 921 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100223179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1776 | Open in IMG/M |
| 3300004081|Ga0063454_100411603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 910 | Open in IMG/M |
| 3300005093|Ga0062594_100019440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2798 | Open in IMG/M |
| 3300005178|Ga0066688_10883143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300005451|Ga0066681_10455604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300005574|Ga0066694_10363737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300005602|Ga0070762_10012913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4234 | Open in IMG/M |
| 3300005602|Ga0070762_10694806 | Not Available | 682 | Open in IMG/M |
| 3300005947|Ga0066794_10070078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1042 | Open in IMG/M |
| 3300006041|Ga0075023_100202297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
| 3300006046|Ga0066652_101514595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 621 | Open in IMG/M |
| 3300006050|Ga0075028_100125687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1334 | Open in IMG/M |
| 3300006050|Ga0075028_100443847 | Not Available | 749 | Open in IMG/M |
| 3300006055|Ga0097691_1196272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 521 | Open in IMG/M |
| 3300006057|Ga0075026_100292095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 887 | Open in IMG/M |
| 3300006800|Ga0066660_10101821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2035 | Open in IMG/M |
| 3300006893|Ga0073928_10042578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4178 | Open in IMG/M |
| 3300007255|Ga0099791_10103718 | Not Available | 1310 | Open in IMG/M |
| 3300007258|Ga0099793_10359862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 712 | Open in IMG/M |
| 3300007265|Ga0099794_10034883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2373 | Open in IMG/M |
| 3300009088|Ga0099830_10004099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8117 | Open in IMG/M |
| 3300009143|Ga0099792_10711287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 651 | Open in IMG/M |
| 3300011269|Ga0137392_10005131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8212 | Open in IMG/M |
| 3300011269|Ga0137392_10050044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3139 | Open in IMG/M |
| 3300012205|Ga0137362_10091426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2551 | Open in IMG/M |
| 3300012582|Ga0137358_10217403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1303 | Open in IMG/M |
| 3300012685|Ga0137397_11319604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300012924|Ga0137413_10055463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2317 | Open in IMG/M |
| 3300012924|Ga0137413_10119118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1678 | Open in IMG/M |
| 3300012925|Ga0137419_10705678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 819 | Open in IMG/M |
| 3300012925|Ga0137419_11242493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
| 3300012927|Ga0137416_10246422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1458 | Open in IMG/M |
