| Basic Information | |
|---|---|
| Family ID | F086830 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TMTILSKYIDNLTLNVESEKLKTLMRELYVEALNTERTE |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.64 % |
| % of genes near scaffold ends (potentially truncated) | 91.82 % |
| % of genes from short scaffolds (< 2000 bps) | 87.27 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.909 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (21.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.545 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13476 | AAA_23 | 67.27 |
| PF13640 | 2OG-FeII_Oxy_3 | 10.91 |
| PF01327 | Pep_deformylase | 6.36 |
| PF02463 | SMC_N | 1.82 |
| PF13555 | AAA_29 | 1.82 |
| PF01555 | N6_N4_Mtase | 0.91 |
| PF00149 | Metallophos | 0.91 |
| PF04851 | ResIII | 0.91 |
| PF02945 | Endonuclease_7 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 6.36 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.91 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.91 % |
| All Organisms | root | All Organisms | 49.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02F3ZI2 | Not Available | 502 | Open in IMG/M |
| 3300001838|RCM33_1000549 | All Organisms → Viruses → Predicted Viral | 2697 | Open in IMG/M |
| 3300001843|RCM34_1007752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1092 | Open in IMG/M |
| 3300002835|B570J40625_100198337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2181 | Open in IMG/M |
| 3300002835|B570J40625_100571419 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300005581|Ga0049081_10041804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1740 | Open in IMG/M |
| 3300005582|Ga0049080_10002473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 6362 | Open in IMG/M |
| 3300005582|Ga0049080_10216445 | Not Available | 630 | Open in IMG/M |
| 3300005662|Ga0078894_11148539 | Not Available | 660 | Open in IMG/M |
| 3300006802|Ga0070749_10561304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 618 | Open in IMG/M |
| 3300006875|Ga0075473_10436476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 529 | Open in IMG/M |
| 3300007540|Ga0099847_1243193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 518 | Open in IMG/M |
| 3300007974|Ga0105747_1274428 | Not Available | 567 | Open in IMG/M |
| 3300007992|Ga0105748_10564152 | Not Available | 501 | Open in IMG/M |
| 3300008110|Ga0114343_1094572 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300008117|Ga0114351_1449659 | Not Available | 521 | Open in IMG/M |
| 3300008120|Ga0114355_1036949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2765 | Open in IMG/M |
| 3300008259|Ga0114841_1076993 | All Organisms → Viruses → Predicted Viral | 1524 | Open in IMG/M |
| 3300008267|Ga0114364_1038504 | All Organisms → Viruses → Predicted Viral | 1805 | Open in IMG/M |
| 3300008448|Ga0114876_1020898 | All Organisms → Viruses → Predicted Viral | 3402 | Open in IMG/M |
| 3300008448|Ga0114876_1157870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300009068|Ga0114973_10150642 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
