Metagenome / Metatranscriptome Family F086855

Basic Information
Family ID	F086855
Family Type	Metagenome / Metatranscriptome
Number of Sequences	110
Average Sequence Length	40 residues
Representative Sequence	DDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR
Number of Associated Samples	105
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.82 %
% of genes near scaffold ends (potentially truncated)	97.27 %
% of genes from short scaffolds (< 2000 bps)	89.09 %
Associated GOLD sequencing projects	99
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.23

Most Common Taxonomy
Group	Bacteria (82.727 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.727 % of family members)
Environment Ontology (ENVO)	Unclassified (23.636 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (37.273 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 15.15% Coil/Unstructured: 84.85%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF03992	ABM	20.91
PF07969	Amidohydro_3	19.09
PF00296	Bac_luciferase	6.36
PF00106	adh_short	3.64
PF02900	LigB	3.64
PF13594	Obsolete Pfam Family	2.73
PF08843	AbiEii	1.82
PF13458	Peripla_BP_6	1.82
PF04909	Amidohydro_2	1.82
PF13378	MR_MLE_C	1.82
PF10041	DUF2277	1.82
PF00596	Aldolase_II	0.91
PF00378	ECH_1	0.91
PF02129	Peptidase_S15	0.91
PF03471	CorC_HlyC	0.91
PF13522	GATase_6	0.91
PF01408	GFO_IDH_MocA	0.91
PF02730	AFOR_N	0.91
PF08352	oligo_HPY	0.91
PF02746	MR_MLE_N	0.91
PF13419	HAD_2	0.91
PF02515	CoA_transf_3	0.91
PF00702	Hydrolase	0.91
PF03480	DctP	0.91
PF00903	Glyoxalase	0.91
PF05598	DUF772	0.91
PF00034	Cytochrom_C	0.91
PF00583	Acetyltransf_1	0.91
PF03364	Polyketide_cyc	0.91
PF14833	NAD_binding_11	0.91
PF05378	Hydant_A_N	0.91
PF13561	adh_short_C2	0.91
PF00496	SBP_bac_5	0.91
PF04255	DUF433	0.91
PF00550	PP-binding	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	6.36
COG0145	N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit	Amino acid transport and metabolism [E]	1.82
COG2253	Predicted nucleotidyltransferase component of viral defense system	Defense mechanisms [V]	1.82
COG4948	L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily	Cell wall/membrane/envelope biogenesis [M]	1.82
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.91
COG2414	Aldehyde:ferredoxin oxidoreductase	Energy production and conversion [C]	0.91
COG2442	Predicted antitoxin component of a toxin-antitoxin system, DUF433 family	Defense mechanisms [V]	0.91

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	83.64 %
Unclassified	root	N/A	16.36 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	83.64 %
Unclassified	root	N/A	16.36 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	82.73 %
Unclassified	root	N/A	16.36 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.91 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	28.18 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	16.36 %
Unclassified	root	N/A	16.36 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3.64 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.91 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	28.18 %
Unclassified	root	N/A	16.36 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11.82 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2.73 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.91 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.91 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.91 %
Deinococcus-Thermus	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	0.91 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	28.18 %
Unclassified	root	N/A	16.36 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	8.18 %
Deinococci	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci	0.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.91 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.91 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.91 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	22.73 %
Unclassified	root	N/A	16.36 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	8.18 %
Reyranellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae	0.91 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.91 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	0.91 %
Thermales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales	0.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	22.73 %
Unclassified	root	N/A	16.36 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	8.18 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.91 %
Reyranella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella	0.91 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	0.91 %
Thermaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae	0.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	22.73 %
Unclassified	root	N/A	16.36 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	8.18 %
unclassified Reyranella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella	0.91 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.91 %
Thermus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus	0.91 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	22.73 %
Unclassified	root	N/A	16.36 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	8.18 %
Reyranella sp. CPCC 100927	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927	0.91 %
Symbiodinium pilosum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum	0.91 %
Thermus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus	0.91 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100485992	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	522	Open in IMG/M
3300000443\|F12B_10233428	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	509	Open in IMG/M
3300002912\|JGI25386J43895_10154149	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300003987\|Ga0055471_10087229	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	900	Open in IMG/M
3300004024\|Ga0055436_10005687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2519	Open in IMG/M
3300004479\|Ga0062595_100801922	All Organisms → cellular organisms → Bacteria	776	Open in IMG/M
3300004479\|Ga0062595_101081662	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	699	Open in IMG/M
3300005175\|Ga0066673_10350532	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	862	Open in IMG/M
3300005440\|Ga0070705_101783665	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	522	Open in IMG/M
3300005471\|Ga0070698_100013991	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	8486	Open in IMG/M
3300005556\|Ga0066707_10544642	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	749	Open in IMG/M
3300005558\|Ga0066698_10902797	Not Available	565	Open in IMG/M
3300005560\|Ga0066670_10707941	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	610	Open in IMG/M
3300005586\|Ga0066691_10577857	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	669	Open in IMG/M
3300005713\|Ga0066905_100824231	Not Available	806	Open in IMG/M
3300005829\|Ga0074479_10710805	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	594	Open in IMG/M
3300005844\|Ga0068862_100331166	All Organisms → cellular organisms → Bacteria	1408	Open in IMG/M
3300006034\|Ga0066656_10793504	Not Available	607	Open in IMG/M
3300006050\|Ga0075028_100745059	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	593	Open in IMG/M
3300006800\|Ga0066660_11023756	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
3300006806\|Ga0079220_10307403	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	983	Open in IMG/M
3300006845\|Ga0075421_101033655	All Organisms → cellular organisms → Bacteria	928	Open in IMG/M
3300006846\|Ga0075430_100716014	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	825	Open in IMG/M
3300006904\|Ga0075424_102420267	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	551	Open in IMG/M
3300007258\|Ga0099793_10655099	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300009038\|Ga0099829_10701987	Not Available	840	Open in IMG/M