| 3300012927|Ga0137416_12243466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300012955|Ga0164298_10688424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300014489|Ga0182018_10587784 | Not Available | 585 | Open in IMG/M |
| 3300014495|Ga0182015_10248078 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300014501|Ga0182024_12052197 | Not Available | 631 | Open in IMG/M |
| 3300015241|Ga0137418_10102508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2573 | Open in IMG/M |
| 3300017946|Ga0187879_10044597 | All Organisms → cellular organisms → Bacteria | 2628 | Open in IMG/M |
| 3300018051|Ga0184620_10086787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 946 | Open in IMG/M |
| 3300019789|Ga0137408_1023107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6803 | Open in IMG/M |
| 3300019880|Ga0193712_1123102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300019889|Ga0193743_1112542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 998 | Open in IMG/M |
| 3300019889|Ga0193743_1217702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 589 | Open in IMG/M |
| 3300020001|Ga0193731_1130879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300020580|Ga0210403_10360818 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300021170|Ga0210400_10086245 | Not Available | 2473 | Open in IMG/M |
| 3300021170|Ga0210400_10239255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1482 | Open in IMG/M |
| 3300021171|Ga0210405_10263709 | Not Available | 1363 | Open in IMG/M |
| 3300021180|Ga0210396_10091437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2757 | Open in IMG/M |
| 3300021363|Ga0193699_10004378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5139 | Open in IMG/M |
| 3300021363|Ga0193699_10014872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2811 | Open in IMG/M |
| 3300021411|Ga0193709_1053662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 935 | Open in IMG/M |
| 3300021411|Ga0193709_1079810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 729 | Open in IMG/M |
| 3300021968|Ga0193698_1012512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
| 3300022557|Ga0212123_10042756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4320 | Open in IMG/M |
| 3300025484|Ga0208587_1017339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2354 | Open in IMG/M |
| 3300026551|Ga0209648_10213361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1461 | Open in IMG/M |
| 3300026551|Ga0209648_10479814 | Not Available | 741 | Open in IMG/M |
| 3300026555|Ga0179593_1255090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2951 | Open in IMG/M |
| 3300027181|Ga0208997_1011042 | Not Available | 1204 | Open in IMG/M |
| 3300027381|Ga0208983_1078573 | Not Available | 621 | Open in IMG/M |
| 3300027383|Ga0209213_1017877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1319 | Open in IMG/M |
| 3300027388|Ga0208995_1068872 | Not Available | 621 | Open in IMG/M |
| 3300027480|Ga0208993_1000601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5146 | Open in IMG/M |
| 3300027480|Ga0208993_1003884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2467 | Open in IMG/M |
| 3300027480|Ga0208993_1029841 | Not Available | 967 | Open in IMG/M |
| 3300027575|Ga0209525_1024324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1490 | Open in IMG/M |
| 3300027603|Ga0209331_1007280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 2949 | Open in IMG/M |