| 3300009154|Ga0114963_10226932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300009155|Ga0114968_10051000 | All Organisms → Viruses → Predicted Viral | 2666 | Open in IMG/M |
| 3300009164|Ga0114975_10277940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300009164|Ga0114975_10431296 | Not Available | 716 | Open in IMG/M |
| 3300009169|Ga0105097_10441858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300009181|Ga0114969_10707277 | Not Available | 542 | Open in IMG/M |
| 3300009184|Ga0114976_10133953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
| 3300009187|Ga0114972_10466769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300009507|Ga0115572_10611279 | Not Available | 600 | Open in IMG/M |
| 3300009785|Ga0115001_10016023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 5053 | Open in IMG/M |
| 3300010157|Ga0114964_10313066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300010160|Ga0114967_10650796 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 503 | Open in IMG/M |
| 3300010885|Ga0133913_11115564 | All Organisms → Viruses → Predicted Viral | 2030 | Open in IMG/M |
| 3300010885|Ga0133913_11406376 | Not Available | 1774 | Open in IMG/M |
| 3300010885|Ga0133913_13178471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1087 | Open in IMG/M |
| 3300011010|Ga0139557_1002474 | All Organisms → Viruses → Predicted Viral | 4112 | Open in IMG/M |
| 3300012013|Ga0153805_1072422 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 584 | Open in IMG/M |
| 3300012920|Ga0160423_10347793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
| 3300013372|Ga0177922_10298575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300013372|Ga0177922_10584650 | Not Available | 612 | Open in IMG/M |
| 3300017744|Ga0181397_1151015 | Not Available | 594 | Open in IMG/M |
| 3300017756|Ga0181382_1103129 | Not Available | 771 | Open in IMG/M |
| 3300017761|Ga0181356_1076251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
| 3300017766|Ga0181343_1084957 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300017766|Ga0181343_1084958 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300017766|Ga0181343_1161386 | Not Available | 622 | Open in IMG/M |
| 3300017766|Ga0181343_1194330 | Not Available | 557 | Open in IMG/M |
| 3300017784|Ga0181348_1295596 | Not Available | 544 | Open in IMG/M |
| 3300017785|Ga0181355_1147705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300017785|Ga0181355_1173707 | Not Available | 859 | Open in IMG/M |
| 3300018416|Ga0181553_10613726 | Not Available | 574 | Open in IMG/M |
| 3300020048|Ga0207193_1543763 | Not Available | 771 | Open in IMG/M |
| 3300020161|Ga0211726_10132349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1199 | Open in IMG/M |
| 3300020161|Ga0211726_10770906 | Not Available | 1088 | Open in IMG/M |
| 3300020172|Ga0211729_10309378 | Not Available | 564 | Open in IMG/M |
| 3300020172|Ga0211729_10519705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 809 | Open in IMG/M |
| 3300020172|Ga0211729_11062812 | All Organisms → Viruses → Predicted Viral | 1635 | Open in IMG/M |
| 3300020183|Ga0194115_10001303 | Not Available | 32070 | Open in IMG/M |