3300009088\|Ga0099830_10246946	All Organisms → cellular organisms → Bacteria	1411	Open in IMG/M
3300009137\|Ga0066709_103105048	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300009147\|Ga0114129_10600341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1426	Open in IMG/M
3300009177\|Ga0105248_10085486	All Organisms → cellular organisms → Bacteria	3549	Open in IMG/M
3300009799\|Ga0105075_1042944	Not Available	560	Open in IMG/M
3300009806\|Ga0105081_1012351	Not Available	962	Open in IMG/M
3300010047\|Ga0126382_10597999	Not Available	907	Open in IMG/M
3300010303\|Ga0134082_10170973	All Organisms → cellular organisms → Bacteria	883	Open in IMG/M
3300010321\|Ga0134067_10178066	Not Available	771	Open in IMG/M
3300010336\|Ga0134071_10697632	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300010359\|Ga0126376_13101835	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300010360\|Ga0126372_11642253	Not Available	682	Open in IMG/M
3300010362\|Ga0126377_10164823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2095	Open in IMG/M
3300010391\|Ga0136847_10141768	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1456	Open in IMG/M
3300011270\|Ga0137391_11395281	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300012205\|Ga0137362_11271493	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	621	Open in IMG/M
3300012207\|Ga0137381_10564512	Not Available	992	Open in IMG/M
3300012353\|Ga0137367_10158150	All Organisms → cellular organisms → Bacteria	1651	Open in IMG/M
3300012355\|Ga0137369_10252912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1331	Open in IMG/M
3300012685\|Ga0137397_10277785	All Organisms → cellular organisms → Bacteria	1248	Open in IMG/M
3300012923\|Ga0137359_10316040	All Organisms → cellular organisms → Bacteria	1390	Open in IMG/M
3300012944\|Ga0137410_11657047	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300012948\|Ga0126375_10210878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1284	Open in IMG/M
3300012971\|Ga0126369_10523052	Not Available	1247	Open in IMG/M
3300014154\|Ga0134075_10112816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1152	Open in IMG/M
3300014262\|Ga0075301_1182565	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	505	Open in IMG/M
3300015052\|Ga0137411_1025146	All Organisms → cellular organisms → Bacteria	1634	Open in IMG/M
3300015356\|Ga0134073_10067565	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300016404\|Ga0182037_11715886	Not Available	560	Open in IMG/M
3300017966\|Ga0187776_11012749	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300018053\|Ga0184626_10014587	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	3125	Open in IMG/M
3300018059\|Ga0184615_10059912	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2123	Open in IMG/M
3300018063\|Ga0184637_10083563	All Organisms → cellular organisms → Bacteria	1960	Open in IMG/M
3300018063\|Ga0184637_10174826	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1322	Open in IMG/M
3300018063\|Ga0184637_10540864	All Organisms → cellular organisms → Bacteria	671	Open in IMG/M
3300018422\|Ga0190265_10291868	All Organisms → cellular organisms → Bacteria	1697	Open in IMG/M
3300018422\|Ga0190265_11799629	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300018431\|Ga0066655_10245573	All Organisms → cellular organisms → Bacteria	1139	Open in IMG/M
3300018468\|Ga0066662_12260472	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300018482\|Ga0066669_11275903	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	664	Open in IMG/M
3300018482\|Ga0066669_12399844	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300019249\|Ga0184648_1183364	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	549	Open in IMG/M
3300019458\|Ga0187892_10032441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	4185	Open in IMG/M
3300019789\|Ga0137408_1044791	All Organisms → cellular organisms → Bacteria	2507	Open in IMG/M
3300020067\|Ga0180109_1013196	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	965	Open in IMG/M
