NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086857

Metagenome / Metatranscriptome Family F086857

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086857
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 38 residues
Representative Sequence MSIIIRVVFIAACAYAGSVFAGIQFPDLPDPYQMAQK
Number of Associated Samples 80
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.47 %
% of genes near scaffold ends (potentially truncated) 18.18 %
% of genes from short scaffolds (< 2000 bps) 60.91 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.182 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil
(33.636 % of family members)
Environment Ontology (ENVO) Unclassified
(27.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.182 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 43.08%    β-sheet: 0.00%    Coil/Unstructured: 56.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF07369DUF1488 9.09
PF00583Acetyltransf_1 3.64
PF03734YkuD 0.91
PF00216Bac_DNA_binding 0.91
PF16518GrlR 0.91
PF07311Dodecin 0.91
PF13683rve_3 0.91
PF13751DDE_Tnp_1_6 0.91
PF13560HTH_31 0.91
PF13546DDE_5 0.91
PF00580UvrD-helicase 0.91
PF13551HTH_29 0.91
PF09361Phasin_2 0.91
PF02673BacA 0.91
PF00115COX1 0.91
PF00872Transposase_mut 0.91
PF11175DUF2961 0.91
PF05899Cupin_3 0.91
PF01243Putative_PNPOx 0.91
PF07506RepB 0.91
PF05717TnpB_IS66 0.91
PF11752DUF3309 0.91
PF04851ResIII 0.91
PF04392ABC_sub_bind 0.91
PF13481AAA_25 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.91
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.91
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.91
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.91
COG1475Chromosome segregation protein Spo0J, contains ParB-like nuclease domainCell cycle control, cell division, chromosome partitioning [D] 0.91
COG1968Undecaprenyl pyrophosphate phosphataseLipid transport and metabolism [I] 0.91
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.91
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.91
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.91
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 0.91
COG3436TransposaseMobilome: prophages, transposons [X] 0.91
COG3973DNA helicase IVReplication, recombination and repair [L] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.18 %
UnclassifiedrootN/A21.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig39990Not Available852Open in IMG/M
3300001545|JGI12630J15595_10008712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2189Open in IMG/M
3300001545|JGI12630J15595_10039953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria952Open in IMG/M
3300001593|JGI12635J15846_10169981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1473Open in IMG/M
3300001661|JGI12053J15887_10006565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6194Open in IMG/M
3300001661|JGI12053J15887_10015110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4279Open in IMG/M
3300001661|JGI12053J15887_10071497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1920Open in IMG/M
3300001661|JGI12053J15887_10081127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1785Open in IMG/M
3300001661|JGI12053J15887_10107258Not Available1507Open in IMG/M
3300001661|JGI12053J15887_10233333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei921Open in IMG/M
3300002245|JGIcombinedJ26739_100223179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1776Open in IMG/M
3300004081|Ga0063454_100411603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales910Open in IMG/M
3300005093|Ga0062594_100019440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2798Open in IMG/M