| 3300020204|Ga0194116_10334293 | Not Available | 780 | Open in IMG/M |
| 3300020221|Ga0194127_10716233 | Not Available | 625 | Open in IMG/M |
| 3300020527|Ga0208232_1014865 | Not Available | 1162 | Open in IMG/M |
| 3300021093|Ga0194123_10140857 | Not Available | 1316 | Open in IMG/M |
| 3300021959|Ga0222716_10316527 | Not Available | 936 | Open in IMG/M |
| 3300021961|Ga0222714_10331608 | Not Available | 824 | Open in IMG/M |
| 3300023179|Ga0214923_10060389 | Not Available | 2803 | Open in IMG/M |
| 3300024289|Ga0255147_1095595 | Not Available | 548 | Open in IMG/M |
| 3300024515|Ga0255183_1106096 | Not Available | 547 | Open in IMG/M |
| 3300025436|Ga0208103_1047381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 594 | Open in IMG/M |
| 3300025889|Ga0208644_1401555 | Not Available | 504 | Open in IMG/M |
| 3300027586|Ga0208966_1007483 | All Organisms → Viruses → Predicted Viral | 3271 | Open in IMG/M |
| 3300027608|Ga0208974_1130619 | Not Available | 650 | Open in IMG/M |
| 3300027621|Ga0208951_1178714 | Not Available | 539 | Open in IMG/M |
| 3300027736|Ga0209190_1324504 | Not Available | 579 | Open in IMG/M |
| 3300027747|Ga0209189_1384570 | Not Available | 525 | Open in IMG/M |
| 3300027749|Ga0209084_1218521 | Not Available | 757 | Open in IMG/M |
| 3300027749|Ga0209084_1289965 | Not Available | 621 | Open in IMG/M |
| 3300027759|Ga0209296_1002187 | Not Available | 14274 | Open in IMG/M |
| 3300027759|Ga0209296_1161733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300027760|Ga0209598_10315112 | Not Available | 607 | Open in IMG/M |
| 3300027772|Ga0209768_10340257 | Not Available | 617 | Open in IMG/M |
| 3300027782|Ga0209500_10280483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300027963|Ga0209400_1332036 | Not Available | 570 | Open in IMG/M |
| 3300028275|Ga0255174_1048213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
| 3300028394|Ga0304730_1146123 | Not Available | 956 | Open in IMG/M |
| 3300028394|Ga0304730_1238090 | Not Available | 663 | Open in IMG/M |
| 3300031758|Ga0315907_10319503 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
| 3300031758|Ga0315907_11004405 | Not Available | 602 | Open in IMG/M |
| 3300031784|Ga0315899_10265737 | Not Available | 1707 | Open in IMG/M |
| 3300031787|Ga0315900_10363319 | All Organisms → Viruses → Predicted Viral | 1161 | Open in IMG/M |
| 3300031787|Ga0315900_10929625 | Not Available | 581 | Open in IMG/M |
| 3300031857|Ga0315909_10577927 | Not Available | 756 | Open in IMG/M |
| 3300031857|Ga0315909_10992530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300032092|Ga0315905_10310978 | Not Available | 1509 | Open in IMG/M |
| 3300033233|Ga0334722_10683764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300033979|Ga0334978_0606142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 504 | Open in IMG/M |
| 3300033992|Ga0334992_0359940 | Not Available | 664 | Open in IMG/M |
| 3300033994|Ga0334996_0020902 | All Organisms → Viruses → Predicted Viral | 4255 | Open in IMG/M |
| 3300033994|Ga0334996_0294674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300034061|Ga0334987_0421649 | Not Available | 838 | Open in IMG/M |