3300021081\|Ga0210379_10431669	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300022756\|Ga0222622_11089206	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	588	Open in IMG/M
3300025165\|Ga0209108_10266436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	868	Open in IMG/M
3300025324\|Ga0209640_10813712	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300025910\|Ga0207684_10314099	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1351	Open in IMG/M
3300025919\|Ga0207657_10294616	All Organisms → cellular organisms → Bacteria	1286	Open in IMG/M
3300025923\|Ga0207681_11059950	All Organisms → cellular organisms → Bacteria	681	Open in IMG/M
3300025939\|Ga0207665_11451743	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	546	Open in IMG/M
3300026001\|Ga0208000_115385	Not Available	511	Open in IMG/M
3300026095\|Ga0207676_12072815	All Organisms → cellular organisms → Bacteria	567	Open in IMG/M
3300026528\|Ga0209378_1100830	All Organisms → cellular organisms → Bacteria	1275	Open in IMG/M
3300026536\|Ga0209058_1335668	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	522	Open in IMG/M
3300026538\|Ga0209056_10039316	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	4358	Open in IMG/M
3300026552\|Ga0209577_10219363	All Organisms → cellular organisms → Bacteria	1450	Open in IMG/M
3300026827\|Ga0207591_107563	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	554	Open in IMG/M
3300027511\|Ga0209843_1049717	Not Available	742	Open in IMG/M
3300027862\|Ga0209701_10429408	All Organisms → cellular organisms → Bacteria → Proteobacteria	731	Open in IMG/M
3300027907\|Ga0207428_10013931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	7005	Open in IMG/M
3300027909\|Ga0209382_10244186	All Organisms → cellular organisms → Bacteria	2041	Open in IMG/M
3300027964\|Ga0256864_1156686	All Organisms → cellular organisms → Bacteria	648	Open in IMG/M
3300028809\|Ga0247824_10075300	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus	1755	Open in IMG/M
3300028878\|Ga0307278_10356429	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	645	Open in IMG/M
3300030830\|Ga0308205_1031788	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10089569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	821	Open in IMG/M
3300031228\|Ga0299914_10010253	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	7162	Open in IMG/M
3300031538\|Ga0310888_10367820	All Organisms → cellular organisms → Bacteria → Proteobacteria	837	Open in IMG/M
3300031716\|Ga0310813_11822889	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	572	Open in IMG/M
3300031740\|Ga0307468_100477883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927	980	Open in IMG/M
3300031764\|Ga0318535_10113480	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1193	Open in IMG/M
3300031833\|Ga0310917_10288444	Not Available	1109	Open in IMG/M
3300031894\|Ga0318522_10297924	Not Available	611	Open in IMG/M
3300031897\|Ga0318520_11016960	Not Available	524	Open in IMG/M
3300032174\|Ga0307470_10936318	All Organisms → cellular organisms → Bacteria → Proteobacteria	684	Open in IMG/M
3300032205\|Ga0307472_102475237	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	528	Open in IMG/M
3300033814\|Ga0364930_0076585	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1142	Open in IMG/M
3300034056\|Ga0373893_062293	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum	525	Open in IMG/M
3300034090\|Ga0326723_0270576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	759	Open in IMG/M
3300034643\|Ga0370545_116571	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	595	Open in IMG/M
3300034664\|Ga0314786_072078	Not Available	696	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	89.09%
Host-Associated	Host-Associated	10.00%
Engineered	Engineered	0.91%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	76.36%
Aquatic	Environmental → Aquatic	12.73%
Plants	Host-Associated → Plants	10.00%