3300005178|Ga0066688_10883143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300005451|Ga0066681_10455604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria786Open in IMG/M
3300005574|Ga0066694_10363737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria684Open in IMG/M
3300005602|Ga0070762_10012913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4234Open in IMG/M
3300005602|Ga0070762_10694806Not Available682Open in IMG/M
3300005947|Ga0066794_10070078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1042Open in IMG/M
3300006041|Ga0075023_100202297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria767Open in IMG/M
3300006046|Ga0066652_101514595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium621Open in IMG/M
3300006050|Ga0075028_100125687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1334Open in IMG/M
3300006050|Ga0075028_100443847Not Available749Open in IMG/M
3300006055|Ga0097691_1196272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium521Open in IMG/M
3300006057|Ga0075026_100292095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria887Open in IMG/M
3300006800|Ga0066660_10101821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2035Open in IMG/M
3300006893|Ga0073928_10042578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4178Open in IMG/M
3300007255|Ga0099791_10103718Not Available1310Open in IMG/M
3300007258|Ga0099793_10359862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium712Open in IMG/M
3300007265|Ga0099794_10034883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2373Open in IMG/M
3300009088|Ga0099830_10004099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium8117Open in IMG/M
3300009143|Ga0099792_10711287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium651Open in IMG/M
3300011269|Ga0137392_10005131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium8212Open in IMG/M
3300011269|Ga0137392_10050044All Organisms → cellular organisms → Bacteria → Proteobacteria3139Open in IMG/M
3300012205|Ga0137362_10091426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2551Open in IMG/M
3300012582|Ga0137358_10217403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1303Open in IMG/M
3300012685|Ga0137397_11319604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300012924|Ga0137413_10055463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2317Open in IMG/M
3300012924|Ga0137413_10119118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1678Open in IMG/M
3300012925|Ga0137419_10705678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei819Open in IMG/M
3300012925|Ga0137419_11242493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria625Open in IMG/M
3300012927|Ga0137416_10246422All Organisms → cellular organisms → Bacteria → Proteobacteria1458Open in IMG/M
3300012927|Ga0137416_12243466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300012955|Ga0164298_10688424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria715Open in IMG/M
3300014489|Ga0182018_10587784Not Available585Open in IMG/M
3300014495|Ga0182015_10248078All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300014501|Ga0182024_12052197Not Available631Open in IMG/M
3300015241|Ga0137418_10102508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2573Open in IMG/M
3300017946|Ga0187879_10044597All Organisms → cellular organisms → Bacteria2628Open in IMG/M
3300018051|Ga0184620_10086787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium946Open in IMG/M
3300019789|Ga0137408_1023107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae6803Open in IMG/M