| 3300034072|Ga0310127_263719 | Not Available | 605 | Open in IMG/M |
| 3300034072|Ga0310127_282625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300034082|Ga0335020_0243735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
| 3300034102|Ga0335029_0212776 | Not Available | 1275 | Open in IMG/M |
| 3300034103|Ga0335030_0497778 | Not Available | 769 | Open in IMG/M |
| 3300034107|Ga0335037_0626875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300034109|Ga0335051_0511708 | Not Available | 557 | Open in IMG/M |
| 3300034112|Ga0335066_0685257 | Not Available | 519 | Open in IMG/M |
| 3300034283|Ga0335007_0326054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 21.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.36% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.45% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.55% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.73% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.82% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.82% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.82% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.82% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.82% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.91% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.91% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.91% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.91% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.91% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.91% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.91% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024515 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d | Environmental | Open in IMG/M |
| 3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_5494000 | 2035265000 | Freshwater | MTILSKYIDGLTLDVDSVKLKNLMRELYIESLNVEVTE |
| RCM33_10005491 | 3300001838 | Marine Plankton | EDTMSILSNYIDGATLDVNNEKLKTIMRELYVEAVNAERSE* |
| RCM34_10077521 | 3300001843 | Marine Plankton | DTMTILSKYIDNLTLNVDNVKLKNLMKELYVEALTTETE* |
| B570J40625_1001983371 | 3300002835 | Freshwater | EDTITILSKYIDNLTLDVEPEKLKTLMRELYVEALNTEVAE* |
| B570J40625_1005714192 | 3300002835 | Freshwater | QEIIDQAEDTMTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE* |
| Ga0049081_100418041 | 3300005581 | Freshwater Lentic | TMTILSKYIDNLTLNVESEKLKTLMRELYIEALNTETTE* |
| Ga0049080_100024731 | 3300005582 | Freshwater Lentic | AEDTMTILSKYIDNLTLNVERDKLKNLMKELYVEALNTETTE* |
| Ga0049080_102164452 | 3300005582 | Freshwater Lentic | AEDTMTILSKYIDNLTLNVERDKLKNLMKELYVEALNTETSE* |
| Ga0078894_111485391 | 3300005662 | Freshwater Lake | ILSKYIDNLTLNVDNDKLKTLMKELYVEALTTETE* |
| Ga0070749_105613042 | 3300006802 | Aqueous | FSILSKYIDNLTLDVDPKQLKVIMKEIYVEALSTEKAE* |
| Ga0075473_104364761 | 3300006875 | Aqueous | QAEDTMTILGKYIDNLTLNVDNDKLKALMREIYIEALTTETE* |
| Ga0099847_12431931 | 3300007540 | Aqueous | EDTMTILSKYIDGLTLNVEPDKLKKIMRELYVESLTTEIIE* |
| Ga0105747_12744281 | 3300007974 | Estuary Water | QAEDTITILNKYIDNLQLDIESDKLKTIMRELYVEALNTEIAE* |
| Ga0105748_105641522 | 3300007992 | Estuary Water | DADDDLIDQAEDTITILNKYIDNLQLDIESDKLKTIMRELYVEALNTEVSE* |