| 3300027645|Ga0209117_1000862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 11298 | Open in IMG/M |
| 3300027645|Ga0209117_1007051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3830 | Open in IMG/M |
| 3300027651|Ga0209217_1030083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1703 | Open in IMG/M |
| 3300027651|Ga0209217_1050208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1260 | Open in IMG/M |
| 3300027651|Ga0209217_1094038 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300027652|Ga0209007_1047269 | Not Available | 1094 | Open in IMG/M |
| 3300027663|Ga0208990_1087168 | Not Available | 881 | Open in IMG/M |
| 3300027671|Ga0209588_1016225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2296 | Open in IMG/M |
| 3300027678|Ga0209011_1016993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2380 | Open in IMG/M |
| 3300027727|Ga0209328_10002856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4952 | Open in IMG/M |
| 3300027862|Ga0209701_10302087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 919 | Open in IMG/M |
| 3300027884|Ga0209275_10019389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3025 | Open in IMG/M |
| 3300027897|Ga0209254_10045934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3834 | Open in IMG/M |
| 3300027903|Ga0209488_10187324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1561 | Open in IMG/M |
| 3300027908|Ga0209006_10025109 | All Organisms → cellular organisms → Bacteria | 5395 | Open in IMG/M |
| 3300027915|Ga0209069_10306300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 845 | Open in IMG/M |
| 3300028047|Ga0209526_10625966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 686 | Open in IMG/M |
| 3300028047|Ga0209526_10910084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 534 | Open in IMG/M |
| 3300028536|Ga0137415_10114980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2538 | Open in IMG/M |
| 3300030580|Ga0311355_10209457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2033 | Open in IMG/M |
| 3300030991|Ga0073994_12033511 | Not Available | 506 | Open in IMG/M |
| 3300030991|Ga0073994_12218031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 595 | Open in IMG/M |
| 3300030991|Ga0073994_12398065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1788 | Open in IMG/M |
| 3300031708|Ga0310686_104980314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1197 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 33.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.73% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.82% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.82% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.91% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021968 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_04351600 | 2124908032 | Soil | MSIIIRVVVVVMCAYAGSVVAGIQFPDLPDPYEMAQK |
| JGI12630J15595_100087124 | 3300001545 | Forest Soil | MSNIIRIVVIATCAYAGSVVGGAQFPDLPDPYSIAQK* |
| JGI12630J15595_100399533 | 3300001545 | Forest Soil | MSIIIRIVVVVTCAYAGLVVADIQSPDLPDPYETAQK* |
| JGI12635J15846_101271464 | 3300001593 | Forest Soil | PLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK* |
| JGI12635J15846_101699813 | 3300001593 | Forest Soil | MSIIIRIAIIAACAYAGSAIAGAQFLDLPDHHXIAQK* |