Bioremediation	Engineered → Bioremediation	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	73.64%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.18%
Sediment	Environmental → Aquatic → Sediment	7.27%
Freshwater	Environmental → Aquatic → Freshwater	3.64%
Marine	Environmental → Aquatic → Marine	1.82%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.82%
Peat	Environmental → Terrestrial → Peat	0.91%
Cave	Environmental → Terrestrial → Cave	0.91%
Floodplain	Environmental → Terrestrial → Floodplain	0.91%
Metal	Engineered → Bioremediation → Metal	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	60.00%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.27%
Loam	Environmental → Terrestrial → Soil → Loam	7.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.36%
Sand	Environmental → Terrestrial → Soil → Sand	3.64%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.73%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.73%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.82%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.82%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.82%
Lake	Environmental → Aquatic → Freshwater → Lake	0.91%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.91%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.91%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	30.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	15.45%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.27%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.27%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.36%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.64%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.64%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	3.64%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.73%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.73%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.73%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.82%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.82%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.91%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.91%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.91%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.91%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	12.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	10.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.36%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.45%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	5.45%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.45%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.55%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	4.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.64%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.64%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	2.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.73%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.73%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	2.73%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.82%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.82%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.91%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.91%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.91%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.91%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.91%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.91%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.91%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.91%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	0.91%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.91%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	0.91%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.91%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000443	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly	Environmental	Open in IMG/M