| Ga0114343_10945722 | 3300008110 | Freshwater, Plankton | ITILSKYIDNLTLDVEPEKLKTLMRELYVEALNTEVAE* |
| Ga0114351_14496592 | 3300008117 | Freshwater, Plankton | IDQAEDTMTILSKYIDNLSLDVEPEKLKILMRELYVEALNTEVAE* |
| Ga0114355_10369494 | 3300008120 | Freshwater, Plankton | MTILSKYIDNLELDVEPDKLKTLMRELYVEALNTEVAE* |
| Ga0114841_10769931 | 3300008259 | Freshwater, Plankton | VDQAEDTMTILSKYIDNLTINVEPVKLKSIMQELYVEALSTTTE* |
| Ga0114364_10385041 | 3300008267 | Freshwater, Plankton | DQAEDTMTILGKYIDNLTLNVESDKLKTLMRELYIEALNTETTE* |
| Ga0114876_10208985 | 3300008448 | Freshwater Lake | ILSKYIDNLQLQVEPDKLKSIMRELYVEALNTEVAE* |
| Ga0114876_11578701 | 3300008448 | Freshwater Lake | SKYIDNLTLDVQPEKLKTLMRELYVEALNTEVAE* |
| Ga0114973_101506421 | 3300009068 | Freshwater Lake | TMTILSKYIDNLSLQVEPEKLKTVMRELYVEALNVERTE* |
| Ga0114963_102269321 | 3300009154 | Freshwater Lake | IDQAEDTMTILSKYIDNLSLQVEPEKLKTVMRELYVEALNVERTE* |
| Ga0114968_100510001 | 3300009155 | Freshwater Lake | QAEDTMTILSKYIDNLPLTVEPDKLKGLMRELYVEALSSDTE* |
| Ga0114975_102779403 | 3300009164 | Freshwater Lake | DQAEDTMTILSKYIDNLTLNVENEKLKTLMRELYVEALNTERTE* |
| Ga0114975_104312963 | 3300009164 | Freshwater Lake | DTMTILSKYIDGLSLNVESEKLKTLMRELYVEALNLEKIE* |
| Ga0105097_104418582 | 3300009169 | Freshwater Sediment | EDQDLVDQAEDTMTILSKFIDNMTLDIETTKLKTIIREVYIEALNTEKTE* |
| Ga0114969_107072771 | 3300009181 | Freshwater Lake | DTMTILGKYIDNLTLNVESDKLKSLMRELYIEALNTETTE* |
| Ga0114976_101339532 | 3300009184 | Freshwater Lake | MTILSKYIDGLTLNVESEKLKTLMRELYVEALNLEKIE* |
| Ga0114972_104667692 | 3300009187 | Freshwater Lake | EIVDQAEDTMTILSKYIDNLTLNVENEKLKILMRELYVEALNTERTE* |
| Ga0115572_106112792 | 3300009507 | Pelagic Marine | TILSNYIDQQGVDVDSNKLKNLMRELYVEALAQETI* |
| Ga0115001_100160235 | 3300009785 | Marine | NQAEDTMTILSKYIDGLSLNVESEKLKTLMRELYVEALHTEETD* |
| Ga0114964_103130662 | 3300010157 | Freshwater Lake | EDTMTILSKYIDNLTLNVESEKLKTLMRELYIEALNTETTE* |
| Ga0114967_106507962 | 3300010160 | Freshwater Lake | SKYIDGLTLDVDSDKLKNLMRELYVESLNVEVTE* |
| Ga0133913_111155644 | 3300010885 | Freshwater Lake | LSHFIDNSQLNVETDKLKSLMRELYVEALNTEKAE* |
| Ga0133913_114063761 | 3300010885 | Freshwater Lake | QDIVDQAEDTMTILSKYIDGLELNVESNKLKSIMKEVYIEALNTETTE* |
| Ga0133913_131784711 | 3300010885 | Freshwater Lake | TMTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE* |
| Ga0139557_10024742 | 3300011010 | Freshwater | MTILSKYIDNLELNVDNEKLKTFMRELYVEALNTENIE* |
| Ga0153805_10724222 | 3300012013 | Surface Ice | DTMTILSKYIDNLELNVDNEKLKTFMRELYVEALNTENIE* |
| Ga0160423_103477931 | 3300012920 | Surface Seawater | MTILSKYIDDLPLNVEPEKLKNIMKELYVEALNEERV* |
| Ga0177922_102985752 | 3300013372 | Freshwater | DTMTILSKYIDNLTLNVESEKLKTLMRELYIEALNTETTE* |
| Ga0177922_105846501 | 3300013372 | Freshwater | LSKYIDNLTINVERDKLKNLMKELYVEALNTETSE* |
| Ga0181397_11510151 | 3300017744 | Seawater | DTMTILSKYIDDLPLNVEPEKLKNIMKELYVEALNEERT |
| Ga0181382_11031291 | 3300017756 | Seawater | NQAEDTMTILSKYIDDLPLNVEPEKLKNIMKELYVEALNEERT |
| Ga0181356_10762513 | 3300017761 | Freshwater Lake | DQAEDTMTILSKHIDNLTLNVNNEKLKTLMRELYVEALNTEVSE |