| JGI12053J15887_100065658 | 3300001661 | Forest Soil | MSIIIRVVVVVICAYAGSIVAGAQFADLPDPYQVAQK* |
| JGI12053J15887_100151103 | 3300001661 | Forest Soil | MSIIIRIVVIAACAYAGSAIAGAQFLDLPDHHQIAQK* |
| JGI12053J15887_100714973 | 3300001661 | Forest Soil | MSVFIRIVILAACAYAGSAVAGIQFQTLPDPSQMAQK* |
| JGI12053J15887_100811272 | 3300001661 | Forest Soil | MSIIIRIVIIAACAYAGSAIAGAQFRDLPEHHQIAQKLPI* |
| JGI12053J15887_101072584 | 3300001661 | Forest Soil | MSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQLA |
| JGI12053J15887_102183962 | 3300001661 | Forest Soil | MIILSPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDXPDPYQTAQK* |
| JGI12053J15887_102333331 | 3300001661 | Forest Soil | PMSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQLAQK* |
| JGIcombinedJ26739_1002231793 | 3300002245 | Forest Soil | MSIIIRIVVVVTCAYAGLVVADIQFPDLPDPYEMAQK* |
| JGIcombinedJ26739_1006535283 | 3300002245 | Forest Soil | SDNDYPCSPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK* |
| Ga0063454_1004116031 | 3300004081 | Soil | NKQEAAMFIIIRILVLATCAYAGSVFAGAQFPDLPDPYQMAQN* |
| Ga0062594_1000194405 | 3300005093 | Soil | MSIIIRLIIVVFCAYAGSVVAGAQFADLPADETFQDAQK* |
| Ga0066688_108831432 | 3300005178 | Soil | EAAMFIIIRVLIVATCAYAGSVCAGVQFPEIPDTYQMAQDQLK* |
| Ga0066681_104556042 | 3300005451 | Soil | MFIIIRVLVVATCAYAGSVCAGVQFPEIPDTYQMAQDQLK* |
| Ga0066694_103637371 | 3300005574 | Soil | KQGAAMFIILRVLVIATCAYAGSLFAGVQYPDLPDPYQIAQK* |
| Ga0070762_100129136 | 3300005602 | Soil | MSTIIRVLIVLVCAYAGSVVAGAQFSDIPDPYQTAQK* |
| Ga0070762_106948061 | 3300005602 | Soil | MSIIIRVVIIAFCAYAGSVVADNQFGELPSPGQLGQNQ* |
| Ga0066794_100700781 | 3300005947 | Soil | MSIIIRVVVVVMCAYAGSVVAGIQFPDLPDPYEMAQK* |
| Ga0075023_1002022973 | 3300006041 | Watersheds | MSIIIRVVVIALSAYAGSFVAGIQFPDSPDNYETAQK* |
| Ga0066652_1015145951 | 3300006046 | Soil | MSIIIRVVVVVLCAYAGSVVAGAQFMDLPDPYQATADHAP* |
| Ga0075028_1001256874 | 3300006050 | Watersheds | MSIIIRVVVVALSAYAGSFFAGLQFADLPDPYQMAQK* |
| Ga0075028_1004438472 | 3300006050 | Watersheds | MSIIIRIAVVAARTYAGSVAGIPDLPDPYQMAQK* |
| Ga0097691_11962723 | 3300006055 | Arctic Peat Soil | IIIRVVVFAACAYAGSVVAGIQFPDLPDPYQMAQK* |
| Ga0075026_1002920953 | 3300006057 | Watersheds | MSIIIRVVVVALSAYAGSFFAGIQFPDLPDNYETAQK* |
| Ga0066660_101018217 | 3300006800 | Soil | MFIITRVLVIATCAYAGSVFAGVQYPDLPDPYEIAQK* |
| Ga0073928_100425788 | 3300006893 | Iron-Sulfur Acid Spring | MSTIIRVFIVLVCAYAGSVVAGTQFSDIPDPYQTAQK* |
| Ga0099791_101037183 | 3300007255 | Vadose Zone Soil | MSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQLAQK* |
| Ga0099793_103598622 | 3300007258 | Vadose Zone Soil | MSIIIRIVIIAAGAYAGSSNAGAQFRDLPDHHQIAQK* |
| Ga0099794_100348834 | 3300007265 | Vadose Zone Soil | MSFIIRVAVLAACAYAGSIVAGIQFPDPPDPYQMAQK* |
| Ga0099830_1000409915 | 3300009088 | Vadose Zone Soil | MFFMFRVLVIAVCAYAGSIVAGIQFPNLPDPYQSAQR* |
| Ga0099792_107112872 | 3300009143 | Vadose Zone Soil | MSIIIRIAIIAACAYAGSAIAGAQFLDLPDHHQIAQK* |
| Ga0137392_100051311 | 3300011269 | Vadose Zone Soil | MFFMFRVLVIAVCAYAGSIAAGIQFPNLPDPYQSAQR* |
| Ga0137392_100500444 | 3300011269 | Vadose Zone Soil | MSIIIRIVALATCAYAGSVVAGIQFPDLPEPYQMTQK* |
| Ga0137362_100914263 | 3300012205 | Vadose Zone Soil | MSIIIRVAVLAACAYAGSIVAGVQFPDLADPYQMAQK* |
| Ga0137358_102174032 | 3300012582 | Vadose Zone Soil | MSIIIRVAVIAACAYAGSIVAGIQFPDLADPYQIAQK* |