3300002912	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm	Environmental	Open in IMG/M
3300003987	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2	Environmental	Open in IMG/M
3300004024	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009799	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30	Environmental	Open in IMG/M
3300009806	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014262	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1	Environmental	Open in IMG/M
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019249	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020067	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025165	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026001	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 (SPAdes)	Environmental	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026827	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes)	Environmental	Open in IMG/M
3300027511	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027964	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq	Environmental	Open in IMG/M
3300028809	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300030830	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031197 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1	Environmental	Open in IMG/M
3300031228	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031764	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031894	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033814	Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17	Environmental	Open in IMG/M
3300034056	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3	Engineered	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034643	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034664	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.23
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.23
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F086855

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1004859921	3300000364	Soil	DDTFFIRVTGGDVETKXTLRFDVEKKTVEVANRAQGQR*
F12B_102334281	3300000443	Soil	FFIRVTGGDVETKETNRFDVAKQTVEVANRAMGQR*
JGI25386J43895_101541491	3300002912	Grasslands Soil	SIEYGDDTFFIRVTGGDVETKKTLRFDLEKKAVQVADRAQGQR*
Ga0055471_100872291	3300003987	Natural And Restored Wetlands	IEYGDDTFFIRVTGGDVESKETLRFDVAGKTVQVANRAQGQR*
Ga0055436_100056873	3300004024	Natural And Restored Wetlands	DIHSIEFGDDTFFIRVTGGDVETKDTLRFDVAQNTVEVASRAQGQR*
Ga0062595_1008019223	3300004479	Soil	FGDDTFFIRVTGGDVETKETNRFDVAKKTVEVANRAMGQR*
Ga0062595_1010816621	3300004479	Soil	FGDDTFFIRVTGGDVETKETHRFDVEKKTVEVANRAIGQR*
Ga0066673_103505321	3300005175	Soil	SIEYGDDTFFIRVTGGDVESKQTLKFDAAKKTVEVANRALGQR*
Ga0070705_1017836652	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	SIEFGDDTFFIRVTGGDVESKETNRFDVAKQTVEVANRALGQR*
Ga0070698_10001399110	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	IHSIEFGDDTFFIRVTGGDVETKETHRFDVEKQTVEVANRAIGQR*
Ga0066707_105446422	3300005556	Soil	FGDDTFFIRVTGGDVEKKQTLKFDPDKKTVEVANRALGQR*
Ga0066698_109027971	3300005558	Soil	HSIEYGDDTFFIRVTGGDVESQKTLRFDLDKKSVQVADRAQGQR*
Ga0066670_107079411	3300005560	Soil	DDTFFIRVTGGDVETKQTLKFDPEKKTVEVANRALGQR*
Ga0066691_105778572	3300005586	Soil	TFFIRVTGGDVERKQTLKFDAAKKTVEVANRALGQR*
Ga0066905_1008242311	3300005713	Tropical Forest Soil	DDTFFIRVTGGDVEQQKTLRFDPDKKAVQVADRAQGQR*
Ga0074479_107108052	3300005829	Sediment (Intertidal)	FIRVTGGDVETKETHRFDVEKKTVEVANRAKGER*
Ga0068862_1003311664	3300005844	Switchgrass Rhizosphere	IEFGDDTFFIRVTGGDVETKKTLKFDKDKKTVEVADRAMNQR*
Ga0066656_107935042	3300006034	Soil	HSIEYGDDTFFIRVTGGDVESNKTLRFDLEKKSVQVADRAQGQR*
Ga0075028_1007450592	3300006050	Watersheds	SIEFGDDTFFIRVTGGDVESKETHRFDVEKKTVQVANRALGQR*
Ga0066660_110237562	3300006800	Soil	DDTFFIRVTGGDVETKKTLRFDLEKKTVQVADRAQGQR*
Ga0079220_103074031	3300006806	Agricultural Soil	FGDDTFFIRVTGGDVETKETNRFDVHKKTVEVANRALGQR*
Ga0075421_1010336553	3300006845	Populus Rhizosphere	TFFIRVTGGDVETKETNRFDVAKQTVEVANRAMGQR*