| Ga0181343_10849573 | 3300017766 | Freshwater Lake | DDLIDQAEDTITILNKYIDNLQLDIESDKLKTIMRELYVEALNTEIAE |
| Ga0181343_10849583 | 3300017766 | Freshwater Lake | DDLIDQAEDTITILNKYIDNLQLDIESDKLKTIMRELYVEALNTEVSE |
| Ga0181343_11613861 | 3300017766 | Freshwater Lake | DTMTILSKYIDNLTLNVESDKLKGLMRELYVEALNTETE |
| Ga0181343_11943301 | 3300017766 | Freshwater Lake | MTILSKYIDNLTLNVNSDKLKTLMRELYVEALNTETTE |
| Ga0181348_12955961 | 3300017784 | Freshwater Lake | ILSKYIDNLTLNVECEKLKTLMRELYIEALNTETTE |
| Ga0181355_11477053 | 3300017785 | Freshwater Lake | TILSKHIDNLTLNVNNEKLKTLMRELYVEALNTEVSE |
| Ga0181355_11737071 | 3300017785 | Freshwater Lake | DTMTILGKYIDNLTLNVESDKLKTLMRELYIEALNTETTE |
| Ga0181553_106137262 | 3300018416 | Salt Marsh | LSKYIDALELDVENDKLKKIMRELYVEALTTEVTD |
| Ga0207193_15437631 | 3300020048 | Freshwater Lake Sediment | DLVDQAEDTMTILSKFIDGLATNVDSTKLKGLMRELYVESLNVEIIE |
| Ga0211726_101323491 | 3300020161 | Freshwater | ILSKYIDNLPLDVEPEKLKAIMRELYIEAINTEVAE |
| Ga0211726_107709061 | 3300020161 | Freshwater | TILSKYIDNLTLTVDNDKLKTLMKELYVEALTTETE |
| Ga0211729_103093781 | 3300020172 | Freshwater | AEDTVTILSKYIDNLTLNVDNDKLKGLMRELYVEALNTEIE |
| Ga0211729_105197051 | 3300020172 | Freshwater | MTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE |
| Ga0211729_110628122 | 3300020172 | Freshwater | ILSKYIDNLTLNVESDKLKGLMRELYVEALNTETE |
| Ga0194115_1000130335 | 3300020183 | Freshwater Lake | MTILNRYIDNLALNVNGDKLKTLMRELYVEALNTETTE |
| Ga0194116_103342931 | 3300020204 | Freshwater Lake | QAEDTVTILSKYIDNLTLNVENDKLKGLMRELYVEALNIQIE |
| Ga0194127_107162332 | 3300020221 | Freshwater Lake | SLSKYIDNLELEVEPDKLKTLMRELYVEALNTEVAE |
| Ga0208232_10148652 | 3300020527 | Freshwater | ILSKYIDNLTLNVNSDKLKTLMRELYVEAINTETTE |
| Ga0194123_101408571 | 3300021093 | Freshwater Lake | IIDQAEDTMTILSKYIDALELDIENDQLKKLMRELYVEALNTEVTD |
| Ga0222716_103165272 | 3300021959 | Estuarine Water | LSKYIDGLKLEVNNEKLKDIMRELYTEALHTEETD |
| Ga0222714_103316081 | 3300021961 | Estuarine Water | DTMTILSKYIDNLTLNVEAEKLKTLMRELYVEAINTETTE |
| Ga0214923_100603895 | 3300023179 | Freshwater | LSKHIDNLTLNVNNEKLKTLMRELYVEALNTETTE |
| Ga0255147_10955952 | 3300024289 | Freshwater | MTILSKYIDNLTLNVESDKLKQVMQELYVEALSTETE |
| Ga0255183_11060961 | 3300024515 | Freshwater | VTILSKYIDNLTLNVDNDKLKVLMRELYVEALNTNIE |
| Ga0208103_10473813 | 3300025436 | Freshwater | DTMTILSKYIDNLPLTVEPDKLKGLMRELYVEALNTETE |
| Ga0208644_14015552 | 3300025889 | Aqueous | QAEDTMTILSKYIDNLELDVESEKLKKLMRELYVEALNTEIAE |
| Ga0208966_10074836 | 3300027586 | Freshwater Lentic | QAEDTMTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE |
| Ga0208974_11306192 | 3300027608 | Freshwater Lentic | ILSKYIDNLTLNVESDKLKTLMRELYIEALNTETTE |
| Ga0208951_11787142 | 3300027621 | Freshwater Lentic | EDTMTILSRYIDNLTLNVESDKLKSLMRELYIEALNTETTE |
| Ga0209190_13245041 | 3300027736 | Freshwater Lake | IDQAEDTMTILSKYIDNLSLQVEPEKLKTVMRELYVEALNVERTE |
| Ga0209189_13845702 | 3300027747 | Freshwater Lake | DTMTILSKYIDNLTLNVEGEKLKTLMRELYVEALNTEKTE |
| Ga0209084_12185212 | 3300027749 | Freshwater Lake | MTILSKYIDNLTLTVDNDKLKTLMKELYVEALNTETE |
| Ga0209084_12899651 | 3300027749 | Freshwater Lake | TMTILSKYIDNLTLTVENDKLKILMRELYVEALTTETE |