| Ga0137397_113196042 | 3300012685 | Vadose Zone Soil | MSIIIRIVIIAACAYAGSAIAGAQFRDLPDHHQIAQK* |
| Ga0137413_100554631 | 3300012924 | Vadose Zone Soil | MSIFIRIVVVAACAYAGSAVAGIQFQTLPDPSQMAQK* |
| Ga0137413_101191182 | 3300012924 | Vadose Zone Soil | MSIIIRIVIIAACAYTGSAIAGAQFLDLPDHHQIAQK* |
| Ga0137419_103856403 | 3300012925 | Vadose Zone Soil | PYYPLANNKRQAMSIIIRVAVIAACAYAGSIVAGVQFPDLADPYQMAQK* |
| Ga0137419_107056783 | 3300012925 | Vadose Zone Soil | VQQTKRQAMSVFIRIVILAACAYAGSAVAGIQFQTLPDPYQMAQK* |
| Ga0137419_112424932 | 3300012925 | Vadose Zone Soil | MSIIIRIVVIAACAYAGSAIAGAQFLDLPDHHEIAQK* |
| Ga0137416_102464222 | 3300012927 | Vadose Zone Soil | MSIIIRIAIIAACAYAGSAIAGAQFLDLPDHHEIAQK* |
| Ga0137416_122434661 | 3300012927 | Vadose Zone Soil | TMSIIIRVAVLAARAYAGSIVGGVRFPDVADPYQMAQK* |
| Ga0164298_106884243 | 3300012955 | Soil | MSIIIRLIIVVFCAYAGSVVAGAQFADLPADETFQ |
| Ga0182018_105877841 | 3300014489 | Palsa | AMSTIIRVFIVLVCAYAGSVVAGAQFSDIPDPYQTGQK* |
| Ga0182015_102480784 | 3300014495 | Palsa | MSTIIRVFIVLVCAYAGSVVAGAQFSDIPDPYQTA |
| Ga0182024_120521971 | 3300014501 | Permafrost | MSTIIRVFIVLVCAYAGSVVAGAQFSDIPDPYQTAQK* |
| Ga0137418_101025082 | 3300015241 | Vadose Zone Soil | MSIIIRIAIIAACAYAGSAIAGAQFRDLPDHHQIAQK* |
| Ga0187879_100445971 | 3300017946 | Peatland | MSTIIRVFIVLVCAYAGSVVAGAQFSDIPDPYQTGQK |
| Ga0184620_100867872 | 3300018051 | Groundwater Sediment | MSIIIRLIIVVFCAYAGSVVAGAQFADLPADDPFQDAQK |
| Ga0137408_102310715 | 3300019789 | Vadose Zone Soil | MSFIIRVAVLVACAYAGSIVAGIQFPDPPDPYQMAQK |
| Ga0193712_11231022 | 3300019880 | Soil | MSIIIRIVIIAACAYAGSAIAGAQFRDLPDHHQFAQK |
| Ga0193743_11125421 | 3300019889 | Soil | MSIIRIIVLAACAYAGSAVATIQFPDLPDRYQMAQK |
| Ga0193743_12177021 | 3300019889 | Soil | MSIFIRIVVFAACAYAGSAVASIQFSDLPAPFQMAQK |
| Ga0193731_11308792 | 3300020001 | Soil | MSIIIRIVIIAACAYAGSAIAGAQFLDLPDHHQIAQK |
| Ga0210403_103608182 | 3300020580 | Soil | MSIIIIRVVVIATCAYAGLVVADIQFPDLPDPYQTAQK |
| Ga0210400_100862451 | 3300021170 | Soil | MSIIIRIVVVATCAYAGLVVADIQFPDLPDPYEMAQK |
| Ga0210400_102392554 | 3300021170 | Soil | MSIIIRVVVIAACAYAGLVVADIQFPDLPDPYQMAQK |
| Ga0210405_102637092 | 3300021171 | Soil | MSIIIRVVVVVMCAYAGSIVAGVQFPDLPDPYQLAQK |
| Ga0210396_100914374 | 3300021180 | Soil | MSIIIRIMVVAMCAFAGSAVAGIQFSELPDHDQVTLVR |
| Ga0193699_100043781 | 3300021363 | Soil | MSIIIRIAIIAACAYAGSAIAGAQFLDLPDHHEIAQK |
| Ga0193699_100148723 | 3300021363 | Soil | MSIIIRIVIIAACAYAVSAIAGAQFRDLPDHHQIAQK |
| Ga0193709_10536623 | 3300021411 | Soil | IMSIIIRIVIIAACAYAGSAIAGAQFRDLPDHHQIAQK |
| Ga0193709_10798103 | 3300021411 | Soil | MTIIIRIVILAACAYAGSAVAGIQFQTLPDPYQMAQK |
| Ga0193698_10125122 | 3300021968 | Soil | MSIIIRIVIIAACAYAGSAIAGAQFRDLPDHHQIAQK |
| Ga0212123_100427562 | 3300022557 | Iron-Sulfur Acid Spring | MSTIIRVFIVLVCAYAGSVVAGTQFSDIPDPYQTAQK |
| Ga0208587_10173395 | 3300025484 | Arctic Peat Soil | MSIIIRVVVVVMCAYAGSVVAGIQFPDLPDPYEMAEK |
| Ga0209648_102133612 | 3300026551 | Grasslands Soil | MSIIIRIVVVVTRAYAGLVVADIQFPDLPDPYEMAQK |
| Ga0209648_104798141 | 3300026551 | Grasslands Soil | MSIIIRIVVVATCAYAGLVVAGIQFPDLPDPYEMAQK |
| Ga0179593_12550904 | 3300026555 | Vadose Zone Soil | MSIIIRVAVIAACAYAGSIVAGIQFPDLADPYQIAQK |
| Ga0208997_10014153 | 3300027181 | Forest Soil | MIILSPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDIPDPYQTAQK |
| Ga0208997_10110424 | 3300027181 | Forest Soil | MSIIIRVVVVVICAYAGSIVAGAQFADLPDPYQVAQK |
| Ga0208983_10785731 | 3300027381 | Forest Soil | MSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQLAQK |
| Ga0209213_10178772 | 3300027383 | Forest Soil | MSIIIRIVIIAACAYAGSAIAGAQFRDLPEHHQIAQKLPI |
| Ga0208995_10688722 | 3300027388 | Forest Soil | MSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQVAQK |
| Ga0208993_10006014 | 3300027480 | Forest Soil | MSIIIRVVGVVICAYAGSIVAGAQFADLPDPYQVAQK |
| Ga0208993_10038843 | 3300027480 | Forest Soil | MSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK |
| Ga0208993_10298412 | 3300027480 | Forest Soil | MSIIIRIVVIAACAYAGSAIAGAQFLDLPDHHQIAQK |
| Ga0209525_10243243 | 3300027575 | Forest Soil | MSIIIRVVIVAFCAYAGSVVADNQFSELPSPGQLGQNQ |
| Ga0209331_10072802 | 3300027603 | Forest Soil | MSIIIRIVVVTCAYAGLVVADIQFPDLPDPYEMAQK |
| Ga0208988_10123946 | 3300027633 | Forest Soil | MIILSPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK |
| Ga0209117_10008625 | 3300027645 | Forest Soil | MSIIIRVVVVVACAYAGSVVGSIQSPDLPDPYQMAQK |
| Ga0209117_10070516 | 3300027645 | Forest Soil | MSIIIRVVFIAACAYAGSVFAGIQFPDLPDPYQMAQK |
| Ga0209217_10300833 | 3300027651 | Forest Soil | MSIIIRVAVLAACAYAGSIVAGVQFPDLADPYQMAQK |
| Ga0209217_10502083 | 3300027651 | Forest Soil | RLSNKQERAMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK |
| Ga0209217_10940382 | 3300027651 | Forest Soil | MSIIIRVFVVAACAYAGSVFAGIQFPDLPDPHEMAQK |
| Ga0209007_10472691 | 3300027652 | Forest Soil | KRGSMSTIIRVLIVLVCAYAGSVVAGAQFSDIPDPYQTAQK |
| Ga0208990_10871683 | 3300027663 | Forest Soil | MSIIRIIVLAACAYAGSAVATIQFPDLPDPYQMAQKE |
| Ga0209588_10162254 | 3300027671 | Vadose Zone Soil | MSFIIRVAVLAACAYAGSIVAGIQFPDPPDPYQMAQK |
| Ga0209011_10169934 | 3300027678 | Forest Soil | MSIIIRIAIIAACAYAGSAIAGAQFLDLSDPHQIAQK |
| Ga0208991_10276495 | 3300027681 | Forest Soil | MIILSPLFNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDIPDPYQTAQK |
| Ga0209328_100028566 | 3300027727 | Forest Soil | MSNIIRIVVIATCAYAGSVVGGAQFPDLPDPYSIAQK |
| Ga0209701_103020871 | 3300027862 | Vadose Zone Soil | KRQQMFFIFRVLVIAVCAYAGSIVAGIQFPNLPDPYQSAQR |
| Ga0209275_100193892 | 3300027884 | Soil | MSTIIRVLIVLVCAYAGSVVAGAQFSDIPDPYQTAQK |
| Ga0209254_100459344 | 3300027897 | Freshwater Lake Sediment | MSITIRVVVIALSAYAGSFLAGIQFADQPDPYQMAQK |
| Ga0209488_101873241 | 3300027903 | Vadose Zone Soil | MSIIIRVAVIAACAYAGSIVAGVQFPDLADPYQMAQK |
| Ga0209006_100251098 | 3300027908 | Forest Soil | MSTIIRVLIVLVCAYAGSVVAGDQFSDIPDPYQTVQK |
| Ga0209069_103063003 | 3300027915 | Watersheds | MSIIIRVVVIALSAYAGSFVAGIQFPDSPDNYETAQK |
| Ga0209526_106259663 | 3300028047 | Forest Soil | IIIRVVVIATSAYAGLVAADIQFPNLPDPYQMAQK |
| Ga0209526_109100842 | 3300028047 | Forest Soil | RKRQQMSIIIRVLVIVMSAYAGSAFASIQFPDLPDPYQVAEK |
| Ga0137415_101149802 | 3300028536 | Vadose Zone Soil | MSIIIRIVVIAACAYAGSAIAGAQFLDLPDHHEIAQK |
| Ga0311355_102094573 | 3300030580 | Palsa | MSTIIRILIVLVCAYAGSVVAGAQFSEIPESYQAAQK |
| Ga0073994_120335112 | 3300030991 | Soil | MSVFIRIVILAACAYAGSAVAGIQFQTLPDPYQMAQK |
| Ga0073994_122180312 | 3300030991 | Soil | MSIIIRIVVIAACAYAGSAIAGAQFLDLPAHQQIAQK |
| Ga0073994_123980653 | 3300030991 | Soil | MSIIIRIVVVVTCAYAGLVVADIQSPDLPDPYETAQK |
| Ga0310686_1049803142 | 3300031708 | Soil | MEGGTMSIIIRVVIVAFCAYAGSVVADNQFSELPSPGQLGQNQ |
| ⦗Top⦘ |