3300019880|Ga0193712_1123102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300019889|Ga0193743_1112542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae998Open in IMG/M
3300019889|Ga0193743_1217702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense589Open in IMG/M
3300020001|Ga0193731_1130879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria631Open in IMG/M
3300020580|Ga0210403_10360818All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300021170|Ga0210400_10086245Not Available2473Open in IMG/M
3300021170|Ga0210400_10239255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1482Open in IMG/M
3300021171|Ga0210405_10263709Not Available1363Open in IMG/M
3300021180|Ga0210396_10091437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2757Open in IMG/M
3300021363|Ga0193699_10004378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5139Open in IMG/M
3300021363|Ga0193699_10014872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2811Open in IMG/M
3300021411|Ga0193709_1053662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium935Open in IMG/M
3300021411|Ga0193709_1079810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei729Open in IMG/M
3300021968|Ga0193698_1012512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1081Open in IMG/M
3300022557|Ga0212123_10042756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4320Open in IMG/M
3300025484|Ga0208587_1017339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2354Open in IMG/M
3300026551|Ga0209648_10213361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1461Open in IMG/M
3300026551|Ga0209648_10479814Not Available741Open in IMG/M
3300026555|Ga0179593_1255090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2951Open in IMG/M
3300027181|Ga0208997_1011042Not Available1204Open in IMG/M
3300027381|Ga0208983_1078573Not Available621Open in IMG/M
3300027383|Ga0209213_1017877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1319Open in IMG/M
3300027388|Ga0208995_1068872Not Available621Open in IMG/M
3300027480|Ga0208993_1000601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5146Open in IMG/M
3300027480|Ga0208993_1003884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2467Open in IMG/M
3300027480|Ga0208993_1029841Not Available967Open in IMG/M
3300027575|Ga0209525_1024324All Organisms → cellular organisms → Bacteria → Proteobacteria1490Open in IMG/M
3300027603|Ga0209331_1007280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00692949Open in IMG/M
3300027645|Ga0209117_1000862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium11298Open in IMG/M
3300027645|Ga0209117_1007051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3830Open in IMG/M
3300027651|Ga0209217_1030083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1703Open in IMG/M
3300027651|Ga0209217_1050208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1260Open in IMG/M
3300027651|Ga0209217_1094038All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300027652|Ga0209007_1047269Not Available1094Open in IMG/M
3300027663|Ga0208990_1087168Not Available881Open in IMG/M
3300027671|Ga0209588_1016225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2296Open in IMG/M
3300027678|Ga0209011_1016993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2380Open in IMG/M
3300027727|Ga0209328_10002856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4952Open in IMG/M
3300027862|Ga0209701_10302087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium919Open in IMG/M
3300027884|Ga0209275_10019389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3025Open in IMG/M
3300027897|Ga0209254_10045934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3834Open in IMG/M
3300027903|Ga0209488_10187324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1561Open in IMG/M
3300027908|Ga0209006_10025109All Organisms → cellular organisms → Bacteria5395Open in IMG/M
3300027915|Ga0209069_10306300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.845Open in IMG/M
3300028047|Ga0209526_10625966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens686Open in IMG/M
3300028047|Ga0209526_10910084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia534Open in IMG/M
3300028536|Ga0137415_10114980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2538Open in IMG/M
3300030580|Ga0311355_10209457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2033Open in IMG/M
3300030991|Ga0073994_12033511Not Available506Open in IMG/M
3300030991|Ga0073994_12218031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium595Open in IMG/M
3300030991|Ga0073994_12398065All Organisms → cellular organisms → Bacteria → Proteobacteria1788Open in IMG/M
3300031708|Ga0310686_104980314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1197Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil33.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.27%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.73%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.82%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.82%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.91%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.91%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025484Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027388Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_043516002124908032SoilMSIIIRVVVVVMCAYAGSVVAGIQFPDLPDPYEMAQK
JGI12630J15595_1000871243300001545Forest SoilMSNIIRIVVIATCAYAGSVVGGAQFPDLPDPYSIAQK*
JGI12630J15595_1003995333300001545Forest SoilMSIIIRIVVVVTCAYAGLVVADIQSPDLPDPYETAQK*
JGI12635J15846_1012714643300001593Forest SoilPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK*
JGI12635J15846_1016998133300001593Forest SoilMSIIIRIAIIAACAYAGSAIAGAQFLDLPDHHXIAQK*
JGI12053J15887_1000656583300001661Forest SoilMSIIIRVVVVVICAYAGSIVAGAQFADLPDPYQVAQK*
JGI12053J15887_1001511033300001661Forest SoilMSIIIRIVVIAACAYAGSAIAGAQFLDLPDHHQIAQK*
JGI12053J15887_1007149733300001661Forest SoilMSVFIRIVILAACAYAGSAVAGIQFQTLPDPSQMAQK*
JGI12053J15887_1008112723300001661Forest SoilMSIIIRIVIIAACAYAGSAIAGAQFRDLPEHHQIAQKLPI*
JGI12053J15887_1010725843300001661Forest SoilMSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQLA
JGI12053J15887_1021839623300001661Forest SoilMIILSPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDXPDPYQTAQK*
JGI12053J15887_1023333313300001661Forest SoilPMSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQLAQK*
JGIcombinedJ26739_10022317933300002245Forest SoilMSIIIRIVVVVTCAYAGLVVADIQFPDLPDPYEMAQK*
JGIcombinedJ26739_10065352833300002245Forest SoilSDNDYPCSPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK*
Ga0063454_10041160313300004081SoilNKQEAAMFIIIRILVLATCAYAGSVFAGAQFPDLPDPYQMAQN*
Ga0062594_10001944053300005093SoilMSIIIRLIIVVFCAYAGSVVAGAQFADLPADETFQDAQK*
Ga0066688_1088314323300005178SoilEAAMFIIIRVLIVATCAYAGSVCAGVQFPEIPDTYQMAQDQLK*
Ga0066681_1045560423300005451SoilMFIIIRVLVVATCAYAGSVCAGVQFPEIPDTYQMAQDQLK*
Ga0066694_1036373713300005574SoilKQGAAMFIILRVLVIATCAYAGSLFAGVQYPDLPDPYQIAQK*
Ga0070762_1001291363300005602SoilMSTIIRVLIVLVCAYAGSVVAGAQFSDIPDPYQTAQK*
Ga0070762_1069480613300005602SoilMSIIIRVVIIAFCAYAGSVVADNQFGELPSPGQLGQNQ*
Ga0066794_1007007813300005947SoilMSIIIRVVVVVMCAYAGSVVAGIQFPDLPDPYEMAQK*
Ga0075023_10020229733300006041WatershedsMSIIIRVVVIALSAYAGSFVAGIQFPDSPDNYETAQK*
Ga0066652_10151459513300006046SoilMSIIIRVVVVVLCAYAGSVVAGAQFMDLPDPYQATADHAP*
Ga0075028_10012568743300006050WatershedsMSIIIRVVVVALSAYAGSFFAGLQFADLPDPYQMAQK*
Ga0075028_10044384723300006050WatershedsMSIIIRIAVVAARTYAGSVAGIPDLPDPYQMAQK*
Ga0097691_119627233300006055Arctic Peat SoilIIIRVVVFAACAYAGSVVAGIQFPDLPDPYQMAQK*
Ga0075026_10029209533300006057WatershedsMSIIIRVVVVALSAYAGSFFAGIQFPDLPDNYETAQK*
Ga0066660_1010182173300006800SoilMFIITRVLVIATCAYAGSVFAGVQYPDLPDPYEIAQK*
Ga0073928_1004257883300006893Iron-Sulfur Acid SpringMSTIIRVFIVLVCAYAGSVVAGTQFSDIPDPYQTAQK*
Ga0099791_1010371833300007255Vadose Zone SoilMSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQLAQK*
Ga0099793_1035986223300007258Vadose Zone SoilMSIIIRIVIIAAGAYAGSSNAGAQFRDLPDHHQIAQK*
Ga0099794_1003488343300007265Vadose Zone SoilMSFIIRVAVLAACAYAGSIVAGIQFPDPPDPYQMAQK*
Ga0099830_10004099153300009088Vadose Zone SoilMFFMFRVLVIAVCAYAGSIVAGIQFPNLPDPYQSAQR*
Ga0099792_1071128723300009143Vadose Zone SoilMSIIIRIAIIAACAYAGSAIAGAQFLDLPDHHQIAQK*
Ga0137392_1000513113300011269Vadose Zone SoilMFFMFRVLVIAVCAYAGSIAAGIQFPNLPDPYQSAQR*
Ga0137392_1005004443300011269Vadose Zone SoilMSIIIRIVALATCAYAGSVVAGIQFPDLPEPYQMTQK*
Ga0137362_1009142633300012205Vadose Zone SoilMSIIIRVAVLAACAYAGSIVAGVQFPDLADPYQMAQK*
Ga0137358_1021740323300012582Vadose Zone SoilMSIIIRVAVIAACAYAGSIVAGIQFPDLADPYQIAQK*
Ga0137397_1131960423300012685Vadose Zone SoilMSIIIRIVIIAACAYAGSAIAGAQFRDLPDHHQIAQK*
Ga0137413_1005546313300012924Vadose Zone SoilMSIFIRIVVVAACAYAGSAVAGIQFQTLPDPSQMAQK*
Ga0137413_1011911823300012924Vadose Zone SoilMSIIIRIVIIAACAYTGSAIAGAQFLDLPDHHQIAQK*
Ga0137419_1038564033300012925Vadose Zone SoilPYYPLANNKRQAMSIIIRVAVIAACAYAGSIVAGVQFPDLADPYQMAQK*
Ga0137419_1070567833300012925Vadose Zone SoilVQQTKRQAMSVFIRIVILAACAYAGSAVAGIQFQTLPDPYQMAQK*
Ga0137419_1124249323300012925Vadose Zone SoilMSIIIRIVVIAACAYAGSAIAGAQFLDLPDHHEIAQK*
Ga0137416_1024642223300012927Vadose Zone SoilMSIIIRIAIIAACAYAGSAIAGAQFLDLPDHHEIAQK*
Ga0137416_1224346613300012927Vadose Zone SoilTMSIIIRVAVLAARAYAGSIVGGVRFPDVADPYQMAQK*
Ga0164298_1068842433300012955SoilMSIIIRLIIVVFCAYAGSVVAGAQFADLPADETFQ
Ga0182018_1058778413300014489PalsaAMSTIIRVFIVLVCAYAGSVVAGAQFSDIPDPYQTGQK*
Ga0182015_1024807843300014495PalsaMSTIIRVFIVLVCAYAGSVVAGAQFSDIPDPYQTA
Ga0182024_1205219713300014501PermafrostMSTIIRVFIVLVCAYAGSVVAGAQFSDIPDPYQTAQK*
Ga0137418_1010250823300015241Vadose Zone SoilMSIIIRIAIIAACAYAGSAIAGAQFRDLPDHHQIAQK*
Ga0187879_1004459713300017946PeatlandMSTIIRVFIVLVCAYAGSVVAGAQFSDIPDPYQTGQK
Ga0184620_1008678723300018051Groundwater SedimentMSIIIRLIIVVFCAYAGSVVAGAQFADLPADDPFQDAQK
Ga0137408_1023107153300019789Vadose Zone SoilMSFIIRVAVLVACAYAGSIVAGIQFPDPPDPYQMAQK
Ga0193712_112310223300019880SoilMSIIIRIVIIAACAYAGSAIAGAQFRDLPDHHQFAQK
Ga0193743_111254213300019889SoilMSIIRIIVLAACAYAGSAVATIQFPDLPDRYQMAQK
Ga0193743_121770213300019889SoilMSIFIRIVVFAACAYAGSAVASIQFSDLPAPFQMAQK
Ga0193731_113087923300020001SoilMSIIIRIVIIAACAYAGSAIAGAQFLDLPDHHQIAQK
Ga0210403_1036081823300020580SoilMSIIIIRVVVIATCAYAGLVVADIQFPDLPDPYQTAQK
Ga0210400_1008624513300021170SoilMSIIIRIVVVATCAYAGLVVADIQFPDLPDPYEMAQK
Ga0210400_1023925543300021170SoilMSIIIRVVVIAACAYAGLVVADIQFPDLPDPYQMAQK
Ga0210405_1026370923300021171SoilMSIIIRVVVVVMCAYAGSIVAGVQFPDLPDPYQLAQK
Ga0210396_1009143743300021180SoilMSIIIRIMVVAMCAFAGSAVAGIQFSELPDHDQVTLVR
Ga0193699_1000437813300021363SoilMSIIIRIAIIAACAYAGSAIAGAQFLDLPDHHEIAQK
Ga0193699_1001487233300021363SoilMSIIIRIVIIAACAYAVSAIAGAQFRDLPDHHQIAQK