| Ga0209296_100218719 | 3300027759 | Freshwater Lake | EDTMTILSKYIDNLPLTVEPDKLKGLMRELYVEALSSDTE |
| Ga0209296_11617331 | 3300027759 | Freshwater Lake | AEDTMTILSKYIDNLTLNVENEKLKTLMRELYVEALNTERTE |
| Ga0209598_103151121 | 3300027760 | Freshwater Lake | DQAEDTMTILSKYIDNLSLQVEPEKLKTVMRELYVEALNVERTE |
| Ga0209768_103402571 | 3300027772 | Freshwater Lake | MTILSRYIDNLTLNVESEKLKTLMRELYIEALNTETTE |
| Ga0209500_102804832 | 3300027782 | Freshwater Lake | ILSKYIDNLTLNVESEKLKTLMRELYIEALNTETTE |
| Ga0209400_13320361 | 3300027963 | Freshwater Lake | DEDTMTILGKYIDNLTLNVESDKLKSLMRELYIEALNTETTE |
| Ga0255174_10482132 | 3300028275 | Freshwater | TMTILSKYIDGLQLNVEPDKLKTVMRELYVEALNVEKTE |
| Ga0304730_11461232 | 3300028394 | Freshwater Lake | ILSKYIDNLQLQVEPDKLKSIMRELYVEALNTEVAE |
| Ga0304730_12380902 | 3300028394 | Freshwater Lake | EDTMTILSKYIDNLTLNVESDKLKSLMRELYIEALNTETTE |
| Ga0315907_103195032 | 3300031758 | Freshwater | LSKYIDNLELDVEPDKLKTLMRELYVEALNTEVAE |
| Ga0315907_110044052 | 3300031758 | Freshwater | QELIDQAEDTMTILSKYIDNLTINVESDKLKKIMQELYVEALSTTTE |
| Ga0315899_102657372 | 3300031784 | Freshwater | ILSKYIDGLTLDVDSDKLKNLMRELYVESLNVEVTE |
| Ga0315900_103633192 | 3300031787 | Freshwater | EDTMTILSKYIDNLSLDVEPEKLKILMRELYVEALNTEVAE |
| Ga0315900_109296251 | 3300031787 | Freshwater | TMTILSKYIDNLELDVEPDKLKTLMRELYVEALNTEVAE |
| Ga0315909_105779272 | 3300031857 | Freshwater | QELVDQAEDTMTILSKYIDNLTINVEPVKLKSIMQELYVEALSTTTE |
| Ga0315909_109925302 | 3300031857 | Freshwater | DTMTILSKYIDNLTLNVENEKLKTLMRELYVEALNTERTE |
| Ga0315905_103109782 | 3300032092 | Freshwater | SAIDDQEIIDQAEDTMTILSKYIDNLTLDVEPDKLKNLMKEVYIEALNTETTE |
| Ga0334722_106837641 | 3300033233 | Sediment | DQAEDTMTILGKYIDNLTLSVESDKLKTLMRELYIEALNTETTEC |
| Ga0334978_0606142_373_489 | 3300033979 | Freshwater | MTILSKYIDNLPLDVEPEKLKSIMRELYIEAINTEVAE |
| Ga0334992_0359940_556_663 | 3300033992 | Freshwater | LSKYIDNLTLNVNSDKLKTLMRELYVEAINTETTE |
| Ga0334996_0020902_31_147 | 3300033994 | Freshwater | MTILSKYIDGLATNVDSTKLKGLMRELYVESLNVEIIE |
| Ga0334996_0294674_13_129 | 3300033994 | Freshwater | MTILSKYIDNLTLNVEAEKLKTLMRELYVEALNTEKAE |
| Ga0334987_0421649_1_150 | 3300034061 | Freshwater | VDQELIDQAEDTMTILSKYIDNLTINVEPDRLKKIMQELYVEALSTTTE |
| Ga0310127_263719_480_602 | 3300034072 | Fracking Water | MTILSKYIDGQELNVAPNRLKNLMQELYVEALSLETESNA |
| Ga0310127_282625_10_126 | 3300034072 | Fracking Water | MTILSKHIDNLTLDVEAEKLKTLMRELYIEALNTEIAE |
| Ga0335020_0243735_770_889 | 3300034082 | Freshwater | TMTILSKYIDNLTLNVESEKLKTLMRELYVEALNTERTE |
| Ga0335029_0212776_1152_1274 | 3300034102 | Freshwater | EDTVTILSKYIDNLTLNVENDKLKNLMRELYVEALNTELE |
| Ga0335030_0497778_661_768 | 3300034103 | Freshwater | LSKYIDNLTLDVEPEKLKTLVRELYVEALNTEVAE |
| Ga0335037_0626875_13_129 | 3300034107 | Freshwater | MTILSKYIDNLQLQVEPDKLKSIMRELYVEALNTEVAE |
| Ga0335051_0511708_447_557 | 3300034109 | Freshwater | ILSKYIDNLTLDVEPEKLKTLVRELYVEALNTEVAE |
| Ga0335066_0685257_2_145 | 3300034112 | Freshwater | EVIDQAEDTITILNKYIDGLTTNIESDKLKKIMRELYVEAINMESIE |
| Ga0335007_0326054_881_994 | 3300034283 | Freshwater | TILSKYIDNLTLDVESDKLKNIMRELYVEALNTEVAE |
| ⦗Top⦘ |