Ga0075430_1007160143	3300006846	Populus Rhizosphere	FGDDTFFIRVTGGDVEIKETLRFDPEKKTVTVANRALGQR*
Ga0075424_1024202673	3300006904	Populus Rhizosphere	IEFGDDTFFIRVTGGDVETKQTLKFDVEKKTVEVANRALGQR*
Ga0099793_106550991	3300007258	Vadose Zone Soil	SIEYGDDTFFIRVTGGDVESKKTLRFDLEKKSVHVADRAQGQR*
Ga0099829_107019871	3300009038	Vadose Zone Soil	DTFFIRVTGGDVETKETLRFDVEKKTVEVANRAKGQR*
Ga0099830_102469461	3300009088	Vadose Zone Soil	IEFGDDTFFLRVTGGDVESKETRRFDVEKKTVEIANRALGQR*
Ga0066709_1031050482	3300009137	Grasslands Soil	FGNDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAKGQR*
Ga0114129_106003413	3300009147	Populus Rhizosphere	EYGNDTFFIRVTGGDVETKQTLKFDVEKKTVEVANRALGQR*
Ga0105248_100854865	3300009177	Switchgrass Rhizosphere	DDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR*
Ga0105075_10429441	3300009799	Groundwater Sand	HSIEYGDDTFFIRVTGGDVESQKTLRFDLEKKSVQVADRALGQR*
Ga0105081_10123512	3300009806	Groundwater Sand	EYGDDTFFLRVTGGDVESQKTLRFDLDKKSVQVADRAQGQR*
Ga0126382_105979991	3300010047	Tropical Forest Soil	TFFIRVTGGDVETKKTLRFDPEKKAVQIADRAQGQR*
Ga0134082_101709731	3300010303	Grasslands Soil	FFVRVTGGDVETKETLRFDVEKKTVEIANRAQGQR*
Ga0134067_101780662	3300010321	Grasslands Soil	FFLRVTGGDVETKKTLRFDLEKKTVQVADRAQGQR*
Ga0134071_106976322	3300010336	Grasslands Soil	DDTFFVRVTGGDVETKETLRFDVEKKTVEIANRARGQR*
Ga0126376_131018351	3300010359	Tropical Forest Soil	IHSIEYGDDTIFLRVTGGDVESQETLRFDVEQKTVTVANRALGQR*
Ga0126372_116422532	3300010360	Tropical Forest Soil	YGDDTFFIRVTGGDVETKKTLRFDPEKKTVQIADRAQGQR*
Ga0126377_101648231	3300010362	Tropical Forest Soil	TFFIRVTGGDVEQQKTLRFDPDKKAVQVADRAQGQR*
Ga0136847_101417683	3300010391	Freshwater Sediment	MKYPTGGRHETKETHRFDVGQQTVEVANRAQGQR*
Ga0137391_113952813	3300011270	Vadose Zone Soil	DAGSDDTFFIRVTGGDVETRKTLKFDAERKTVEVADRALGQR*
Ga0137362_112714932	3300012205	Vadose Zone Soil	DIHSIEFGDDTFFIRVTGGDVETKETHRFDVEKKTVAVANRAIGQR*
Ga0137381_105645121	3300012207	Vadose Zone Soil	IEYGDDTFFIRVTGGDVESQKTLRFDLDKKSVQVADRAQGQR*
Ga0137367_101581501	3300012353	Vadose Zone Soil	IEFGNDTFFIRVTGGDVETKETLRFDVERKTVEVANRAKGQR*
Ga0137369_102529123	3300012355	Vadose Zone Soil	FGDDTFFLRVTGGDVETKDTLRFDVEKKTVEVANRAKGQR*
Ga0137397_102777852	3300012685	Vadose Zone Soil	FGDDTFFIRVTGGDVEKQQTLKFDPDKKTVEVANRALGQR*
Ga0137359_103160402	3300012923	Vadose Zone Soil	HSIEYGDDTFFIRVTGGDVETMKTLKFDKDKQTVEVADRAMNQR*
Ga0137410_116570472	3300012944	Vadose Zone Soil	SIEYGDDTFFIRVTGGDVESKKTLRFDLEQKTVKVADRAQGQR*
Ga0126375_102108781	3300012948	Tropical Forest Soil	IFLRVTGGDVESKETHRFDVEKQTVEIANRAMGQR*
Ga0126369_105230521	3300012971	Tropical Forest Soil	HSIEYGDDTFFIRVTGGDVEQQKTLRFDPDKKAVQVADRAQGQR*
Ga0134075_101128163	3300014154	Grasslands Soil	EYGDDTFFIRVTGGDVESNKTLRFDLEKKSVQVADRAQGQR*
Ga0075301_11825652	3300014262	Natural And Restored Wetlands	SIEFGDDTFFIRVTGGDVETKETLRFDVDKKTVTVADRAQGQR*
Ga0137411_10251464	3300015052	Vadose Zone Soil	TFFLRVTGGDVETKETHRFDVEKKTVEIANRAKGER*
Ga0134073_100675652	3300015356	Grasslands Soil	FFVRVTGGDVETKETLRFDVEKKTVEIANRARGQR*
Ga0182037_117158861	3300016404	Soil	DDTFFIRVTGGDVETKKTLRFDPEKKSVQIADRAQGQR
Ga0187776_110127492	3300017966	Tropical Peatland	EFGDDTFFLRVTGGDVETKETLRFDVANKTVEVANRAQGQR
Ga0184626_100145875	3300018053	Groundwater Sediment	DDTFFLRVTGGDVETKKTLKFDLEKKTVEVADRAMNQR
Ga0184615_100599124	3300018059	Groundwater Sediment	FGDDTFFLRVTGGDVESKKTLKFDKDKKTVEVADRAMNQR
Ga0184637_100835631	3300018063	Groundwater Sediment	EFGDDTFFLRVTGGDVETKETHRFDVDKQTVEIANRAKGQR
Ga0184637_101748264	3300018063	Groundwater Sediment	FFIRVTGGDVETQKTLRFDVEKKTVEVANRALNQR
Ga0184637_105408642	3300018063	Groundwater Sediment	DIHSIEFGPDTFFIRVTGGDVESKETFRFDVDKKTVQVANRALGQR
Ga0190265_102918681	3300018422	Soil	IHSIEFGDDTFFIRVTGGDVETKETHRFDVEKKTVEIANRAQGQR
Ga0190265_117996292	3300018422	Soil	SIEFGDDTFFIRVTGGDVETKKTLKFDKDKKTVEVADRAMNQR
Ga0066655_102455731	3300018431	Grasslands Soil	DIHSIEYGNDTFFIRVTGGDVETKQTLKFDPEKKTVEVANRALGQR
Ga0066662_122604722	3300018468	Grasslands Soil	SIAYGDYTFFILVTGVDVEKQKTLRFHLEKQTVEVEDRAQHLQ