Ga0193709_105366233300021411SoilIMSIIIRIVIIAACAYAGSAIAGAQFRDLPDHHQIAQK
Ga0193709_107981033300021411SoilMTIIIRIVILAACAYAGSAVAGIQFQTLPDPYQMAQK
Ga0193698_101251223300021968SoilMSIIIRIVIIAACAYAGSAIAGAQFRDLPDHHQIAQK
Ga0212123_1004275623300022557Iron-Sulfur Acid SpringMSTIIRVFIVLVCAYAGSVVAGTQFSDIPDPYQTAQK
Ga0208587_101733953300025484Arctic Peat SoilMSIIIRVVVVVMCAYAGSVVAGIQFPDLPDPYEMAEK
Ga0209648_1021336123300026551Grasslands SoilMSIIIRIVVVVTRAYAGLVVADIQFPDLPDPYEMAQK
Ga0209648_1047981413300026551Grasslands SoilMSIIIRIVVVATCAYAGLVVAGIQFPDLPDPYEMAQK
Ga0179593_125509043300026555Vadose Zone SoilMSIIIRVAVIAACAYAGSIVAGIQFPDLADPYQIAQK
Ga0208997_100141533300027181Forest SoilMIILSPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDIPDPYQTAQK
Ga0208997_101104243300027181Forest SoilMSIIIRVVVVVICAYAGSIVAGAQFADLPDPYQVAQK
Ga0208983_107857313300027381Forest SoilMSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQLAQK
Ga0209213_101787723300027383Forest SoilMSIIIRIVIIAACAYAGSAIAGAQFRDLPEHHQIAQKLPI
Ga0208995_106887223300027388Forest SoilMSIIIRVVVVVTCAYAGSAVAGAQFADLPDPYQVAQK
Ga0208993_100060143300027480Forest SoilMSIIIRVVGVVICAYAGSIVAGAQFADLPDPYQVAQK
Ga0208993_100388433300027480Forest SoilMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK
Ga0208993_102984123300027480Forest SoilMSIIIRIVVIAACAYAGSAIAGAQFLDLPDHHQIAQK
Ga0209525_102432433300027575Forest SoilMSIIIRVVIVAFCAYAGSVVADNQFSELPSPGQLGQNQ
Ga0209331_100728023300027603Forest SoilMSIIIRIVVVTCAYAGLVVADIQFPDLPDPYEMAQK
Ga0208988_101239463300027633Forest SoilMIILSPLSNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK
Ga0209117_100086253300027645Forest SoilMSIIIRVVVVVACAYAGSVVGSIQSPDLPDPYQMAQK
Ga0209117_100705163300027645Forest SoilMSIIIRVVFIAACAYAGSVFAGIQFPDLPDPYQMAQK
Ga0209217_103008333300027651Forest SoilMSIIIRVAVLAACAYAGSIVAGVQFPDLADPYQMAQK
Ga0209217_105020833300027651Forest SoilRLSNKQERAMSIIIRVVILATFAYAGSIVAGVQFPDLPDPYQTAQK
Ga0209217_109403823300027651Forest SoilMSIIIRVFVVAACAYAGSVFAGIQFPDLPDPHEMAQK
Ga0209007_104726913300027652Forest SoilKRGSMSTIIRVLIVLVCAYAGSVVAGAQFSDIPDPYQTAQK
Ga0208990_108716833300027663Forest SoilMSIIRIIVLAACAYAGSAVATIQFPDLPDPYQMAQKE
Ga0209588_101622543300027671Vadose Zone SoilMSFIIRVAVLAACAYAGSIVAGIQFPDPPDPYQMAQK
Ga0209011_101699343300027678Forest SoilMSIIIRIAIIAACAYAGSAIAGAQFLDLSDPHQIAQK
Ga0208991_102764953300027681Forest SoilMIILSPLFNKQETAMSIIIRVVILATFAYAGSIVAGVQFPDIPDPYQTAQK
Ga0209328_1000285663300027727Forest SoilMSNIIRIVVIATCAYAGSVVGGAQFPDLPDPYSIAQK
Ga0209701_1030208713300027862Vadose Zone SoilKRQQMFFIFRVLVIAVCAYAGSIVAGIQFPNLPDPYQSAQR
Ga0209275_1001938923300027884SoilMSTIIRVLIVLVCAYAGSVVAGAQFSDIPDPYQTAQK
Ga0209254_1004593443300027897Freshwater Lake SedimentMSITIRVVVIALSAYAGSFLAGIQFADQPDPYQMAQK
Ga0209488_1018732413300027903Vadose Zone SoilMSIIIRVAVIAACAYAGSIVAGVQFPDLADPYQMAQK
Ga0209006_1002510983300027908Forest SoilMSTIIRVLIVLVCAYAGSVVAGDQFSDIPDPYQTVQK
Ga0209069_1030630033300027915WatershedsMSIIIRVVVIALSAYAGSFVAGIQFPDSPDNYETAQK
Ga0209526_1062596633300028047Forest SoilIIIRVVVIATSAYAGLVAADIQFPNLPDPYQMAQK
Ga0209526_1091008423300028047Forest SoilRKRQQMSIIIRVLVIVMSAYAGSAFASIQFPDLPDPYQVAEK
Ga0137415_1011498023300028536Vadose Zone SoilMSIIIRIVVIAACAYAGSAIAGAQFLDLPDHHEIAQK
Ga0311355_1020945733300030580PalsaMSTIIRILIVLVCAYAGSVVAGAQFSEIPESYQAAQK
Ga0073994_1203351123300030991SoilMSVFIRIVILAACAYAGSAVAGIQFQTLPDPYQMAQK
Ga0073994_1221803123300030991SoilMSIIIRIVVIAACAYAGSAIAGAQFLDLPAHQQIAQK
Ga0073994_1239806533300030991SoilMSIIIRIVVVVTCAYAGLVVADIQSPDLPDPYETAQK
Ga0310686_10498031423300031708SoilMEGGTMSIIIRVVIVAFCAYAGSVVADNQFSELPSPGQLGQNQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.