Ga0066669_112759032	3300018482	Grasslands Soil	TFFIRVTGGDVEKKQTLKFDPDKKTVEVANRALGQR
Ga0066669_123998442	3300018482	Grasslands Soil	FFIRVTGGDVESKETLRFDVEKKTVEVANRAKGQR
Ga0184648_11833642	3300019249	Groundwater Sediment	DDTFFLRVTGGDVETKETHRFDVEKQTVEVANRAKGQR
Ga0187892_100324411	3300019458	Bio-Ooze	EYGDDTFFIRVTGGDVESKETHRFDVDKKTVEIANRALGQR
Ga0137408_10447911	3300019789	Vadose Zone Soil	IHSIEFGDDTFFLRVTGGDVETKETHRFDVEKKTVEIANRAKGER
Ga0180109_10131963	3300020067	Groundwater Sediment	GDDTFFIRVTGGDVETKETLRFDVEKKTVEVANRSQGQR
Ga0210379_104316693	3300021081	Groundwater Sediment	DDTFFLRVTGGDVETKKTLKFDKEKKTVEVADRAMNQR
Ga0222622_110892061	3300022756	Groundwater Sediment	DIHSIEFGDDTFFLRVTGGDVETKETHRFDVEKKTVEIANRAQGQR
Ga0209108_102664363	3300025165	Soil	SIEFGDDTFFIRVTGGDVETNETHRFDVEKKTVEIANRAQGQR
Ga0209640_108137121	3300025324	Soil	HSIEFGDDTFFIRVTGGDVETQKTLKFDPDKKTVEIADRALNQR
Ga0207684_103140993	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	IEFGDDTFFIRVTGGDVETKQTHRFDVEKKTVEVANRALGQR
Ga0207657_102946161	3300025919	Corn Rhizosphere	MPFVFGDDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR
Ga0207681_110599503	3300025923	Switchgrass Rhizosphere	FFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR
Ga0207665_114517432	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	EFGDDTFFIRVTGGDVETKETHRFDVEKKTVEVANRAIGQR
Ga0208000_1153851	3300026001	Rice Paddy Soil	EFGDDTFFLRVTGGDVETKETNRFDVEKKTVEVANRALGQR
Ga0207676_120728151	3300026095	Switchgrass Rhizosphere	HSIEFGDDTFFIRVTGGDVETKETLRFDVEKKTVEVANRAQGQR
Ga0209378_11008301	3300026528	Soil	DDTFFIRVTGGDVETKKTLRFDLEKKTVQVADRAQGQR
Ga0209058_13356681	3300026536	Soil	HSIEYGDDTFFIRVTGGDVESKKTLRFDLEKKTVQVADRAQGQR
Ga0209056_100393161	3300026538	Soil	FFIRVTGGDVESKKTLRFDLEKKSVQVADRAQGQR
Ga0209577_102193631	3300026552	Soil	SIEYGDDTFFIRVTGGDVETKKTLRFDLEKKTVQVADRAQGQR
Ga0207591_1075633	3300026827	Soil	YGDDTFFIRVTGGDVETKQTLKFDKDRKTVEVANRAMGQR
Ga0209843_10497172	3300027511	Groundwater Sand	SIEYGDDTFFIRVTGGDVESQKTLRFDLEKKSVNVADRAFGQR
Ga0209701_104294083	3300027862	Vadose Zone Soil	IEFGDDTFFLRVTGGDVESKETRRFDVEKKTVEIANRALGQR
Ga0207428_100139319	3300027907	Populus Rhizosphere	IFIRVTGGDVESKQTFRFDPEKDTVEVANRALGQR
Ga0209382_102441861	3300027909	Populus Rhizosphere	EFGDDTFFLRVTGGDVETKETHRFDVDKKTVEIANRALGQR
Ga0256864_11566862	3300027964	Soil	IHSIEFGDDTFFIRVTGGDVETQKTLKFDPDRKTVEVADRALNQR
Ga0247824_100753001	3300028809	Soil	TFFIRVTGGDVETKQTLKFDAEKKTVEVANRAMGQR
Ga0307278_103564292	3300028878	Soil	IEFGDDTFFLRVTGGDVETKKTLKFDLEKKTVEVADRAMNQR
Ga0308205_10317881	3300030830	Soil	HSIAYGDDTFFIRVTGGDVEKHKTLRFNLDKQTVEVEDRGQRPR
(restricted) Ga0255310_100895693	3300031197	Sandy Soil	DTFFIRVTGGDVETKETRRFDLEKKTVEIANRANGQR
Ga0299914_100102537	3300031228	Soil	MSQDTLDGDVETKKTLRFDAEQKTAKVTDRALNQR
Ga0310888_103678201	3300031538	Soil	EFGDDTFFIRVTGGDVETKETNRFDVEKKTVEVANRAVGQR
Ga0310813_118228891	3300031716	Soil	EFGDDTFFIRVTGGDVETKETHRFDVEKKTVEVVNRALGQR
Ga0307468_1004778831	3300031740	Hardwood Forest Soil	HSIEYGDDTFFIRVTGGDVETKKTNKFDPDKKTVEVADRSRGQR
Ga0318535_101134802	3300031764	Soil	FFIRVTGGDVETKKTLRFDPEKKTVQIADRAQGQR
Ga0310917_102884441	3300031833	Soil	GDDTFFIRVTGGDVETKKTLRFDPEKKTVQIADRAQGQR
Ga0318522_102979241	3300031894	Soil	EYGDDTIFIRVTGGDVETKKTLRFDPEKKSVQIADRAQGQR
Ga0318520_110169601	3300031897	Soil	EYGDDTFFIRVTGGDVETKKTLRFDPEKKSVQIADRAQGQR
Ga0307470_109363183	3300032174	Hardwood Forest Soil	DDTFFIRVTGGDVESKETNRFDVEKKTVEVANRALGQR
Ga0307472_1024752371	3300032205	Hardwood Forest Soil	FGDDTFFIRVTGGDVETKETLKFDVEKKTVEIANRALGQR
Ga0364930_0076585_2_130	3300033814	Sediment	IEFGDDTFFIRVTGGDVETKETLRFNVKQKTVEVANRAQGQR
Ga0373893_062293_2_115	3300034056	Sediment Slurry	DTFFIQVTGGDVETKETLRFDVDKRTVEIADRARGQQ
Ga0326723_0270576_651_758	3300034090	Peat Soil	FFIRVTGGDVETKETHRFDVEKKTVEVANRALGQR
Ga0370545_116571_442_588	3300034643	Soil	VGDIYSIEFGDDTFFIRVTGGDVETKETHRFDVEKKTMEIANRAKGQR
Ga0314786_072078_2_133	3300034664	Soil	SIEYGDDTFFIRVTGGDVETKKTLRFDLEKKSVQIADRAQGQR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign